DOCSLIB.ORG

Short Peptides Derived from the BAG-1 C-Terminus Inhibit the Interaction Between BAG-1 and HSC70 and Decrease Breast Cancer Cell Growth

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Short Peptides Derived from the BAG-1 C-Terminus Inhibit the Interaction Between BAG-1 and HSC70 and Decrease Breast Cancer Cell Growth FEBS Letters 583 (2009) 3405–3411 journal homepage: www.FEBSLetters.org Short peptides derived from the BAG-1 C-terminus inhibit the interaction between BAG-1 and HSC70 and decrease breast cancer cell growth Adam Sharp a, Ramsey I. Cutress a, Peter W.M. Johnson a, Graham Packham a, Paul A. Townsend b,* a Cancer Research UK Centre, Cancer Sciences Division, University of Southampton, School of Medicine, Southampton General Hospital, Southampton S016 6YD, UK b Human Genetics Division, University of Southampton, School of Medicine, Southampton General Hospital, Southampton S016 6YD, UK article info abstract Article history: BAG-1, a multifunctional protein, interacts with a plethora of cellular targets where the interaction Received 8 July 2009 with HSC70 and HSP70, is considered vital. Structural studies have demonstrated the C-terminal of Revised 21 September 2009 BAG-1 forms a bundle of three alpha-helices of which helices 2 and 3 are directly involved in binding Accepted 24 September 2009 to the chaperones. Here we found peptides derived from helices 2 and 3 of BAG-1 interfered with Available online 1 October 2009 BAG-1:HSC70 binding. We confirmed that a 12 amino-acid peptide from helix 2 directly interacted Edited by Lukas Huber with HSC70 and when introduced into MCF-7 and ZR-75-1 cells, these peptides inhibited their growth. In conclusion, we have identified a small domain within BAG-1 which appears to play a crit- ical role in the interaction with HSC70. Keywords: BAG-1 HSC70 Structured summary: HSP70 MINT-7265269, MINT-7265296, MINT-7265324, MINT-7265339, MINT-7265351, MINT-7265364, MINT- Interaction 7265483, MINT-7265464, MINT-7265310: HSC70 (uniprotkb:P11142) binds (MI:0407) to BAG1 (uni- Binding protkb:Q99933) by peptide array (MI:0081) MINT-7265281: peptide 15L (uniprotkb:Q99933) binds (MI:0407) to HSC70 (uniprotkb:P11142) by surface plasmon resonance (MI:0107) Ó 2009 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved. 1. Introduction and HSP70, is considered key for many of BAG-1 functions [5,14,28,30–33]. For example, mutations which prevent binding BAG-1 is a multifunctional protein that can modulate a wide to HSC70/HSP70 interfere with the ability of BAG-1 to promote cell range of cellular processes [1]. For example, overexpression of survival and to modulate NHR function [2,6,21,22,29,34–36].In BAG-1 protects cells from a wide range of apoptotic stimuli, acti- addition, BAG-1 has been shown to modulate proteasomal degra- vates RAF-1 kinase-dependent signalling, enhances proliferation dation of Tau proteins, a process dependent on the interaction with and metastasis, regulates proteasomal degradation, and modulates HSC70/HSP70 [5]. Moreover, BAG-1 has cochaperone activity and the transcriptional activity of a variety of nuclear hormone recep- stimulates nucleotide exchange of HSC70/HSP70 [27,37–40] tors (NHR) [2–16]. Functional and expression studies suggest that HSC70 and HSP70 play important roles in multiple cell processes, overexpression of BAG-1 may play an important role in diverse for example, via effects on protein (re)folding and activation of cancer types [1,2,4,15,17–29]. NHR. Thus, binding to these multifunctional proteins may explain The mechanism(s) by which BAG-1 exerts its pleiotropic effects at least in part the multiple effects associated with BAG-1 are not fully understood. Although BAG-1 has many protein bind- overexpression. ing partners (including BCL-2, RAF-1, pRb, CHIP and the protea- The interaction between BAG-1 and HSC70/HSP70 has been some), interaction with the 70 kDa heat shock proteins, HSC70 studied by NMR and X-ray crystallography [34,41]. The 70 kDa heat shock proteins comprise an amino terminal ATPase domain, a central peptide binding domain and a carboxyl terminal region Abbreviations: BAG, bcl2-associated athanogene-1; HSC70, heat shock cognate that can form a ‘‘lid” over the peptide binding domain [42,43]. 70; HSP70, heat shock protein 70; SPR, surface plasmon resonance The interaction of BAG-1 with the ATPase domain of HSC70/ * Corresponding author. Address: Human Genetics Division, Duthie Building, HSP70 is mediated by the C-terminal BAG domain of BAG-1. This Southampton General Hospital (MP808), Southampton SO16 6YD, UK. Fax: +44 (0)23 8079 4264. evolutionarily conserved ‘‘BAG domain” [44] is formed of a bundle E-mail address: [email protected] (P.A. Townsend). of three alpha-helices (Fig. 1). Helices 2 and 3 are involved in elec- 0014-5793/$36.00 Ó 2009 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved. doi:10.1016/j.febslet.2009.09.047 3406 A. Sharp et al. / FEBS Letters 583 (2009) 3405–3411 UK) for 1 h at room temperature. The wells were washed as before, prior to addition of GST-BAG-1S or GST (each 500 ng) in PBS. Fol- lowing incubation at room temperature for 1.5 h, unbound protein was removed by washing in PBS. Bound BAG-1 was detected using the BAG-1-specific monoclonal antibody 3.10 G3E2 [46] at a 1/ 1000 dilution of ascities in PBS (200 ll). Following incubation at room temperature for 1 h, wells were washed and then incubated for 1 h with 200 ll of horseradish peroxidase conjugated sheep anti-mouse Ig antibody (GE/Amersham Biosciences, UK) diluted in PBS (200 ll). Wells were washed and developed by addition of 200 ll of o-Phenylenediamine Dihydrochloride (Sigma, UK) and incubation for 10 min at 37 °C. Absorbance at 450 nm was deter- mined on a Dynatech MR5000 plate reader (Dynatech, Germany). The absorbance of wells containing HSC70 and GST was used to determine the 0% interaction and the absorbance of wells contain- ing HSC70 and GST-BAG-1S was used to determine the 100% inter- action. Peptides were added to the interaction assay at various concentrations prior to addition of GST-BAG-S. Fig. 1. The BAG-1:HSC70 interaction. The figure shows the interaction between the 2.3. Surface plasmon resonance (SPR) three helices comprising the BAG domain of BAG-1 (red) and the ATPase domain of HSC70 (blue). The 8 amino-acid binding core of helix 2 (pink) and the 16 amino-acid binding core of helix 3 (light blue) identified in this study are indicated. Figure was SPR analysis was performed using BIAcore 2000 biosensor and drawn using PyMOLÓ and structural coordinates from Protein Data Bank id 1hx1. BIA evaluation 2.0 software (BIAcore, Sweden). CM5 carboxy- methyl dextran sensor chips were activated with injection of 100 ll of a 1:1 mixture of N-ethyl-N0-[(dimethylamino)propyl]car- trostatic interactions with subdomains IB and IIB of the ATPase do- bodiimide and N-hydroxysuccinimide. Immediately after activa- main of HSC70 [41]. Although helix 1 is not directly involved in tion, 30 ll of peptide 15L (100 lM) in HBS buffer (10 nM HEPES binding, it may contribute to intramolecular interactions which with 0.15 M NaCl, 3.4 mM EDTA, and 0.005% surfactant P20; BIA- stabilize the overall structure of the BAG domain. In this paper, core, Sweden) was injected for covalent coupling to the surface we have identified small peptides derived from the BAG domain of the sensor chip. Unreacted sites were blocked by injection of that were sufficient to inhibit the interaction of BAG-1 and 70 ll of 1 M ethanolamine pH 8.5. Recombinant HSC70 was diluted HSC70 and investigated their effect on breast cancer cell growth. to the desired concentrations in HBS buffer and injected separately over the chip-bound peptide 15L. Sensograms were collected at 2. Materials and methods 25 °C, with a flow rate of 10 ll/min and data collection rate of 1 Hz. Sensograms were normalised to a base line of 0 resonance 2.1. BAG-1 peptides and GST-BAG-1 units (RU). Equivalent concentrations of each protein were injected over an untreated surface to serve as blank sensograms for subtrac- For in vitro studies, peptides were generated by solid phase syn- tion of bulk refractive index background. The sensor chip surface thesis (Mimotopes Pty Ltd., Australia), dissolved in DMSO and was regenerated between runs with a 1 min injection of 100 lM 10 mM stock solutions stored at À80 °C. For cell studies, Penetratin HCl, at 10 ll/min. [45] and Penetratin-coupled peptides were obtained from the Can- cer Research UK Research Services (London, UK), dissolved in water 2.4. Cell culture and 1 mM stocks stored at À80 °C. The sequence of the Penetratin- coupled peptides are shown below (Penetratin sequences are ZR-75-1 and MCF-7 human breast cancer cell lines were ob- underlined). tained from ATCC (American Type Culture Collection, USA) and H2-Pen CKLDRRVKATIERQIKIWFQNRRMKWKK maintained in Dulbecco’s modified Eagle’s media (Life Technolo- H2mut-Pen CKLDAAVKATIERQIKIWFQNRRMKWKK gies Inc., UK) supplemented with 10% (v/v) fetal calf serum (PAA H3-Pen LKRKRGLVKKVQAFLAECDTVERQIKIWFQNRRMKWKK Laboratories, UK) and 1% (v/v) penicillin/streptomycin/glutamine. Con-Pen RQIKIWFQNRRMKWKKC-CVARTEPLQT To measure growth inhibition, cells were plated at a density of Penetratin RQIKIWFQNRRMKWKK 5000 cells per well of a 96 well plate. The following day, cells were treated with various concentrations of BAG-1 or control peptides. BAG-1 peptides were synthesised with Penetratin at their C-ter- After 6 days, media was removed from each well and replaced with minus coupled via a peptide bond. The control peptide was an 200 ll RPMI-1640 media (Life Technologies Inc., UK) supple- unrelated BCL-2 derived sequence coupled to Penetratin by a disul- mented with 10% (v/v) fetal calf serum and 1% (v/v) penicillin/ Ò phide bond at its N-terminus.
Load more

Recommended publications
  • Learning Protein Constitutive Motifs from Sequence Data Je´ Roˆ Me Tubiana, Simona Cocco, Re´ Mi Monasson*
    TOOLS AND RESOURCES Learning protein constitutive motifs from sequence data Je´ roˆ me Tubiana, Simona Cocco, Re´ mi Monasson* Laboratory of Physics of the Ecole Normale Supe´rieure, CNRS UMR 8023 & PSL Research, Paris, France Abstract Statistical analysis of evolutionary-related protein sequences provides information about their structure, function, and history. We show that Restricted Boltzmann Machines (RBM), designed to learn complex high-dimensional data and their statistical features, can efficiently model protein families from sequence information. We here apply RBM to 20 protein families, and present detailed results for two short protein domains (Kunitz and WW), one long chaperone protein (Hsp70), and synthetic lattice proteins for benchmarking. The features inferred by the RBM are biologically interpretable: they are related to structure (residue-residue tertiary contacts, extended secondary motifs (a-helixes and b-sheets) and intrinsically disordered regions), to function (activity and ligand specificity), or to phylogenetic identity. In addition, we use RBM to design new protein sequences with putative properties by composing and ’turning up’ or ’turning down’ the different modes at will. Our work therefore shows that RBM are versatile and practical tools that can be used to unveil and exploit the genotype–phenotype relationship for protein families. DOI: https://doi.org/10.7554/eLife.39397.001 Introduction In recent years, the sequencing of many organisms’ genomes has led to the collection of a huge number of protein sequences, which are catalogued in databases such as UniProt or PFAM Finn et al., 2014). Sequences that share a common ancestral origin, defining a family (Figure 1A), *For correspondence: are likely to code for proteins with similar functions and structures, providing a unique window into [email protected] the relationship between genotype (sequence content) and phenotype (biological features).
    [Show full text]
  • Co-Chaperone Potentiation of Vitamin D Receptor-Mediated Transactivation
    81 Co-chaperone potentiation of vitamin D receptor-mediated transactivation: a role for Bcl2-associated athanogene-1 as an intracellular-binding protein for 1,25-dihydroxyvitamin D3 R F Chun, M Gacad, L Nguyen, M Hewison and J S Adams Division of Endocrinology, Diabetes and Metabolism, Burns and Allen Research Institute, Cedars-Sinai Medical Center, Room D-3088, 8700 Beverly Boulevard, Los Angeles, California 90048, USA (Requests for offprints should be addressed to M Hewison; Email: [email protected]) Abstract The constitutively expressed member of the heat shock protein-70 family (hsc70) is a chaperone with multiple functions in cellular homeostasis. Previously, we demonstrated the ability of hsc70 to bind 25-hydroxyvitamin D3 (25-OHD3) and 1,25- dihydroxyvitamin D3 (1,25(OH)2D3). Hsc70 also recruits and interacts with the co-chaperone Bcl2-associated athanogene (BAG)-1 via the ATP-binding domain that resides on hsc70. Competitive ligand-binding assays showed that, like hsc70, recombinant BAG-1 is able to bind 25-OHD3 (KdZ0.71G0.25 nM, BmaxZ69.9G16.1 fmoles/mg protein) and 1,25(OH)2D3 (KdZ0.16G0.07 nM, BmaxZ38.1G3.5 fmoles/mg protein; both nZ3 separate binding assays, P!0.001 for Kd and Bmax). To investigate the functional significance of this, we transiently overexpressed the S, M, and L variants of BAG-1 into human kidney HKC-8 cells stably transfected with a 1,25(OH)2D3-responsive 24-hydroxylase (CYP24) promoter–reporter construct. As HKC-8 cells also express the enzyme 1a-hydroxylase, both 25-OHD3 (200 nM) and 1,25(OH)2D3 (5 nM) were able to induce CYP24 promoter activity.
    [Show full text]
  • Bag6 Complex Contains a Minimal Tail-Anchor–Targeting Module and a Mock BAG Domain
    Bag6 complex contains a minimal tail-anchor–targeting module and a mock BAG domain Jee-Young Mocka, Justin William Chartrona,Ma’ayan Zaslavera,YueXub,YihongYeb, and William Melvon Clemons Jr.a,1 aDivision of Chemistry and Chemical Engineering, California Institute of Technology, Pasadena, CA 91125; and bLaboratory of Molecular Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892 Edited by Gregory A. Petsko, Weill Cornell Medical College, New York, NY, and approved December 1, 2014 (received for review February 12, 2014) BCL2-associated athanogene cochaperone 6 (Bag6) plays a central analogous yeast complex contains two proteins, Get4 and Get5/ role in cellular homeostasis in a diverse array of processes and is Mdy2, which are homologs of the mammalian proteins TRC35 part of the heterotrimeric Bag6 complex, which also includes and Ubl4A, respectively. In yeast, these two proteins form ubiquitin-like 4A (Ubl4A) and transmembrane domain recognition a heterotetramer that regulates the handoff of the TA protein complex 35 (TRC35). This complex recently has been shown to be from the cochaperone small, glutamine-rich, tetratricopeptide important in the TRC pathway, the mislocalized protein degrada- repeat protein 2 (Sgt2) [small glutamine-rich tetratricopeptide tion pathway, and the endoplasmic reticulum-associated degrada- repeat-containing protein (SGTA) in mammals] to the delivery tion pathway. Here we define the architecture of the Bag6 factor Get3 (TRC40 in mammals) (19–22). It is expected that the complex, demonstrating that both TRC35 and Ubl4A have distinct mammalian homologs, along with Bag6, play a similar role (23– C-terminal binding sites on Bag6 defining a minimal Bag6 complex.
    [Show full text]
  • Apiap2 Transcription Factor Restricts Development of the Toxoplasma Tissue Cyst
    ApiAP2 transcription factor restricts development of the Toxoplasma tissue cyst Joshua B. Radkea,1, Olivier Lucasa,1,2, Erandi K. De Silvab, YanFen Mac, William J. Sullivan, Jr.d, Louis M. Weissc, Manuel Llinasb, and Michael W. Whitea,3 aDepartments of Molecular Medicine and Global Health, University of South Florida, Tampa, FL 33612; bDepartment of Molecular Biology and Lewis-Sigler Institute for Integrative Genomics, Princeton University, Princeton, NJ 08544; cDepartments of Medicine and Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, NY 10461; and dDepartment of Pharmacology and Toxicology, Indiana University School of Medicine, Indianapolis, IN 46202 Edited* by Jitender P. Dubey, US Department of Agriculture, Beltsville, MD, and approved March 14, 2013 (received for review January 3, 2013) Cellular differentiation leading to formation of the bradyzoite tissue the cell cycle transcriptome of Plasmodium falciparum and Toxo- cyst stage is the underlying cause of chronic toxoplasmosis. Con- plasma asexual stages are progressive with little understanding yet sequently, mechanisms responsible for controlling development in as to how these serial patterns are controlled (8, 9). In Toxoplasma, the Toxoplasma intermediate life cycle have long been sought. Here, conversion between developmental stages is also linked to signif- we identified 15 Toxoplasma mRNAs induced in early bradyzoite icant changes in gene expression (5). Data mining of genome development that encode proteins with apicomplexan AP2 (ApiAP2) sequences has recently identified a family of plant-related AP2 DNA binding domains. Of these 15 mRNAs, the AP2IX-9 mRNA dem- domain (DNA binding) containing proteins in the Apicomplexa onstrated the largest expression increase during alkaline-induced [apicomplexan AP2 (ApiAP2) proteins] (10).
    [Show full text]
  • A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family
    Rockefeller University Digital Commons @ RU Student Theses and Dissertations 2018 A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family Linda Molla Follow this and additional works at: https://digitalcommons.rockefeller.edu/ student_theses_and_dissertations Part of the Life Sciences Commons A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY A Thesis Presented to the Faculty of The Rockefeller University in Partial Fulfillment of the Requirements for the degree of Doctor of Philosophy by Linda Molla June 2018 © Copyright by Linda Molla 2018 A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY Linda Molla, Ph.D. The Rockefeller University 2018 APOBEC2 is a member of the AID/APOBEC cytidine deaminase family of proteins. Unlike most of AID/APOBEC, however, APOBEC2’s function remains elusive. Previous research has implicated APOBEC2 in diverse organisms and cellular processes such as muscle biology (in Mus musculus), regeneration (in Danio rerio), and development (in Xenopus laevis). APOBEC2 has also been implicated in cancer. However the enzymatic activity, substrate or physiological target(s) of APOBEC2 are unknown. For this thesis, I have combined Next Generation Sequencing (NGS) techniques with state-of-the-art molecular biology to determine the physiological targets of APOBEC2. Using a cell culture muscle differentiation system, and RNA sequencing (RNA-Seq) by polyA capture, I demonstrated that unlike the AID/APOBEC family member APOBEC1, APOBEC2 is not an RNA editor. Using the same system combined with enhanced Reduced Representation Bisulfite Sequencing (eRRBS) analyses I showed that, unlike the AID/APOBEC family member AID, APOBEC2 does not act as a 5-methyl-C deaminase.
    [Show full text]
  • Bag-1 Stimulates Bad Phosphorylation Through Activation of Akt and Raf Kinases to Mediate Cell Survival in Breast Cancer
    Kizilboga et al. BMC Cancer (2019) 19:1254 https://doi.org/10.1186/s12885-019-6477-4 RESEARCH ARTICLE Open Access Bag-1 stimulates Bad phosphorylation through activation of Akt and Raf kinases to mediate cell survival in breast cancer Tugba Kizilboga1, Emine Arzu Baskale1, Jale Yildiz1, Izzet Mehmet Akcay1, Ebru Zemheri2, Nisan Denizce Can1, Can Ozden1, Salih Demir1, Fikret Ezberci3 and Gizem Dinler-Doganay1* Abstract Background: Bag-1 (Bcl-2-associated athanogene) is a multifunctional anti-apoptotic protein frequently overexpressed in cancer. Bag-1 interacts with a variety of cellular targets including Hsp70/Hsc70 chaperones, Bcl-2, nuclear hormone receptors, Akt and Raf kinases. In this study, we investigated in detail the effects of Bag-1 on major cell survival pathways associated with breast cancer. Methods: Using immunoblot analysis, we examined Bag-1 expression profiles in tumor and normal tissues of breast cancer patients with different receptor status. We investigated the effects of Bag-1 on cell proliferation, apoptosis, Akt and Raf kinase pathways, and Bad phosphorylation by implementing ectopic expression or knockdown of Bag-1 in MCF-7, BT-474, MDA-MB-231 and MCF-10A breast cell lines. We also tested these in tumor and normal tissues from breast cancer patients. We investigated the interactions between Bag-1, Akt and Raf kinases in cell lines and tumor tissues by co-immunoprecipitation, and their subcellular localization by immunocytochemistry and immunohistochemistry. Results: We observed that Bag-1 is overexpressed in breast tumors in all molecular subtypes, i.e., regardless of their ER, PR and Her2 expression profile. Ectopic expression of Bag-1 in breast cancer cell lines results in the activation of B-Raf, C-Raf and Akt kinases, which are also upregulated in breast tumors.
    [Show full text]
  • Origin and Evolution of the Human Bcl2-Associated Athanogene-1 (BAG-1)
    International Journal of Molecular Sciences Article Origin and Evolution of the Human Bcl2-Associated Athanogene-1 (BAG-1) 1, 2, 1 1 1 Peter Nguyen y, Kyle Hess y , Larissa Smulders , Dat Le , Carolina Briseno , Christina M. Chavez 1 and Nikolas Nikolaidis 1,* 1 Center for Applied Biotechnology Studies, and Center for Computational and Applied Mathematics, Department of Biological Science, College of Natural Sciences and Mathematics, California State University Fullerton, Fullerton, CA 92834-6850, USA; [email protected] (P.N.); [email protected] (L.S.); [email protected] (D.L.); [email protected] (C.B.); [email protected] (C.M.C.) 2 Department of Genome Sciences, Molecular and Cellular Biology Graduate Program, University of Washington, Seattle, WA 98195, USA; [email protected] * Correspondence: [email protected]; Tel.: +1-657-278-4526 These authors contributed equally to this work. y Received: 20 November 2020; Accepted: 17 December 2020; Published: 18 December 2020 Abstract: Molecular chaperones, particularly the 70-kDa heat shock proteins (Hsp70s), are key orchestrators of the cellular stress response. To perform their critical functions, Hsp70s require the presence of specific co-chaperones, which include nucleotide exchange factors containing the BCL2-associated athanogene (BAG) domain. BAG-1 is one of these proteins that function in a wide range of cellular processes, including apoptosis, protein refolding, and degradation, as well as tumorigenesis. However, the origin of BAG-1 proteins and their evolution between and within species are mostly uncharacterized. This report investigated the macro- and micro-evolution of BAG-1 using orthologous sequences and single nucleotide polymorphisms (SNPs) to elucidate the evolution and understand how natural variation affects the cellular stress response.
    [Show full text]
  • Bag-1 Polyclonal Antibody Catalog # AP73543
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 Bag-1 Polyclonal Antibody Catalog # AP73543 Specification Bag-1 Polyclonal Antibody - Product Information Application WB Primary Accession Q99933 Reactivity Human Host Rabbit Clonality Polyclonal Bag-1 Polyclonal Antibody - Additional Information Gene ID 573 Other Names BAG1; HAP; BAG family molecular chaperone regulator 1; BAG-1; Bcl-2-associated athanogene 1 Dilution WB~~Western Blot: 1/500 - 1/2000. ELISA: 1/20000. Not yet tested in other applications. Format Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage Conditions -20℃ Bag-1 Polyclonal Antibody - Protein Information Bag-1 Polyclonal Antibody - Background Name BAG1 Co-chaperone for HSP70 and HSC70 Synonyms HAP chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting Function the release of ADP from the HSP70 and HSC70 Co-chaperone for HSP70 and HSC70 proteins thereby triggering client/substrate chaperone proteins. Acts as a protein release. Nucleotide release is mediated nucleotide-exchange factor (NEF) promoting via its binding to the nucleotide-binding the release of ADP from the HSP70 and domain (NBD) of HSPA8/HSC70 where as the HSC70 proteins thereby triggering client/substrate protein release. Nucleotide substrate release is mediated via its binding to release is mediated via its binding to the the substrate-binding domain (SBD) of nucleotide-binding domain (NBD) of HSPA8/HSC70 (PubMed:27474739, HSPA8/HSC70 where as the substrate PubMed:9873016, PubMed:24318877). Inhibits release is mediated via its binding to the the pro-apoptotic function of PPP1R15A, and Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 substrate-binding domain (SBD) of has anti-apoptotic activity HSPA8/HSC70 (PubMed:<a href="http://ww (PubMed:12724406).
    [Show full text]
  • Time-Resolved Gene Expression Profiling of Human Squamous Cell Carcinoma Cells During the Apoptosis Process Induced by Photodynamic Treatment with Hypericin
    921-939.qxd 11/8/2009 11:15 Ì ™ÂÏ›‰·921 INTERNATIONAL JOURNAL OF ONCOLOGY 35: 921-939, 2009 921 Time-resolved gene expression profiling of human squamous cell carcinoma cells during the apoptosis process induced by photodynamic treatment with hypericin RENATA SANOVIC1, BARBARA KRAMMER2, SANDRA GRUMBOECK2 and THOMAS VERWANGER2 1Institute of Physiology and Pathophysiology, Paracelsus Medical Private University, Billrothstrasse 11, 5020 Salzburg; 2Department of Molecular Biology, University of Salzburg, Hellbrunnerstr. 34, 5020 Salzburg, Austria Received April 3, 2009; Accepted June 12, 2009 DOI: 10.3892/ijo_00000407 Abstract. Hypericin is used as a powerful naturally occurring Introduction photosensitizer in photodynamic therapy (PDT). Activated by visible light, it kills tumour cells and tissues via generation Photodynamic tumour therapy (PDT) is applied worldwide of reactive oxygen species (ROS). Depending on the pro- for malignant and non-malignant lesions as well as for anti- tocol, apoptotic cell death can be achieved very effectively microbial and antiviral questions. It is based on the preferential by hypericin-PDT. To analyze the fundamental molecular uptake and retention of a per se harmless dye, the photo- mechanisms leading to apoptosis induced by photodamage sensitizer, by target cells and tissue structures which, upon especially with regard to human skin cancer cells, we studied illumination with visible light of an appropriate wavelength, the alteration of the gene expression pattern in the human generates reactive oxygen species (ROS) and free radicals squamous cell carcinoma cell line A-431 at 1.5, 3, 5 and 8 h leading to the destruction of the target tissues and cells. after hypericin-PDT by cDNA-macroarray technique.
    [Show full text]
  • Recent Insights Into the Mechanism of Glucocorticosteroid- Induced Apoptosis
    Cell Death and Differentiation (2002) 9, 6±19 ã 2002 Nature Publishing Group All rights reserved 1350-9047/02 $25.00 www.nature.com/cdd Review Recent insights into the mechanism of glucocorticosteroid- induced apoptosis CW Distelhorst*,1 apoptosis.1 But progress in understanding corticosteroid- induced apoptosis has lagged behind remarkable advances in 1 Division of Hematology/Oncology and Comprehensive Cancer Center, understanding other forms of apoptosis, such as that induced Departments of Medicine and Pharmacology, Case Western Reserve by the ligands of death receptors (e.g., Fas/CD95, tumor University School of Medicine and University Hospitals of Cleveland, necrosis factor). In part, this is because corticosteroid-induced Cleveland, Ohio, USA apoptosis is initiated by a steroid receptor-mediated change in * Corresponding author: CW Distelhorst, Division of Hematology/Oncology, Case Western Reserve University, 10900 Euclid Avenue, Cleveland, Ohio, gene expression, but specific genes that mediate cell death in OH 44106-4937, USA. Tel: 216-368-1175; Fax: 216-368-1166; response to corticosteroid treatment have not been identified. E-mail: [email protected] Recent findings have shed light on events in the cell death pathway downstream from gene regulation, including the Received 20.7.01; revised 7.9.01; accepted 3.10.01 caspases responsible for the execution phase of cell death, Edited by G Nunez the unexpected involvement of the multicatalytic proteasome in the death process, the suppression of prosurvival transcrip- tion factors (e.g., AP-1, c-myc,NF-kB), and crosstalk between Abstract T cell receptor and cytokine signaling pathways. Moreover, Glucocorticosteroid hormones induce apoptosis in lympho- evidence that mitochondrial dysfunction lies downstream of cytes.
    [Show full text]
  • Dysregulation of Glucocorticoid Receptor Co-Factors FKBP5, BAG1 and PTGES3 in Prefrontal Cortex in Psychotic Illness
    OPEN Dysregulation of glucocorticoid receptor SUBJECT AREAS: co-factors FKBP5, BAG1 and PTGES3 in MOLECULAR NEUROSCIENCE prefrontal cortex in psychotic illness SCHIZOPHRENIA Duncan Sinclair1,2,3,4, Stu G. Fillman1,2,3, Maree J. Webster5 & Cynthia Shannon Weickert1,2,3 Received 1 2 20 September 2013 Schizophrenia Research Institute, Sydney, New South Wales, Australia, Neuroscience Research Australia, Sydney, New South Wales, Australia, 3School of Psychiatry, University of New South Wales, Sydney, New South Wales, Australia, 4Neuropsychiatric Accepted Signaling Program, Center for Neurobiology and Behavior, Department of Psychiatry, University of Pennsylvania, 5Stanley Medical 2 December 2013 Research Institute, Laboratory of Brain Research, 9800 Medical Center Drive, Rockville, Maryland 20850. Published 18 December 2013 Molecular abnormalities within the glucocorticoid receptor (GR) stress signaling pathway may confer, or reflect, susceptibility to stress in schizophrenia and bipolar disorder, but the extent of such abnormalities in the brain is not known. Using RNA-Seq and qPCR in two postmortem cohorts totaling 55 schizophrenia, 34 Correspondence and bipolar disorder and 55 control individuals, we identified increased FKBP5 and PTGES3 mRNA expression, requests for materials and decreased BAG1 mRNA expression, in the prefrontal cortex in schizophrenia cases relative to controls should be addressed to (68.0% [p , 0.001], 26.0% [p , 0.01] and 12.1% [p , 0.05] respectively). We also observed increased FKBP5 and decreased BAG1 mRNA expression in bipolar disorder (47.5% [p , 0.05] and 14.9% [p , 0.005]). D.S. (duncans@mail. There were no diagnostic differences in steady-state FKBP51 protein levels, nor in HSPA1A, HSP90AA1, med.upenn.edu) DNAJB1 or HSPB1 mRNA levels.
    [Show full text]
  • Blocking Nuclear Export of HSPA8 After Heat Shock Stress Severely Alters Cell Survival
    www.nature.com/scientificreports OPEN Blocking nuclear export of HSPA8 after heat shock stress severely alters cell survival Received: 13 June 2018 Fengjuan Wang1, Srinivasa Reddy Bonam 1, Nicolas Schall1, Lauriane Kuhn2, Accepted: 23 October 2018 Philippe Hammann2, Olivier Chaloin3, Jean-Baptiste Madinier1, Jean-Paul Briand1, Published: xx xx xxxx Nicolas Page4 & Sylviane Muller1,5 The nuclear translocation of endogenous heat shock cognate protein HSPA8 is a requisite for cell survival during oxidative and heat shock stress. Upon these events, cytoplasmic HSPA8 is thought to concentrate within the nucleus and nucleolus. When the situation returns to normal, HSPA8 is released from its nuclear/nucleolar anchors and redistributes into the cytoplasm. By using diferent stress conditions and a 21-mer phosphopeptide tool called P140, which binds HSPA8 and hampers its chaperone properties, we deciphered the cellular and molecular efects arising during this vital cytoplasmic-nuclear-cytoplasmic shuttling process. Using the non-metastatic fbroblastoid cell line MRL/N-1 derived from a MRL/MpTn-gld/gld lupus-prone mouse, we discovered that P140 treatment neutralized the egress of HSPA8 from nucleus to cytoplasm in the cell recovery phase. This lack of relocation of HSPA8 into the cytoplasm of heat-shocked MRL/N-1 cells altered the ability of these cells to survive when a second mild oxidative stress mimicking infammatory conditions was applied. Crosslinking experiments followed by proteomics studies showed that P140 binds regions close to nuclear import and export signal sequences encompassed within the HSPA8 structure. These data are consistent with HSPA8 having a crucial cell protective role against reactive oxygen species (ROS) production by mitochondria during infammatory conditions.
    [Show full text]