Knicks Go Adds Dash to Paynter's Palette

Total Page:16

File Type:pdf, Size:1020Kb

Load more

WEDNESDAY, NOVEMBER 25, 2020 KNICKS GO ADDS DASH TO A NEW HEIR TO WAR FRONT=S THRONE AT CLAIBORNE PAYNTER'S PALETTE by Katie Ritz War Front is undoubtedly heralded as one of America=s top turf sires, but Claiborne=s Bernie Sams said he finds any stereotype that the stallion is solely a grass producer unjustifiable. AI think War Front has been labeled to some extent as a turf sire, but unfairly so because he got his start with dirt stakes winners,@ he said. AThen a lot of people started breeding to him and taking a lot of them to Europe. He probably is equally as good on dirt as he is on turf, if we had as many of them here.@ Sams=s theory on War Front=s progeny comes to fruition in the versatile ability displayed by War of Will. Cont. p7 IN TDN EUROPE TODAY Knicks Go blazing home in the Breeders= Cup Dirt Mile UNIQUE ATTRACTIONS OF FLOORS BLOOD Breeders= Cup/Eclipse Sportswire Chris McGrath speaks to George Innes-Ker, the youngest son of the late Duke of Roxburghe regarding the dispersal of by Chris McGrath Floors Stud at the Tattersalls December Sales. Click or tap It's a tough game, selling nominations; and, except for those here to go straight to TDN Europe. sparkly new stallions, getting tougher all the time. So we should have every sympathy with the farms trying to drum up custom. True, WinStar doesn't hold back in introducing Paynter on his homepage as "one of the most popular and courageous runners in racing history." But if that's a pretty heady claim, even for a horse whose recovery from desperate illness so captured the hearts of the racing public, then the son of Awesome Again has certainly moved the conversation on. Because whatever else he may be, Paynter is now the sire of the fastest miler in Keeneland history--even as he takes his latest cut in fee, to just $7,500. Okay, they laid out a conveyor belt for the Breeders' Cup this year. Knicks Go, in the GI Big Ass Fans Dirt Mile, set only one in a blurred sequence of track records. (New benchmarks were also reached on the day at six, seven and 10 furlongs.) Even within that context, however, Knicks Go needs credit for the electrifying fashion in which he saw off a horse as fast as Complexity (Maclean's Music), kicking again off fractions of 21.98, 44.40 and 1:08.25 for a final time of 1:33.85. Bottom line is that we need to respect any stallion that can get a horse of such flair, out of Maryland, with first four dams by Outflanker, Allen's Prospect, Medaille d'Or and Cloudy Dawn. Cont. p3 -1 /2 The Only Horse In 2020 To Run A Negative Number On Ragozin. Faster than Gun Runner. Candy Ride's Best-Bred Multiple G1 Son. Candy Ride (Arg) - Mona de Momma, by Speightstown New for 2021: $20,000 S&N PUBLISHER & CEO Sue Morris Finley @suefinley [email protected] SENIOR VICE PRESIDENT Gary King @garykingTDN [email protected] EDITORIAL [email protected] Editor-in-Chief Jessica Martini @JessMartiniTDN Managing Editor Wednesday, November 25, 2020 Alan Carasso @EquinealTDN Senior Editor Steve Sherack @SteveSherackTDN Racing Editor Brian DiDonato @BDiDonatoTDN Deputy Editor Christie DeBernardis @CDeBernardisTDN Associate Editors Christina Bossinakis @CBossTDN Joe Bianca @JBiancaTDN News and Features Editor In Memoriam: Ben Massam (1988-2019) ADVERTISING [email protected] Director of Advertising Alycia Borer Advertising Manager Lia Best Advertising Designer Amanda Crelin Advertising Assistant/Dir. Of Distribution Rachel McCaffrey Advertising Assistants Amie Newcomb Kristen Lomasson Photographer/Photo Editor Sarah K. Andrew @SarahKAndrew [email protected] Social Media Strategist Pictured above in March, Red Right Hand (Lookin At Lucky), a track record holder at Justina Severni Delaware Park, is now retired from racing and ready for his next career through ReRun Thoroughbred Adoption in Greenbush, NY. If you're looking for unique holiday gifts, Associate Producer Katie Ritz click here to see ReRun's current "Moneigh" painting listings, including artwork by Frosted and Justify. All proceeds benefit the horses at ReRun. | Sarah Andrew Director of Customer Service Vicki Forbes [email protected] 2017 CANADIAN DERBY DECLARED OFFICIAL, AGAIN 9 Marketing Manager T.D. Thornton reports on the peculiar case of the heavily-litigated Alayna Cullen @AlaynaCullen 2017 GIII Canadian Derby, which has now been declared official for the fifth time. Director of IT/Accounting Ray Villa [email protected] BLUE BLOOD HONEST MISCHIEF RETIRED TO SEQUEL 10 [email protected] Juddmonte Farms’ immaculately-bred ‘TDN Rising Star’ Honest WORLDWIDE INFORMATION Mischief (Into Mischief) has been retired and will stand in New International Editor York at Sequel Stallions. Kelsey Riley @kelseynrileyTDN [email protected] European Editor Emma Berry [email protected] Associate International Editor Heather Anderson @HLAndersonTDN Newmarket Bureau, Cafe Racing Sean Cronin & Tom Frary [email protected] 60 Broad Street, Suite 100 Red Bank, NJ 07701 732-747-8060 | www.TheTDN.com TDN HEADLINE NEWS • PAGE 3 OF 12 • THETDN.COM WEDNESDAY • NOVEMBER 25, 2020 Knicks Go Adds Dash to Paynter=s Palette cont. from p1 hard to say. Actually this is the second time Knicks Go has demanded a But then Paynter, from his second crop, pulled Knicks Go out fresh look at his sire. In 2018, following a low-key launch by his of his hat. After scoring on debut at Ellis Park, he appeared to be first juveniles the previous year, Paynter mustered just 34 mares put in his place when tried in stakes company, only to establish at $12,500. In fairness, if what is plainly a particular anything he had resisted the affinity with Keeneland by usual drag better than most winning the GI Claiborne young sires, having maintained a Breeders' Futurity S. by 5 1/2 book of 103 at $20,000 the lengths at 70-1. If that previous spring. That reflected a performance came out of the positive reception for that first blue, he then proved its crop at the yearling sales, where substance by heading over to they had parlayed his $25,000 Churchill and beating all bar opening fee into an average Game Winner (Candy Ride {Arg}) return of $83,853. in the GI Breeders' Cup Juvenile. Having accumulated 438 While it is always true that a covers across his first three single star can outshine a seasons, however, Paynter was multitude of dimmer talents, seemingly now being drawn into Paynter had some useful volume the deadly commercial vortex so Paynter | Louise Reinagel behind him and finished behind familiar in a world where only Violence (Medaglia d'Oro) breeders flit nervously from new sire to new sire. Quite what in the second-crop sires' prize money table. He was back in the precocious detonation people had expected in Paynter's first game. After welcoming 97 partners in 2019, he kept solid juveniles, when both he and his sire had been unraced at two, is interest at 71 this year. Cont. p4 TDN HEADLINE NEWS • PAGE 4 OF 12 • THETDN.COM WEDNESDAY • NOVEMBER 25, 2020 In the prevailing climate, admittedly, a further easing of his fee was fairly inevitable. But hopefully that will assist him through the gate that divides the stallion who's still trying to make his name from the one who can be considered relatively proven, while yet remaining highly accessible. That's an elusive combination, making Paynter's credentials seem well worth revisiting. The Dirt Mile success of Knicks Go has elevated his sire past Violence to head the fourth-crop table as the year draws to a close. But he would still be a clear second without his standard-bearer, who after all was otherwise confined only to a couple of allowance wins, eight months apart, following his transfer to Brad Cox. Given the stellar achievements of Violence this year, with Grade I winners from three different crops, it would have reflected very creditably on Paynter even to remain in his vicinity. The key now is for Knicks Go not to turn into a burden, by appearing freakishly out of line with the rest of his sire's output. Paynter has so far assembled another 14 black-type winners at a perfectly respectable ratio, to named foals, of 4%. (That's a match, browsing stallions at a similar stage of their careers, even for Union Rags {Dixie Union} and Dialed In {Mineshaft}--never mind many others who have not approached their excellence.) And if none of these are in the same league as his kingpin, the success of Harpers First Ride in the GIII Pimlico Special last month was his eighth in 15 starts. Liam O'Rourke, director of stallion sales at WinStar, emphasizes the solidity of Paynter's body of work behind his trailblazer. "I think it's important to recognize both aspects of his production," O'Rourke observes. "Paynter is able to get an elite, championship-level racehorse like Knicks Go and also have the depth to be the only top 20 general sire standing for less than $15,000. He's in the top 15 by winners, and just outside the top 10 (11th) by percentage of black-type horses. This combination should spell an upward commercial trajectory." One thing is for sure: nobody could be surprised that a stallion recycling the kind of genes packaged by Paynter should have come up with a horse as talented as Knicks Go. He is out of a full-sister to Tiznow, and therefore also to Grade II winners Budroyale and Tizdubai; not to mention their unraced sister whose own mating with Paynter's sire produced GI Preakness S.
Recommended publications
  • LADY's TOUCH Barn 1 Hip No. 17

    LADY's TOUCH Barn 1 Hip No. 17

    Consigned by Bridie Harrison, Agent for Peter E. Blum Thoroughbreds Barn LADY'S TOUCH Hip No. 1 Dark Bay or Brown Mare; foaled 2004 17 Vice Regent Deputy Minister ................ Mint Copy Touch Gold ...................... Buckpasser Passing Mood .................. Cool Mood LADY'S TOUCH Bold Ruler Secretariat ........................ Somethingroyal Chosen Lady .................... (1987) Mr. Prospector Mine Only ........................ Mono By TOUCH GOLD (1994). Classic winner of $1,679,907, Belmont S. [G1] , etc. Sire of 15 crops of racing age, 896 foals, 731 starters, 29 black-type win - ners, 533 winners of 1777 races and earning $45,966,048. Sire of dams of 42 black-type winners, including champions Emperor Hall, Noon It Is, Sorrentino's Star, and of Upstart, Da Big Hoss, Emollient, Commissioner, Edge of Reality, Penwith, Laugh Track, Flipcup, Javerre, Bryan's Jewel, Nonios, Lion D N A, Gallant, Indian Firewater, Scherer Magic, Shakhimat. 1st dam CHOSEN LADY, by Secretariat. Placed at 3, $11,400. Sister to ACADEMY AWARD [G2] , half-sister to STATUETTE [G3] , GOOD MOOD [G3] . Dam of 15 registered foals, 15 of racing age, 10 to race, 8 winners, including-- WELL CHOSEN (f. by Deputy Minister). Winner at 2 and 3, $501,330, Ash - land S. [G1] , 2nd Fair Grounds Oaks [G3] , Santa Ynez S. [G3] . Dam of TELLING [G1] (c. by A.P. Indy, $848,409, sire), Present Course [L] (g. by Bernardini, $177,330), My Assets [L] (f. by Bernardini, $52,950). IN CONTENTION (c. by Devil's Bag). 8 wins at 2 and 3, $340,824, Cherry Hill Mile S. [G3] , Dancing Count S. [L] (LRL, $33,705), etc.
  • 138904 02 Classic.Pdf

    138904 02 Classic.Pdf

    breeders’ cup CLASSIC BREEDERs’ Cup CLASSIC (GR. I) 30th Running Santa Anita Park $5,000,000 Guaranteed FOR THREE-YEAR-OLDS & UPWARD ONE MILE AND ONE-QUARTER Northern Hemisphere Three-Year-Olds, 122 lbs.; Older, 126 lbs.; Southern Hemisphere Three-Year-Olds, 117 lbs.; Older, 126 lbs. All Fillies and Mares allowed 3 lbs. Guaranteed $5 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Classic will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes Dirt points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Saturday, November 2, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Classic (G1) Horse Owner Trainer Declaration of War Mrs. John Magnier, Michael Tabor, Derrick Smith & Joseph Allen Aidan P. O'Brien B.c.4 War Front - Tempo West by Rahy - Bred in Kentucky by Joseph Allen Flat Out Preston Stables, LLC William I.
  • Mating Analysis West Coast

    Mating Analysis West Coast

    MATING ANALYSIS You may submit your mare online at lanesend.com or call 859-873-7300 to discuss your matings with CHANCE TIMM, [email protected], JILL MCCULLY, [email protected] or LEVANA CAPRIA, [email protected]. WEST COAST Flatter – Caressing by Honour and Glory 2014 Bay l 16.2 Hands “An Eclipse Award winning champion, West Coast is by an outstanding sire son of A.P. Indy, out of a ChampionTwo-Year-Old Filly. West Coast earned a title as Champion Three-Year-Old Colt with five consecutive victories, four in stakes events, and ran 1-2-3 in six consecutive grade one events, including when capturing the Travers Stakes (G1) and Pennsylvania Derby (G1). He is by Flatter, a leading stallion son of A.P. Indy, and sire of more than 50 stakes winners, and out of Caressing, Champion and Breeders’ Cup (G1) winner at two.“ The offspring of West Coast will be free of Northern Dancer at four generations on their sire’s side, and Flatter has crossed well with a wide variety of broodmare sires from that line. The cross with mares from the Danzig branch of Northern Dancer has been particulary productive with seven stakes winners, including graded stakes winners Classic Point and Mad Flatter out of mares by Langfuhr and Honor Grades (who gives inbreeding to the dam of A.P. Indy), and there are also stakes winners out of mares by War Front – who appears particularly interesting here, giving inbreeding to Relaunch and a full-sister – Danzig Connection, Ghazi and Military (who would be intriguing here).
  • To Consignors Hip Color & No

    To Consignors Hip Color & No

    Index to Consignors Hip Color & No. Sex Name, Year Foaled Sire Dam Barn 2 Property of Alliance Sales Agency Racing or broodmare prospect 1582 ch. m. She's Got Friends, 2015 Badge of Silver Friends Included Yearlings 1688 ch. c. unnamed, 2019 Can the Man Exotic Actress 1745 b. c. unnamed, 2019 Sky Kingdom Little Venice Barn 36 Property of Alliance Sales Agency Yearling 1026 dk. b./br. c. unnamed, 2019 Street Boss Donna D Barn 36 Consigned by Alliance Sales Agency, Agent Broodmare 912 b. m. Trac N Jam, 2008 El Corredor Swan River Barn 36 Consigned by Alliance Sales Agency, Agent II Yearling 938 dk. b./br. c. unnamed, 2019 Run Away and Hide Yaletown Barn 36 Consigned by Alliance Sales Agency, Agent IV Racing or broodmare prospect 1076 b. f. Hidden Rosie, 2016 Signature Red Yellowenglishrose Barn 39 Consigned by Amende Place (Lee McMillin), Agent Yearlings 1228 gr/ro. c. unnamed, 2019 Shackleford Silver Sal 1439 ch. f. unnamed, 2019 Gormley Honky Tonk Rose Barn 39 Consigned by Amende Place (Lee McMillin), Agent II Broodmare 1181 dk. b./br. m. Port Charlotte, 2012 Blame Port Roberto Barn 35 Consigned by Ballysax Bloodstock, Agent II Yearling 1158 b. f. unnamed, 2019 Outwork Our Nellie Barn 35 Consigned by Ballysax Bloodstock, Agent III Broodmare 1137 dk. b./br. m. Momma's Favorite, 2012 Sky Mesa Tres Dream Barn 35 Consigned by Ballysax Bloodstock, Agent VI Yearling 859 ch. f. unnamed, 2019 Street Boss Shoot the Moon Barn 35 Consigned by Ballysax Bloodstock, Agent VIII Yearling 977 ch. f. unnamed, 2019 Lord Nelson Sweetness 'n Light Barn 35 Consigned by Ballysax Bloodstock, Agent XVI Broodmare 1124 gr/ro.
  • FATEER Barn 46 Hip No. 4295

    FATEER Barn 46 Hip No. 4295

    Consigned by Lane's End, Agent Barn FATEER Hip No. 46 Dark Bay or Brown Mare; foaled 2012 4295 Storm Cat Giant's Causeway ................ Mariah's Storm Eskendereya .......................... Seattle Slew Aldebaran Light .................... Altair FATEER In Excess (IRE) Indian Charlie ........................ Soviet Sojourn Tamar .................................... (2005) Robellino V Sign .................................... Vexation By ESKENDEREYA (2007). Black-type winner of $725,700, Wood Memorial S. [G1] (AQU, $450,000), etc. Sire of 5 crops of racing age, 407 foals, 287 starters, 17 black-type winners, 205 winners of 574 races and earning $18,545,892, including Mor Spirit (6 wins, $1,668,400, Mohegan Sun Met - ropolitan H. [G1] (BEL, $650,000), etc.), Isabella Sings ($648,170, Mrs. Revere S. [G2] (CD, $112,840), etc.), Eskenformoney ($757,616, Turnback the Alarm H. [G3] (BEL, $120,000), etc.), Mitole [L] (at 3, 2018, $348,710). 1st dam TAMAR, by Indian Charlie. Winner at 4, $50,880. Dam of 3 other registered foals, 3 of racing age, including a 2-year-old of 2018, 1 to race-- Fortunate Queen (f. by Pioneerof the Nile). Placed at 2 and 3, $39,805. 2nd dam V SIGN, by Robellino. Unraced. Sister to Robellation . Dam of 9 winners, incl.-- AVARE (g. by Johannesburg). 6 wins, 2 to 4, $228,395, Eddie Logan S. [L] (SA, $46,500), Pomona Derby (BSR, $27,750). V FORMATION (f. by Proud Birdie). 5 wins at 2 and 3, $155,618, Boca Raton S. [L] (CRC, $60,000), Judy's Red Shoes S. [L] (CRC, $30,000), Gardenia S. (CRC, $22,827), Miramar S. (CRC, $22,713).
  • American Pharoah, Pletcher, Fisher 2021 Inductees Into

    American Pharoah, Pletcher, Fisher 2021 Inductees Into

    THURSDAY, MAY 6, 2021 AMERICAN PHAROAH, SUPER TRAINERS IN CALIFORNIA: THE STORY IN NUMBERS PLETCHER, FISHER 2021 by Dan Ross Over the years, the rise of the so-called super trainer has INDUCTEES INTO HOF prompted many a clutched pearl by virtue of a perceived monopoly on the sport. Anecdotally, it can certainly appear as though the same few names wield an outsized impact. But what does the data say? The TDN has crunched the numbers in California from 2007 onward. This is far from a comprehensive overview of the situation, and what emerges is a picture that can be viewed from multiple angles. On the one hand, the numbers suggest that the biggest stables in the state have indeed consolidated their positions at the top during a long period of market contraction. Yet at the same time, other indicators afford tentative encouragement for the smaller players. Cont. p5 American Pharoah winning the 2015 Belmont | Sarah Andrew IN TDN EUROPE TODAY American Pharoah (Pioneerof the Nile), who became racing's YOUTH SPIRIT NABS CHESTER VASE first Triple Crown winner in 37 years in 2015, and trainers Todd Youth Spirit (Ire) (Camelot {GB}) saluted in the G3 Chester Pletcher and Jack Fishers are the 2021 inductees into the Vase S. on Wednesday. Click or tap here to go straight to National Museum of Racing Hall of Fame. American Pharoah and TDN Europe. Pletcher were elected in the contemporary category and each in their first year of eligibility. Fisher was chosen by the Museum's Steeplechase Review Committee, which convenes once every four years.
  • Pedigree Insights B Y a N D R E W C a U L F I E L D

    Pedigree Insights B Y a N D R E W C a U L F I E L D

    Andrew Caulfield, July 31, 2012-Paynter PEDIGREE INSIGHTS B Y A N D R E W C A U L F I E L D Sunday, Monmouth HASKELL INVITATIONAL S.-GI, $1,000,000, MTH, 7-29, 3yo, 1 1/8m, 1:48 4/5, ft. 1--#@PAYNTER, 118, c, 3, by Awesome Again 1st Dam: Tizso, by Cee's Tizzy 2nd Dam: Cee's Song, by Seattle Song 3rd Dam: Lonely Dancer, by Nice Dancer ($325,000 yrl '10 KEESEP). O-Zayat Stables LLC; B-Diamond A Racing Corp (KY); T-Bob Baffert; J-Rafael Bejarano; $600,000. Lifetime Record: GISP, 6-3-2-0, $952,224. *1/2 to Tizakitty (Distinctive Cat), SW, $158,644; Tiz West (Gone West), GSW, $263,761. Werk Nick Rating: A. Click for the eNicks report & 5-cross pedigree. KY-BRED QUALITY KTA / KTOB Another IBS Yearling Auction Purchase 3rd Individual IBS G1 Winner in 2012 EQB Heart Scan Client • www.EQB.com Half-brother by Street Cry sells at KeeSep with TAYLOR MADE I=ve no idea whether Ahmed Zayat and Bob Baffert are devotees of Frank Sinatra, but they should certainly be singing along to these lines made famous by Ol= Blue Eyes: AOut of the tree of life, I just picked me a plum You came along and everything starting to hum Still it=s a real good bet, the best is yet to come.@ For Atree of life@ substitute Keeneland=s 2010 September Sales, where Zayat Stables picked out a plum at a cost of Aonly@ $325,000 on the opening day, when the average stood at nearly $350,000.
  • Kubota Equestrian Range

    Kubota Equestrian Range

    Kubota Equestrian range Kubota’s equestrian range combines power, reliability and operator comfort to deliver exceptional performance, whatever the task. Moulton Road, Kennett, Newmarket CB8 8QT Call Matthew Bailey on 01638 750322 www.tnsgroup.co.uk Thurlow Nunn Standen 1 ERNEST DOE YOUR TRUSTED NSFA NEW HOLLAND NEWMARKET STUD DEALER FARMERS ASSOCIATION Directory 2021 Nick Angus-Smith Chairman +44 (0) 777 4411 761 [email protected] Andrew McGladdery MRCVS Vice Chairman +44 (0)1638 663150 Michael Drake Company Secretary c/o Edmondson Hall Whatever your machinery requirements, we've got a solution... 25 Exeter Road · Newmarket · Suffolk CB8 8AR Contact Andy Rice on 07774 499 966 Tel: 01638 560556 · Fax: 01638 561656 MEMBERSHIP DETAILS AVAILABLE ON APPLICATION N.S.F.A. Directory published by Thoroughbred Printing & Publishing Mobile: 07551 701176 Email: [email protected] FULBOURN Wilbraham Road, Fulbourn CB21 5EX Tel: 01223 880676 2 3 CHAIRMAN’S FOREWORD AWARD WINNING SOLICITORS & It is my pleasure to again introduce readers to the latest Newmarket Stud Farmers Directory. SPORTS LAWYERS The 2020 Stud Season has been one of uncertainty but we are most fortunate that here in Newmarket we can call on the services of some of the world’s leading experts in their fields. We thank them all very much indeed for their advice. Especial thanks should be given to Tattersalls who have been able to conduct their sales in Newmarket despite severe restrictions. The Covid-19 pandemic has affected all our lives and the Breeding season was no exception. Members have of course complied with all requirements of Government with additional stringent safeguards agreed by ourselves and the Thoroughbred Breeders Association so the breeding season was able to carry on almost unaffected.
  • Scat Daddy Stars at Craven Cont

    Scat Daddy Stars at Craven Cont

    THURSDAY, 19 APRIL, 2018 and the second time I loved him. He is still developing all the SCAT DADDY STARS time and he looks ready to go. This is probably the last sale where you can get them to [Royal] Ascot so I don't think he'll be AT CRAVEN waiting around too long." Hillen was acting for an existing client, who wished to remain anonymous, but was able to confirm that the colt will be staying in Britain. "Scat Daddy has obviously been a great sire and I think nearly all his that breezed last year have won," Hillen added. "I bought one for 60 grand tonight and one for 900, so that's two ends of the spectrum." Even Scat Daddy, then, is not immune to the feast-or-famine flavour of the sector this spring. "It's polarised," confirmed Hillen. "There have been horses going through today I bought on spec, just because they were too cheap. I had a longer list today, I thought they were better horses, but it's a buyers' market. It is easier to get 300 grand than it is to get 75Cwhen there's not the gulf in class. It's all or nothing." cont. p2 The 900,000gns sale-topping son of Scat Daddy | Tattersalls IN TDN AMERICA TODAY TDN Q & A: OGDEN PHIPPS II By Chris McGrath The TDN speaks with Ogden Phipps II on his recent NEWMARKET, UK--The sickle moon hanging over the appointment to the NYRA board and his family’s stable. Tattersalls complex last night provided an apt symbol of the Click or tap here to go straight to TDN America.
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • T Am T Th T Be an C M in Fo Co Fa Gr W St Ch T Ra Sm in R No T Str W Fa

    T Am T Th T Be an C M in Fo Co Fa Gr W St Ch T Ra Sm in R No T Str W Fa

    As a freelance writer, Alan Yuill Walker has spent The Scots & The Turf tells the story of the his life writing about racing and bloodstock. For amazing contribution made to the world of over forty years he was a regular contributor to Thoroughbred horseracing by the Scots and Horse & Hound and has had a long involvement those of Scottish ancestry, past and present. with the Thoroughbred Breeders’ Association. Throughout the years, this contribution has Other magazines/journals to which he has been across the board, from jockeys to trainers contributed on a regular basis include The and owners as well as some superb horses. British/European Racehorse, Stud & Stable, Currently, Scotland has a great ambassador in Pacemaker, The Thoroughbred Breeder and Mark Johnston, who has resurrected Middleham Thoroughbred Owner & Breeder. He was also in North Yorkshire as one of the country’s a leading contributor to The Bloodstock foremost training centres, while his jumping Breeders’ Annual Review. His previous books counterpart Alan King, the son of a Lanarkshire are Thoroughbred Studs of Great Britain, The farmer, is now based outside Marlborough. The History of Darley Stud Farms, Months of Misery greatest lady owner of jumpers in recent years Moments of Bliss, and Grey Magic. was Queen Elizabeth the Queen Mother, while Stirling-born Willie Carson was five-times champion jockey on the Flat. These are, of course, familiar names to any racing enthusiast but they represent just a small part of the Scottish connection that has influenced the Sport of Kings down the years. Recognition of the part played by those from north of the Border is long overdue and The Scots & The Turf now sets the record straight with a fascinating account of those who have helped make horseracing into the fabulous spectacle it is today.
  • The Park House Stables Newsletter

    The Park House Stables Newsletter

    The SUMMER 2012 KINGSCLERE Quarter THE PARK HOUSE STABLES NEWSLETTER The KINGSCLERE Quarter HALF OVERVIEW The story of the 2012 flat season so far has undoubtedly been the unusually wet weather which has wreaked havoc with some of the trainer’s best-laid plans. Certainly, the fast ground horses just haven’t had a fair crack of the whip at all but, due to the fact much of our fast work is done on grass, I am sure some of the horses have conditioned themselves to handling softer ground than maybe would have otherwise been the case. Despite the conditions we have managed to reach 50 winners this term, which has us comfortably on target for where we want to be numerically at the end of the season SIDE GLANCE winning the Diomed Stakes (G3) at Epsom on Investec Oaks Day and to have hit the £700,000 mark in prize money at this stage is a very good haul. Front cover: AUTUMN FIRE wins at Chepstow under David Probert The obvious highlight of the season so far was Bonfire’s Back cover: Team photo reappearance win in the Dante. It was just fantastic to be involved in the subsequent preparation of a leading CONTENTS contender for the Derby and I know everybody connected with the horse thoroughly enjoyed the experience. Though HALF TERM REVIEW, 2, 3, 4, 5, 6, 7, 8 & 9 ultimately the bid for a Derby winner didn’t end as desired, ANDREW BALDING it would be nice to think in the future we could go through 2012 TWELVE TO FOLLOW COMPETITION, 10 & 11 it all again and have a better end result.