DOCSLIB.ORG

Conserved Genetic Signatures Parcellate Cardinal Spinal Neuron Classes Into Local and Projection Subsets Peter J

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Conserved Genetic Signatures Parcellate Cardinal Spinal Neuron Classes Into Local and Projection Subsets Peter J RESEARCH NEURODEVELOPMENT bined sample (Fig. 1A and fig. S1). At P0, spinal neurons have been generated and the Conserved genetic signatures parcellate cardinal basic functional features of adult spinal cir- cuitry have been established, but expression spinal neuron classes into local and persists for many developmental markers of neuronal subtype diversity (2, 9, 10, 18). Using projection subsets marker analyses, 6743 cells passed quality con- trol and were identified as neurons (Fig. 1A). Peter J. Osseward II1,2†, Neal D. Amin1‡, Jeffrey D. Moore3, Benjamin A. Temple1,2, Glutamatergic and GABAergic neurons largely Bianca K. Barriga1,4, Lukas C. Bachmann1, Fernando Beltran Jr.1, Miriam Gullo1, Robert C. Clark1, segregated in the uniform manifold approxi- Shawn P. Driscoll1, Samuel L. Pfaff1*, Marito Hayashi1†§ mationandprojection(UMAP)space,anda graph-based comparison using the highly vari- Motor and sensory functions of the spinal cord are mediated by populations of cardinal neurons arising from able genes conservatively identified 45 distinct separate progenitor lineages. However, each cardinal class is composed of multiple neuronal types with clusters(Fig.1,BandC).Asexpected,manyof distinct molecular, anatomical, and physiological features, and there is not a unifying logic that systematically these clusters were enriched for genes that have accounts for this diversity. We reasoned that the expansion of new neuronal types occurred in a stepwise been previously identified as marker genes for manner analogous to animal speciation, and we explored this by defining transcriptomic relationships using cardinal classes (Fig. 1D and table S1) (1, 2). a top-down approach. We uncovered orderly genetic tiers that sequentially divide groups of neurons by To explore the conserved relationships their motor-sensory, local-long range, and excitatory-inhibitory features. The genetic signatures defining that exist among lumbar spinal neurons, we neuronal projections were tied to neuronal birth date and conserved across cardinal classes. Thus, the developed a divisive clustering pipeline using intersection of cardinal class with projection markers provides a unifying taxonomic solution for the k-means algorithm to split spinal neurons Downloaded from systematically identifying distinct functional subsets. into pairwise groups iteratively on the basis of their overall transcriptional composition (Fig. 1, E and F). We focused on transcription factors rom a functional perspective, spinal neu- One perspective of neuronal diversity is that becausetheyregulateneuronalidentityand rons can be divided along several axes, it arose through evolution in order to expand function (2, 14, 15). We anticipated that this including motor-sensory, excitatory- neural functions (14–16). In this view, primi- approach would first reveal the glutamatergic http://science.sciencemag.org/ F inhibitory, and locally connected neurons tive neuron types served as the precursors and GABAergic neurotransmitter division in for intracord processing versus projection for more specialized subtypes, leading to the the cell population because it is such a promi- neurons for communication with the brain prediction that individualneuronalattributes nent phenotypic difference, and the two cell (1–6). Neuron heterogeneity is often charac- mayhaveemergedinastepwisefashionwith types were isolated from separate litters. How- terized on the basis of landmarks such as ordered hierarchical relationships (14, 16, 17). ever, the neuronal populations split along an their neurotransmitter type, connectivity, cyto- This analogy to animal speciation prompted us axis unrelated to neurotransmitter identity (Fig. architecture, morphology, physiology, develop- to investigate whether molecular and cellular 1, B and G) (11, 19). Differential gene expression mental origin, and genetic profile (7). In the correlates for this type of stepwise diversifica- of the first division indicated that transcription spinal cord, separate cardinal neuron classes tion could be detected among large heteroge- factor Ebf1 is highly expressed in a cell group arise from molecularly distinct progenitor neous populations of spinal neurons. Thus, we defined as group-E neurons, whereas cells arrayed along the dorsoventral axis of rather than focusing on fine-grained molecular transcription factor Hoxc10 is enriched in a on April 30, 2021 the neural tube (2, 8). Neurons within each differences that may or may not correspond different group we termed group-H neurons cardinal class share properties such as the to functional cellular features, we used a top- (Fig. 1G). Histological analysis of Ebf1+ and same neurotransmitter identity and have been down approach to identify the transcriptomic Hoxc10+ neurons identified a spatial divi- targeted in functional studies (1, 2). However, signatures linked to the emergence of differ- sion of these groups (Fig. 2, A and B, and fig. it is increasingly apparent that each cardinal ent neuronal types. At each branch point in S2). Ebf1+ neurons were located in laminae I class is itself composed of heterogeneous popu- our established hierarchy, we defined the to III of the superficial dorsal horn, corresponding lations of neuron types, impeding a detailed molecular, developmental, cytoarchitectural, to the site where many exteroceptive sensory understanding how spinal circuits function neurotransmitter, and connectivity properties inputs terminate. By contrast, Hoxc10+ neurons (9–13). We sought to determine whether there of the neurons. Our analysis uncovered molec- were predominantly located in laminae IV to was a coherent logic for spinal neuron diver- ular markers for local and projection neurons X, areas involved in proprioception and motor sification in mice that could be used to sys- regardless of cardinal class or neurotransmitter. control (3, 4). Although group-E and group-H tematically describe the heterogeneity within By combining markers for cardinal classes neurons broadly differ in motor-sensory func- all the cardinal classes. with those for conserved genetic signatures tions associated with their positions, both types for projection status, we established a simple arecomposedofamixtureofglutamatergic combinatorial matrix that systematically iden- and GABAergic neurons (Fig. 1, B and G, and 1Gene Expression Laboratory, Salk Institute for Biological tified discrete subsets of spinal neurons. fig. S3) (3, 4). Studies, La Jolla, CA 92037, USA. 2Neurosciences Graduate Program, University of California, San Diego, 9500 Gilman Drive, Group-E and -H neurons divide the spinal Group-N and -Z neurons are arrayed along the 3 La Jolla, CA 92037, USA. Howard Hughes Medical Institute, motor-sensory circuitry mediolateral axis of the spinal cord Department of Molecular and Cellular Biology, Center for Brain Science, Harvard University, Cambridge, MA, USA. 4Biological To enrich for neurons while minimizing tech- Using the hierarchical-divisive strategy outlined Sciences Graduate Program, University of California, San Diego, nical and biological variability, we genetically above (Fig. 1F), we further split the group-E 9500 Gilman Drive, La Jolla, CA 92037, USA. †These authors contributed equally to this work. labeled glutamatergic and g-aminobutyric neurons into two subgroups and found that ‡Present address: Department of Psychiatry and Behavioral acid (GABA)–ergic neurons in postnatal day this division identifies glutamatergic-related Sciences, Stanford University, Stanford, CA 94305, USA. §Present 0 (P0) mice, sorted lumbar spinal neurons and GABAergic-related genes and their cor- address: Howard Hughes Medical Institute, Department of Cell 2 4 Biology, Harvard Medical School, Boston, MA 02115, USA. separately, pooled them, and performed single- responding neurons (Fig. 1, B and H) ( , ). *Corresponding author. Email: [email protected] cell RNA-sequencing (scRNA-seq) on the com- Division of the group-H population produced Osseward et al., Science 372, 385–393 (2021) 23 April 2021 1of8 RESEARCH | RESEARCH ARTICLE A postnatal day 0 B Glutamatergic GABAergic 24 C 12 D Glutamatergic Vglut2:Cre; Vgat:Cre; 21 tdTomato tdTomato 40 dI1 18 02 dI3 17 31 28 01 29 16 dI5/LB 010203 09 12 16 19 21 24 28 3229 40 32 V2a 35 39 MN 15 31 18 27 09 03 38 35 15 19 V3 17 37 25 23 pool 38 GABAergic 22 06 scRNA-seq 11 04 03 dI4 0405 10 200733 34 36 41 100% 43 13 44 dILA 08 302614 42 41 34 10 05 dI6 22 50% 36 20 07 33 V1 11 13 23 37 0% V2b 11 23 UMAP2 08 14 30 26 45 neuron UMAP1 non-neuron E F Group-E Group-H functions? spinal neurons enriched enriched k-means 2 Group-E 300 Tshz2 cluster 1 Ebf1 Ebf2 Fig. 1G Cck Hoxc10 ... Npy UMAP 2 Nefl cluster 4 Frzb Nap1l5 200 UMAP 1 k-means 2 k-means 2 Zfhx3 Elavl2 Fig. 1H Fig. 1I Hoxd10 Nova1 Downloaded from functional 100 Cplx1 feature 1? Group-H −log10(p−value) k-means 2 k-means 2 Group-E functional Fig. 1J Fig. 1K feature 2? 0 −2 0 2 log2 Fold Change Group-Z Group-N Group-E (Glut) Group-E (GABA) enriched enriched HIenriched enriched http://science.sciencemag.org/ 300 Nfix Group-E (Glut) 300 Nfib Npy Zfhx3 Tcf4 Cck Zic1 Group-Z Group-N 200 Zic2 200 Sst Hoxb9 Lhx1 Prox1 Gad1 Nefl Sncg Tlx3 Pax2 100 100 Neurod2 −log10(p−value) Slc6a1 −log10(p−value) Zfhx4 Slc17a6 Otp Esrrg Foxp2 0 0 −2 −1 0 1 2 Group-E (GABA) −2 0 2 log2 Fold Change log2 Fold Change Group-N (Glut) Group-N (GABA) Group-Z (GABA) Group-Z (Glut) J enriched enriched K enriched enriched on April 30, 2021 Tfap2b 200 Slc17a6 150 Group-N Group-Z 150 (Glut) (Glut) Slc6a5 Pou4f1 Slc32a1 100 100 Npy Gad1 Slc17a6 Gad2 −log10(p−value) Slc6a5 50 −log10(p−value) 50 En1 Group-N Lhx1 Group-Z Lhx1 (GABA) Gad1 (GABA) Pax2 0 0 −2 0 2 −2 −10 1 2 log2 Fold Change log2 Fold Change Fig. 1. scRNA-seq identifies relationships among groups of spinal neurons. populations can be used to define branch points. The functional differences at the (A) Lumbar segments from P0 Vglut2:Cre; Ai14 and Vgat:Cre; Ai14 neonates (two branch points can be used to identify increasingly more specific neuronal females and one male from each litter) were microdissected. tdTomato+ cells were attributes linked to function.
Load more

Recommended publications
  • Molecular Mechanisms Regulating Mammalian Forebrain Development
    Molecular Mechanisms Regulating Mammalian Forebrain Development By David Chun Cheong Tsui A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Institute of Medical Science University of Toronto © Copyright by David Chun Cheong Tsui (2013) Title: Molecular Mechanisms Regulating Mammalian Forebrain Development Name: David Chun Cheong Tsui Degree: Doctor of Philosophy, 2013 Department: Institute of Medical Sciences, University of Toronto ABSTRACT While the extrinsic factors regulating neurogenesis in the developing forebrain have been widely studied, the mechanisms downstream of the various signaling pathways are relatively ill-defined. In particular, we focused on proteins that have been implicated in cognitive dysfunction. Here, we ask what role two cell intrinsic factors play in the development of two different neurogenic compartments in the forebrain. In the first part of the thesis, the transcription factor FoxP2, which is mutated in individuals who have specific language deficits, was identified to regulate neurogenesis in the developing cortex, in part by regulating the transition from the radial precursors to the transit amplifying intermediate progenitors. Moreover, we found that ectopic expression of the human homologue of the protein promotes neurogenesis in the murine cortex, thereby acting as a gain-of-function isoform. In the second part of the thesis, the histone acetyltransferase CREB-binding protein (CBP) was identified as regulating the generation of neurons from medial ganglionic eminence precursors, similar to its role in the developing cortex. But CBP also plays a more substantial role in the expression of late interneuron markers, suggesting that it is continuously required for the various stages of neurogenesis at least in the ventral neurogenic niche.
    [Show full text]
  • 1.1.4.1. Tumour Suppressor Genes
    To my Mother and Father Learn from yesterday, live for today, hope for tomorrow. The important thing is not to stop questioning. Albert Einstein Inhibition of Tumourigenicity of Small Cell Lung Cancer by Simultaneous Suppression of Id1 and Id3 Expression Danqing Chen ABSTRACT Inhibitor of DNA binding (Id) proteins are a group of transcription factors belonging to the basic helix-loop-helix (bHLH) family and play a wide range of roles in differentiation, proliferation and cell cycle progression. Id proteins act as negative dominant regulators of other bHLH factors by making dimers to these factors to prevent them from binding to E-box of DNA and, hence, to inhibit transcription of target genes. In this work, we first established SCLC cell line N417-derived sublines expressing reduced levels of Id1 and Id3 by transfection of a single vector constructed to co-express two shRNAs simultaneously. Then we investigated the effect of either singly or jointly suppressed Id1 or Id3 on tumourigenicity of SCLC cells in vitro and in vivo. The molecular mechanisms involved in the functional roles of Id1 and Id3 were also assessed. Id1-suppressed cells and Id1 and Id3 double knockdown cells produced significant reductions in proliferation rate by more than 1.4- and 3.9-fold respectively when compared with the control. Soft agar assay showed the number of colonies produced by Id1-suppressed cells and Id1 and Id3 double knockdown cells were reduced by more than 13.7- and 233-fold respectively compared with the control. The suppression effect was also observed in the invasion assay which showed that Id1-suppressed cells and Id1 and Id3 double knockdown cells produced more than 1.7- and 4.6- fold reduction respectively in relative invasiveness.
    [Show full text]
  • 7648.Full.Pdf
    The Journal of Neuroscience, October 15, 2000, 20(20):7648–7656 Evidence That Helix-Loop-Helix Proteins Collaborate with Retinoblastoma Tumor Suppressor Protein to Regulate Cortical Neurogenesis Jean G. Toma, Hiba El-Bizri, Fanie Barnabe´ -Heider, Raquel Aloyz, and Freda D. Miller Center for Neuronal Survival, Montreal Neurological Institute, Montreal, Canada H3A 2B4 The retinoblastoma tumor suppressor protein (pRb) family is phenotypes were rescued by coexpression of a constitutively essential for cortical progenitors to exit the cell cycle and survive. activated pRb mutant. In contrast, Id2 overexpression in post- In this report, we test the hypothesis that pRb collaborates with mitotic cortical neurons affected neither neuronal gene expres- basic helix-loop-helix (bHLH) transcription factors to regulate sion nor survival. Thus, pRb collaborates with HLHs to ensure the cortical neurogenesis, taking advantage of the naturally occur- coordinate induction of terminal mitosis and neuronal gene ex- ring dominant-inhibitory HLH protein Id2. Overexpression of Id2 pression as cortical progenitors become neurons. in cortical progenitors completely inhibited the induction of Key words: neurogenesis; Id2; pRb; bHLH transcription fac- neuron-specific genes and led to apoptosis, presumably as a tors; cortical development; neuronal gene expression; ␣-tubulin; consequence of conflicting differentiation signals. Both of these neural progenitor cells; neurofilaments; apoptosis During embryogenesis, cycling neural progenitor cells in the ven- In particular, in the PNS, bHLHs such as Mash-1 (Johnson et al., tricular zones of the CNS commit to a neuronal fate, and as a 1990) and the neurogenins (Ma et al., 1996; Sommer et al., 1996) consequence of that decision, coordinately undergo terminal mito- regulate the genesis of defined neuronal populations (Guillemot et sis and induce early, neuron-specific genes.
    [Show full text]
  • ISL1 Is an Essential Determinant of Structural and Functional Tonotopic Representation of Sound
    bioRxiv preprint doi: https://doi.org/10.1101/2021.09.03.458707; this version posted September 5, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 ISL1 is an essential determinant of structural and functional tonotopic representation of 2 sound 3 4 5 Authors: Iva Filovaa, 1, Kateryna Pysanenkob,1, Mitra Tavakolia, Simona Vochyanovaa, 6 Martina Dvorakovaa, Romana Bohuslavovaa, Ondrej Smolika, Sarka Benesovac, Lukas 7 Valihrachc, Ebenezer N. Yamoahd, Josef Sykab,2, Bernd Fritzsche,2, and Gabriela Pavlinkovaa,2,* 8 9 Affiliations: 10 aLaboratory of Molecular Pathogenetics, Institute of Biotechnology CAS, 25250 Vestec, 11 Czechia 12 bDepartment of Auditory Neuroscience, Institute of Experimental Medicine CAS, 142 20 13 Prague, Czechia 14 cLaboratory of Gene Expression, Institute of Biotechnology CAS, 25250 Vestec, Czechia 15 dDepartment of Physiology, School of Medicine, University of Nevada Reno, NV 89557, USA 16 eDepartment of Biology, Department of Otolaryngology, University of Iowa, Iowa City, IA 17 52242-1324, USA 18 1I.F. and K.P. contributed equally to this work. 19 2contributed to the conceptualization, evaluation, and writing of this report. 20 *to whom correspondence should be addressed. 21 Email: [email protected] 22 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.09.03.458707; this version posted September 5, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 23 Abstract 24 A cardinal feature of the auditory pathway is frequency selectivity, represented in the form of 25 a tonotopic map from the cochlea to the cortex.
    [Show full text]
  • Neuronal Basic Helix–Loop–Helix Proteins Neurod2/6 Regulate Cortical Commissure Formation Before Midline Interactions
    The Journal of Neuroscience, January 9, 2013 • 33(2):641–651 • 641 Development/Plasticity/Repair Neuronal Basic Helix–Loop–Helix Proteins Neurod2/6 Regulate Cortical Commissure Formation before Midline Interactions Ingo Bormuth,1,2* Kuo Yan,2* Tomoko Yonemasu,1 Maike Gummert,1 Mingyue Zhang,3 Sven Wichert,1 Olga Grishina,2* Alexander Pieper,1 Weiqi Zhang,3 Sandra Goebbels,1 Victor Tarabykin,2 Klaus-Armin Nave,1 and Markus H. Schwab1 1Max Planck Institute of Experimental Medicine, Department of Neurogenetics, D-37075 Go¨ttingen, Germany, 2Charite´–Universita¨tsmedizin Berlin, Institute of Cell Biology and Neurobiology, NeuroCure Cluster of Excellence, D-10115 Berlin, Germany, and 3University of Mu¨nster, Department of Psychiatry, Laboratory of Molecular Psychiatry, D-48149 Mu¨nster, Germany Establishment of long-range fiber tracts by neocortical projection neurons is fundamental for higher brain functions. The molecular control of axon tract formation, however, is still poorly understood. Here, we have identified basic helix–loop–helix (bHLH) transcrip- tion factors Neurod2 and Neurod6 as key regulators of fasciculation and targeted axogenesis in the mouse neocortex. In Neurod2/6 double-mutant mice, callosal axons lack expression of the cell adhesion molecule Contactin2, defasciculate in the subventricular zone, and fail to grow toward the midline without forming Probst bundles. Instead, mutant axons overexpress Robo1 and follow random trajectoriesintotheipsilateralcortex.Incontrasttolong-rangeaxogenesis,generationandmaintenanceofpyramidalneuronsandinitial axon outgrowth are grossly normal, suggesting that these processes are under distinct transcriptional control. Our findings define a new stage in corpus callosum development and demonstrate that neocortical projection neurons require transcriptional specification by neuronal bHLH proteins to execute an intrinsic program of remote connectivity.
    [Show full text]
  • Engineered Type 1 Regulatory T Cells Designed for Clinical Use Kill Primary
    ARTICLE Acute Myeloid Leukemia Engineered type 1 regulatory T cells designed Ferrata Storti Foundation for clinical use kill primary pediatric acute myeloid leukemia cells Brandon Cieniewicz,1* Molly Javier Uyeda,1,2* Ping (Pauline) Chen,1 Ece Canan Sayitoglu,1 Jeffrey Mao-Hwa Liu,1 Grazia Andolfi,3 Katharine Greenthal,1 Alice Bertaina,1,4 Silvia Gregori,3 Rosa Bacchetta,1,4 Norman James Lacayo,1 Alma-Martina Cepika1,4# and Maria Grazia Roncarolo1,2,4# Haematologica 2021 Volume 106(10):2588-2597 1Department of Pediatrics, Division of Stem Cell Transplantation and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 2Stanford Institute for Stem Cell Biology and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 3San Raffaele Telethon Institute for Gene Therapy, Milan, Italy and 4Center for Definitive and Curative Medicine, Stanford School of Medicine, Stanford, CA, USA *BC and MJU contributed equally as co-first authors #AMC and MGR contributed equally as co-senior authors ABSTRACT ype 1 regulatory (Tr1) T cells induced by enforced expression of interleukin-10 (LV-10) are being developed as a novel treatment for Tchemotherapy-resistant myeloid leukemias. In vivo, LV-10 cells do not cause graft-versus-host disease while mediating graft-versus-leukemia effect against adult acute myeloid leukemia (AML). Since pediatric AML (pAML) and adult AML are different on a genetic and epigenetic level, we investigate herein whether LV-10 cells also efficiently kill pAML cells. We show that the majority of primary pAML are killed by LV-10 cells, with different levels of sensitivity to killing. Transcriptionally, pAML sensitive to LV-10 killing expressed a myeloid maturation signature.
    [Show full text]
  • Emerging Roles of Inhibitor of Differentiation-1 in Alzheimer's Disease: Cell Cycle Reentry and Beyond
    cells Review Emerging Roles of Inhibitor of Differentiation-1 in Alzheimer’s Disease: Cell Cycle Reentry and Beyond 1,2, 2, 3 4,5 Shang-Der Chen y , Jenq-Lin Yang y , Yi-Chun Lin , A-Ching Chao and Ding-I Yang 6,7,* 1 Department of Neurology, Kaohsiung Chang Gung Memorial Hospital, Kaohsiung City 833401, Taiwan; [email protected] 2 Institute for Translation Research in Biomedicine, Kaohsiung Chang Gung Memorial Hospital, Kaohsiung City 833401, Taiwan; [email protected] 3 Department of Neurology, Taipei City Hospital, Taipei City 106243, Taiwan; [email protected] 4 Department of Neurology, College of Medicine, Kaohsiung Medical University, Kaohsiung City 807378, Taiwan; [email protected] 5 Department of Neurology, Kaohsiung Medical University Hospital, Kaohsiung City 807377, Taiwan 6 Institute of Brain Science, National Yang-Ming University, Taipei City 112304, Taiwan 7 Brain Research Center, National Yang-Ming University, Taipei City 112304, Taiwan * Correspondence: [email protected]; Tel.: +886-2-28267386 Contributed equally to this work. y Received: 9 June 2020; Accepted: 18 July 2020; Published: 21 July 2020 Abstract: Inhibitor of DNA-binding/differentiation (Id) proteins, a family of helix-loop-helix (HLH) proteins that includes four members of Id1 to Id4 in mammalian cells, are critical for regulating cell growth, differentiation, senescence, cell cycle progression, and increasing angiogenesis and vasculogenesis, as well as accelerating the ability of cell migration. Alzheimer’s disease (AD), the most common neurodegenerative disease in the adult population, manifests the signs of cognitive decline, behavioral changes, and functional impairment. The underlying mechanisms for AD are not well-clarified yet, but the aggregation of amyloid-beta peptides (Aβs), the major components in the senile plaques observed in AD brains, contributes significantly to the disease progression.
    [Show full text]
  • CREB-Dependent Transcription in Astrocytes: Signalling Pathways, Gene Profiles and Neuroprotective Role in Brain Injury
    CREB-dependent transcription in astrocytes: signalling pathways, gene profiles and neuroprotective role in brain injury. Tesis doctoral Luis Pardo Fernández Bellaterra, Septiembre 2015 Instituto de Neurociencias Departamento de Bioquímica i Biologia Molecular Unidad de Bioquímica y Biologia Molecular Facultad de Medicina CREB-dependent transcription in astrocytes: signalling pathways, gene profiles and neuroprotective role in brain injury. Memoria del trabajo experimental para optar al grado de doctor, correspondiente al Programa de Doctorado en Neurociencias del Instituto de Neurociencias de la Universidad Autónoma de Barcelona, llevado a cabo por Luis Pardo Fernández bajo la dirección de la Dra. Elena Galea Rodríguez de Velasco y la Dra. Roser Masgrau Juanola, en el Instituto de Neurociencias de la Universidad Autónoma de Barcelona. Doctorando Directoras de tesis Luis Pardo Fernández Dra. Elena Galea Dra. Roser Masgrau In memoriam María Dolores Álvarez Durán Abuela, eres la culpable de que haya decidido recorrer el camino de la ciencia. Que estas líneas ayuden a conservar tu recuerdo. A mis padres y hermanos, A Meri INDEX I Summary 1 II Introduction 3 1 Astrocytes: physiology and pathology 5 1.1 Anatomical organization 6 1.2 Origins and heterogeneity 6 1.3 Astrocyte functions 8 1.3.1 Developmental functions 8 1.3.2 Neurovascular functions 9 1.3.3 Metabolic support 11 1.3.4 Homeostatic functions 13 1.3.5 Antioxidant functions 15 1.3.6 Signalling functions 15 1.4 Astrocytes in brain pathology 20 1.5 Reactive astrogliosis 22 2 The transcription
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2014/0038291 A1 Ahlfors Et Al
    US 20140.038291A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2014/0038291 A1 Ahlfors et al. (43) Pub. Date: Feb. 6, 2014 (54) METHODS FOR REPROGRAMMING CELLS Publication Classification AND USES THEREOF (51) Int. Cl. (71) Applicant: New World Laboratories Inc., Laval CI2N 15/85 (2006.01) (CA) (52) U.S. Cl. CPC ...................................... CI2N 15/85 (2013.01) (72) Inventors: Jan-Eric Ahlfors, Laval, CA (US); USPC ............................ 435/.441; 435/455; 435/325 Rouwayda Elayoubi, Laval, CA (US) (73) Assignee: New World Laboratories Inc., Laval (57) ABSTRACT (CA) (21) Appl. No.: 13/843,713 Described herein are reprogrammed cells, and methods for cell dedifferentiation, transformation and eukaryotic cell (22) Filed: Mar 15, 2013 reprogramming. Also descried are cells, cell lines, and tissues that can be transplanted in a patient after steps of in vitro Related U.S. Application Data dedifferentiation and in vitro reprogramming. In particular (63) Continuation-in-part of application No. 13/464,987, embodiments the cells are Stem-Like Cell s (SLCs), including filed on May 5, 2012, which is a continuation-in-part Neural Stem-Like Cells (NSLCs), Cardiac Stem-Like Cells of applicationy -No. 13/504,988,s filed on Apr. 30, 2012, (CSLC), Hematopoietic Stem-Like Cells (HSLC), Pancreatic filed as application No. PCT/CA10/01727 on Nov. 1, Progenitor-Like Cells, and Mesendoderm-like Cells. Also 2010 described are methods for generating these cells from human Somatic cells and other types of cells. Also provided are (60) Provisional application No. 61/256,967, filed on Oct. compositions and methods of using of the cells so generated 31, 2009.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2009/0269772 A1 Califano Et Al
    US 20090269772A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2009/0269772 A1 Califano et al. (43) Pub. Date: Oct. 29, 2009 (54) SYSTEMS AND METHODS FOR Publication Classification IDENTIFYING COMBINATIONS OF (51) Int. Cl. COMPOUNDS OF THERAPEUTIC INTEREST CI2O I/68 (2006.01) CI2O 1/02 (2006.01) (76) Inventors: Andrea Califano, New York, NY G06N 5/02 (2006.01) (US); Riccardo Dalla-Favera, New (52) U.S. Cl. ........... 435/6: 435/29: 706/54; 707/E17.014 York, NY (US); Owen A. (57) ABSTRACT O'Connor, New York, NY (US) Systems, methods, and apparatus for searching for a combi nation of compounds of therapeutic interest are provided. Correspondence Address: Cell-based assays are performed, each cell-based assay JONES DAY exposing a different sample of cells to a different compound 222 EAST 41ST ST in a plurality of compounds. From the cell-based assays, a NEW YORK, NY 10017 (US) Subset of the tested compounds is selected. For each respec tive compound in the Subset, a molecular abundance profile from cells exposed to the respective compound is measured. (21) Appl. No.: 12/432,579 Targets of transcription factors and post-translational modu lators of transcription factor activity are inferred from the (22) Filed: Apr. 29, 2009 molecular abundance profile data using information theoretic measures. This data is used to construct an interaction net Related U.S. Application Data work. Variances in edges in the interaction network are used to determine the drug activity profile of compounds in the (60) Provisional application No. 61/048.875, filed on Apr.
    [Show full text]
  • Gene Expression Profiles Associated with Response to Chemotherapy in Epithelial Ovarian Cancers Amir A
    Cancer Therapy: Preclinical Gene Expression Profiles Associated with Response to Chemotherapy in Epithelial Ovarian Cancers Amir A. Jazaeri,1Christopher S. Awtrey,4 Gadisetti V.R. Chandramouli,1 Ya o E r i c Chu a n g, 2 Javed Khan,3 Christos Sotiriou,1Olga Aprelikova,1Cindy J. Yee,4 Kristin K. Zorn,6 Michael J. Birrer,6 J. Carl Barrett,1andJeff Boyd4,5 Abstract Purpose: The goal of this study was to determine whether distinct gene expression profiles are associated with intrinsic and/or acquired chemoresistance in epithelial ovarian carcinoma. Experimental Design: Gene expression profiles were generated from 21primary chemosensi- tive tumors and 24 primary chemoresistant tumors usingcDNA-based microarrays. Gene expres- sion profiles of both groups of primary tumors were then compared with those of 15 ovarian carcinomas obtained followingplatinum-based chemotherapy (‘‘postchemotherapy’’ tumors). A theme discovery tool was used to identify functional categories of genes involved in drug resistance. Results: Comparison of primary chemosensitive and chemoresistant tumors revealed differential expression of 85 genes (P < 0.001). Comparison of gene expression profiles of primary chemo- sensitive tumors and postchemotherapy tumors revealed more robust differences with 760 genes differentiatingthe two groups ( P < 0.001). In contrast, only 230 genes were differentially expressed between primary chemoresistant and postchemotherapy groups (P < 0.001). Common to both gene lists were 178 genes representing transcripts differentially expressed between post- chemotherapy tumors and all primary tumors irrespective of intrinsic chemosensitivity.The gene expression profile of postchemotherapy tumors compared with that of primary tumors revealed statistically significant overrepresentation of genes encoding extracellular matrix ^ related proteins. Conclusions: These data show that gene expression profiling can discriminate primary chemo- resistant from primary chemosensitive ovarian cancers.
    [Show full text]
  • Emerging Roles in CNS Disease and Targets for Modifying Neural Stemcell Behavior
    Cell and Tissue Research https://doi.org/10.1007/s00441-021-03490-z REVIEW Id proteins: emerging roles in CNS disease and targets for modifying neural stemcell behavior Yu‑Hsuan Chu1,2 · Jia‑di Lin1,2 · Suvra Nath1,2 · Christian Schachtrup1,3 Received: 12 April 2021 / Accepted: 18 June 2021 © The Author(s) 2021 Abstract Neural stem/progenitor cells (NSPCs) are found in the adult brain and spinal cord, and endogenous or transplanted NSPCs contribute to repair processes and regulate immune responses in the CNS. However, the molecular mechanisms of NSPC survival and integration as well as their fate determination and functionality are still poorly understood. Inhibitor of DNA binding (Id) proteins are increasingly recognized as key determinants of NSPC fate specifcation. Id proteins act by antago- nizing the DNA-binding activity of basic helix-loop-helix (bHLH) transcription factors, and the balance of Id and bHLH proteins determines cell fate decisions in numerous cell types and developmental stages. Id proteins are central in responses to environmental changes, as they occur in CNS injury and disease, and cellular responses in adult NSPCs implicate Id pro- teins as prime candidates for manipulating stemcell behavior. Here, we outline recent advances in understanding Id protein pleiotropic functions in CNS diseases and propose an integrated view of Id proteins and their promise as potential targets in modifying stemcell behavior to ameliorate CNS disease. Keywords Helix-loop-helix transcription factor · Extracellular matrix · Fibrinogen · Multiple sclerosis · Small molecule inhibitors Introduction their ability to mediate immune responses are well recog- nized. However, the molecular mechanisms that regulate Neurological diseases and injuries to the adult mammalian NSPC survival, cell-fate determination, and functional inte- central nervous system (CNS) often lead to permanent cell gration into the injured tissue under pathological conditions loss and functional impairment because the CNS has only a are poorly understood.
    [Show full text]