Virology Is That the Study of Viruses ? Submicroscopic, Parasitic Particles

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Current research in Virology & Retrovirology 2021, Vol.4, Issue 3 Editorial Bahman Khalilidehkordi Shahrekord University of Medical Sciences, Iran mobile genetic elements of cells (such as transposons, Editorial retrotransposons or plasmids) that became encapsulated in protein capsids, acquired the power to “break free” from Virology is that the study of viruses – submicroscopic, the host cell and infect other cells. Of particular interest parasitic particles of genetic material contained during a here is mimivirus, a huge virus that infects amoebae and protein coat – and virus-like agents. It focuses on the sub- encodes much of the molecular machinery traditionally sequent aspects of viruses: their structure, classification associated with bacteria. Two possibilities are that it’s a and evolution, their ways to infect and exploit host cells for simplified version of a parasitic prokaryote or it originated copy , their interaction with host organism physiology and as an easier virus that acquired genes from its host. The immunity, the diseases they cause, the techniques to iso- evolution of viruses, which frequently occurs together with late and culture them, and their use in research and ther- the evolution of their hosts, is studied within the field of apy. Virology is a subfield of microbiology.Structure and viral evolution. While viruses reproduce and evolve, they’re classification of Virus: A major branch of virology is virus doing not engage in metabolism, don’t move, and depend classification. Viruses are often classified consistent with on variety cell for copy . The often-debated question of the host cell they infect: animal viruses, plant viruses, fun- whether or not they’re alive or not could also be a matter gal viruses, and bacteriophages (viruses infecting bacte- of definition that does not affect the biological reality of vi- ria, which include the foremost complex viruses). Another ruses. Molecular biology research and viral therapy: Bacte- classification uses the geometrical shape of their capsid riophages, the viruses which infect bacteria, are often rel- (often a helix or an icosahedron) or the virus’s structure atively easily grown as viral plaques on bacterial cultures. (e.g. presence or absence of a lipid envelope). Viruses Bacteriophages occasionally move genetic material from home in size from about 30 nm to about 450 nm, which one bacterial cell to a different during a process referred suggests that the majority of them can’t be seen with light to as transduction, and this horizontal gene transfer is one microscopes. The shape and structure of viruses has been reason why they served as a major research tool within the studied by microscopy, NMR spectroscopy, and X-ray crys- early development of biology . The ordering , the function tallography. The most useful and most generally used ar- of ribozymes, the primary recombinant deoxyribonucleic rangement distinguishes viruses consistent with the sort acid and early genetic libraries were all received using bac- of macromolecule they use as genetic material and there- teriophages. Certain genetic elements derived from virus- fore the viral replication method they employ to coax host es, like highly effective promoters, are commonly utilized cells into producing more viruses: in biology research today. Growing animal viruses outside DNA viruses (divided into double-stranded DNA viruses of the living host animal is harder . Classically, fertilized and single-stranded DNA viruses), RNA viruses (divided chicken eggs have often been used, but cell cultures are into positive-sense single-stranded RNA viruses, nega- increasingly employed for this purpose today. Since some tive-sense single-stranded RNA viruses and thus the much viruses that infect eukaryotes got to transport their genet- less common double-stranded RNA viruses), reverse tran- ic material into the host cell’s nucleus, they’re attractive scribing viruses (double-stranded reverse-transcribing tools for introducing new genes into the host (known as DNA viruses and single-stranded reverse-transcribing RNA transformation or transfection). Modified retroviruses are viruses including retroviruses). often used for this purpose, as they integrate their genes into the host’s chromosomes. Virologists also study subviral particles, infectious entities notably smaller and simpler than viruses: viroids (naked DNA viruses circular RNA molecules infecting plants), satellites (nu- Viruses with a DNA genome, except for the DNA reverse cleic acid molecules with or without a capsid that require transcribing viruses, are members of three of the four rec- a helper virus for infection and reproduction), and prions ognized viral realms: Duplodnaviria, Monodnaviria, and (proteins which will exist during a pathological conforma- Varidnaviria. But the incertae sedis order Ligamenvirales, tion that induces other prion molecules to assume that and many other incertae sedis families and genera, are very same conformation). Taxa in virology aren’t necessar- also used to classify DNA viruses. The domains Duplodna- ily monophyletic, because the evolutionary relationships viria and Varidnaviria consist of double-stranded DNA vi- of the varied virus groups remain unclear. Three hypothe- ruses; other double-stranded DNA viruses are incertae se- ses regarding their origin exist: Viruses arose from non-liv- dis. The domain Monodnaviria consists of single-stranded ing matter, separately from yet in parallel to cells, perhaps DNA viruses that generally encode a HUH endonuclease; within the type of self-replicating RNA ribozymes almost other single-stranded DNA viruses are incertae sedis. like viroids. Viruses arose by genome reduction from ear- lier, more competent cellular life forms that became par- RNA viruses: asites to host cells and subsequently lost most of their All viruses that have an RNA genome, and that encode an functionality; samples of such tiny parasitic prokaryotes RNA-dependent RNA polymerase (RdRp), are members of are Mycoplasma and Nanoarchaea. Viruses arose from the kingdom Orthornavirae, within the realm Riboviria..
Recommended publications
  • Mobile Genetic Elements in Streptococci

    Mobile Genetic Elements in Streptococci

    Curr. Issues Mol. Biol. (2019) 32: 123-166. DOI: https://dx.doi.org/10.21775/cimb.032.123 Mobile Genetic Elements in Streptococci Miao Lu#, Tao Gong#, Anqi Zhang, Boyu Tang, Jiamin Chen, Zhong Zhang, Yuqing Li*, Xuedong Zhou* State Key Laboratory of Oral Diseases, National Clinical Research Center for Oral Diseases, West China Hospital of Stomatology, Sichuan University, Chengdu, PR China. #Miao Lu and Tao Gong contributed equally to this work. *Address correspondence to: [email protected], [email protected] Abstract Streptococci are a group of Gram-positive bacteria belonging to the family Streptococcaceae, which are responsible of multiple diseases. Some of these species can cause invasive infection that may result in life-threatening illness. Moreover, antibiotic-resistant bacteria are considerably increasing, thus imposing a global consideration. One of the main causes of this resistance is the horizontal gene transfer (HGT), associated to gene transfer agents including transposons, integrons, plasmids and bacteriophages. These agents, which are called mobile genetic elements (MGEs), encode proteins able to mediate DNA movements. This review briefly describes MGEs in streptococci, focusing on their structure and properties related to HGT and antibiotic resistance. caister.com/cimb 123 Curr. Issues Mol. Biol. (2019) Vol. 32 Mobile Genetic Elements Lu et al Introduction Streptococci are a group of Gram-positive bacteria widely distributed across human and animals. Unlike the Staphylococcus species, streptococci are catalase negative and are subclassified into the three subspecies alpha, beta and gamma according to the partial, complete or absent hemolysis induced, respectively. The beta hemolytic streptococci species are further classified by the cell wall carbohydrate composition (Lancefield, 1933) and according to human diseases in Lancefield groups A, B, C and G.
  • Equine Rotavirus Strain Arg/E706/2008 VP7 (VP7) Gene, Partial Cds Genbank: GU373939.1 FASTA Graphics Popset

    Equine Rotavirus Strain Arg/E706/2008 VP7 (VP7) Gene, Partial Cds Genbank: GU373939.1 FASTA Graphics Popset

    Equine rotavirus strain Arg/E706/2008 VP7 (VP7) gene, partial cds GenBank: GU373939.1 FASTA Graphics PopSet Go to: LOCUS GU373939 972 bp RNA linear VRL 25-JUL-2016 DEFINITION Equine rotavirus strain Arg/E706/2008 VP7 (VP7) gene, partial cds. ACCESSION GU373939 VERSION GU373939.1 KEYWORDS . SOURCE Equine rotavirus ORGANISM Equine rotavirus Viruses; Riboviria; Orthornavirae; Duplornaviricota; Resentoviricetes; Reovirales; Reoviridae; Sedoreovirinae; Rotavirus; unclassified Rotavirus. REFERENCE 1 (bases 1 to 972) AUTHORS Garaicoechea,L., Mino,S.O., Barrandeguy,M. and Parreno,V. TITLE Molecular Characterization of Equine rotavirus Circulating in Sport Horses of Argentina During a 17-year Period (1992-2008) JOURNAL Unpublished REFERENCE 2 (bases 1 to 972) AUTHORS Garaicoechea,L., Mino,S.O., Barrandeguy,M. and Parreno,V. TITLE Direct Submission JOURNAL Submitted (29-DEC-2009) Virology Institute, INTA, Dr Nicolas Repetto y de Los Reseros s/n, Castelar, Buenos Aires 1712, ArgentinaFEATURES Location/Qualifiers source 1..972 /organism="Equine rotavirus" /mol_type="genomic RNA" /strain="Arg/E706/2008" /isolation_source="fecal sample" /host="equine" /db_xref="taxon:10937" /country="Argentina: Buenos Aires" /collection_date="2008" /note="genotype: G14" gene 7..>972 /gene="VP7" CDS 7..>972 /gene="VP7" /codon_start=1 /product="VP7" /protein_id="AEF33475.1" /translation="MYGIEYTTILTFLISLILLNYILQLLTRIMDFIIYRFLLIIVLL SPFLNAQNYGINLPITGSMDTAYVNSTQENIFLTSTLCLYYPTEAATQIDDSSWKDTI SQLFLTKGWPTGSVYLKEYTDIASFSIDPQLYCDYNVVLMKYDEALQLDMSELADLIL NEWLCNPMDITLYYYQQTDEANKWISMGSSCTIKVCPLNTQTLGIGCLTTNVATFEEV
  • Identification of Capsid/Coat Related Protein Folds and Their Utility for Virus Classification

    Identification of Capsid/Coat Related Protein Folds and Their Utility for Virus Classification

    ORIGINAL RESEARCH published: 10 March 2017 doi: 10.3389/fmicb.2017.00380 Identification of Capsid/Coat Related Protein Folds and Their Utility for Virus Classification Arshan Nasir 1, 2 and Gustavo Caetano-Anollés 1* 1 Department of Crop Sciences, Evolutionary Bioinformatics Laboratory, University of Illinois at Urbana-Champaign, Urbana, IL, USA, 2 Department of Biosciences, COMSATS Institute of Information Technology, Islamabad, Pakistan The viral supergroup includes the entire collection of known and unknown viruses that roam our planet and infect life forms. The supergroup is remarkably diverse both in its genetics and morphology and has historically remained difficult to study and classify. The accumulation of protein structure data in the past few years now provides an excellent opportunity to re-examine the classification and evolution of viruses. Here we scan completely sequenced viral proteomes from all genome types and identify protein folds involved in the formation of viral capsids and virion architectures. Viruses encoding similar capsid/coat related folds were pooled into lineages, after benchmarking against published literature. Remarkably, the in silico exercise reproduced all previously described members of known structure-based viral lineages, along with several proposals for new Edited by: additions, suggesting it could be a useful supplement to experimental approaches and Ricardo Flores, to aid qualitative assessment of viral diversity in metagenome samples. Polytechnic University of Valencia, Spain Keywords: capsid, virion, protein structure, virus taxonomy, SCOP, fold superfamily Reviewed by: Mario A. Fares, Consejo Superior de Investigaciones INTRODUCTION Científicas(CSIC), Spain Janne J. Ravantti, The last few years have dramatically increased our knowledge about viral systematics and University of Helsinki, Finland evolution.
  • 2020 Taxonomic Update for Phylum Negarnaviricota (Riboviria: Orthornavirae), Including the Large Orders Bunyavirales and Mononegavirales

    2020 Taxonomic Update for Phylum Negarnaviricota (Riboviria: Orthornavirae), Including the Large Orders Bunyavirales and Mononegavirales

    Archives of Virology https://doi.org/10.1007/s00705-020-04731-2 VIROLOGY DIVISION NEWS 2020 taxonomic update for phylum Negarnaviricota (Riboviria: Orthornavirae), including the large orders Bunyavirales and Mononegavirales Jens H. Kuhn1 · Scott Adkins2 · Daniela Alioto3 · Sergey V. Alkhovsky4 · Gaya K. Amarasinghe5 · Simon J. Anthony6,7 · Tatjana Avšič‑Županc8 · María A. Ayllón9,10 · Justin Bahl11 · Anne Balkema‑Buschmann12 · Matthew J. Ballinger13 · Tomáš Bartonička14 · Christopher Basler15 · Sina Bavari16 · Martin Beer17 · Dennis A. Bente18 · Éric Bergeron19 · Brian H. Bird20 · Carol Blair21 · Kim R. Blasdell22 · Steven B. Bradfute23 · Rachel Breyta24 · Thomas Briese25 · Paul A. Brown26 · Ursula J. Buchholz27 · Michael J. Buchmeier28 · Alexander Bukreyev18,29 · Felicity Burt30 · Nihal Buzkan31 · Charles H. Calisher32 · Mengji Cao33,34 · Inmaculada Casas35 · John Chamberlain36 · Kartik Chandran37 · Rémi N. Charrel38 · Biao Chen39 · Michela Chiumenti40 · Il‑Ryong Choi41 · J. Christopher S. Clegg42 · Ian Crozier43 · John V. da Graça44 · Elena Dal Bó45 · Alberto M. R. Dávila46 · Juan Carlos de la Torre47 · Xavier de Lamballerie38 · Rik L. de Swart48 · Patrick L. Di Bello49 · Nicholas Di Paola50 · Francesco Di Serio40 · Ralf G. Dietzgen51 · Michele Digiaro52 · Valerian V. Dolja53 · Olga Dolnik54 · Michael A. Drebot55 · Jan Felix Drexler56 · Ralf Dürrwald57 · Lucie Dufkova58 · William G. Dundon59 · W. Paul Duprex60 · John M. Dye50 · Andrew J. Easton61 · Hideki Ebihara62 · Toufc Elbeaino63 · Koray Ergünay64 · Jorlan Fernandes195 · Anthony R. Fooks65 · Pierre B. H. Formenty66 · Leonie F. Forth17 · Ron A. M. Fouchier48 · Juliana Freitas‑Astúa67 · Selma Gago‑Zachert68,69 · George Fú Gāo70 · María Laura García71 · Adolfo García‑Sastre72 · Aura R. Garrison50 · Aiah Gbakima73 · Tracey Goldstein74 · Jean‑Paul J. Gonzalez75,76 · Anthony Grifths77 · Martin H. Groschup12 · Stephan Günther78 · Alexandro Guterres195 · Roy A.
  • The LUCA and Its Complex Virome in Another Recent Synthesis, We Examined the Origins of the Replication and Structural Mart Krupovic , Valerian V

    The LUCA and Its Complex Virome in Another Recent Synthesis, We Examined the Origins of the Replication and Structural Mart Krupovic , Valerian V

    PERSPECTIVES archaea that form several distinct, seemingly unrelated groups16–18. The LUCA and its complex virome In another recent synthesis, we examined the origins of the replication and structural Mart Krupovic , Valerian V. Dolja and Eugene V. Koonin modules of viruses and posited a ‘chimeric’ scenario of virus evolution19. Under this Abstract | The last universal cellular ancestor (LUCA) is the most recent population model, the replication machineries of each of of organisms from which all cellular life on Earth descends. The reconstruction of the four realms derive from the primordial the genome and phenotype of the LUCA is a major challenge in evolutionary pool of genetic elements, whereas the major biology. Given that all life forms are associated with viruses and/or other mobile virion structural proteins were acquired genetic elements, there is no doubt that the LUCA was a host to viruses. Here, by from cellular hosts at different stages of evolution giving rise to bona fide viruses. projecting back in time using the extant distribution of viruses across the two In this Perspective article, we combine primary domains of life, bacteria and archaea, and tracing the evolutionary this recent work with observations on the histories of some key virus genes, we attempt a reconstruction of the LUCA virome. host ranges of viruses in each of the four Even a conservative version of this reconstruction suggests a remarkably complex realms, along with deeper reconstructions virome that already included the main groups of extant viruses of bacteria and of virus evolution, to tentatively infer archaea. We further present evidence of extensive virus evolution antedating the the composition of the virome of the last universal cellular ancestor (LUCA; also LUCA.
  • The Mimivirus 1.2 Mb Dsdna Genome Is Elegantly Organized Into a Nuclear-Like Weapon

    The Mimivirus 1.2 Mb Dsdna Genome Is Elegantly Organized Into a Nuclear-Like Weapon

    The Mimivirus 1.2 Mb dsDNA genome is elegantly organized into a nuclear-like weapon Chantal Abergel ( [email protected] ) French National Centre for Scientic Research https://orcid.org/0000-0003-1875-4049 Alejandro Villalta Casares French National Centre for Scientic Research https://orcid.org/0000-0002-7857-7067 Emmanuelle Quemin University of Hamburg Alain Schmitt French National Centre for Scientic Research Jean-Marie Alempic French National Centre for Scientic Research Audrey Lartigue French National Centre for Scientic Research Vojta Prazak University of Oxford Daven Vasishtan Oxford Agathe Colmant French National Centre for Scientic Research Flora Honore French National Centre for Scientic Research https://orcid.org/0000-0002-0390-8730 Yohann Coute University Grenoble Alpes, CEA https://orcid.org/0000-0003-3896-6196 Kay Gruenewald University of Oxford https://orcid.org/0000-0002-4788-2691 Lucid Belmudes Univ. Grenoble Alpes, CEA, INSERM, IRIG, BGE Biological Sciences - Article Keywords: Mimivirus 1.2 Mb dsDNA, viral genome, organization, RNA polymerase subunits Posted Date: February 16th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-83682/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Mimivirus 1.2 Mb genome is elegantly organized into a nuclear-like weapon Alejandro Villaltaa#, Emmanuelle R. J. Queminb#, Alain Schmitta#, Jean-Marie Alempica, Audrey Lartiguea, Vojtěch Pražákc, Lucid Belmudesd, Daven Vasishtanc, Agathe M. G. Colmanta, Flora A. Honoréa, Yohann Coutéd, Kay Grünewaldb,c, Chantal Abergela* aAix–Marseille University, Centre National de la Recherche Scientifique, Information Génomique & Structurale, Unité Mixte de Recherche 7256 (Institut de Microbiologie de la Méditerranée, FR3479), 13288 Marseille Cedex 9, France.
  • Comprehensive Analysis of Mobile Genetic Elements in the Gut Microbiome Reveals Phylum-Level Niche-Adaptive Gene Pools

    Comprehensive Analysis of Mobile Genetic Elements in the Gut Microbiome Reveals Phylum-Level Niche-Adaptive Gene Pools

    bioRxiv preprint doi: https://doi.org/10.1101/214213; this version posted December 22, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Comprehensive analysis of mobile genetic elements in the gut microbiome 2 reveals phylum-level niche-adaptive gene pools 3 Xiaofang Jiang1,2,†, Andrew Brantley Hall2,3,†, Ramnik J. Xavier1,2,3,4, and Eric Alm1,2,5,* 4 1 Center for Microbiome Informatics and Therapeutics, Massachusetts Institute of Technology, 5 Cambridge, MA 02139, USA 6 2 Broad Institute of MIT and Harvard, Cambridge, MA 02142, USA 7 3 Center for Computational and Integrative Biology, Massachusetts General Hospital and Harvard 8 Medical School, Boston, MA 02114, USA 9 4 Gastrointestinal Unit and Center for the Study of Inflammatory Bowel Disease, Massachusetts General 10 Hospital and Harvard Medical School, Boston, MA 02114, USA 11 5 MIT Department of Biological Engineering, Massachusetts Institute of Technology, Cambridge, MA 12 02142, USA 13 † Co-first Authors 14 * Corresponding Author bioRxiv preprint doi: https://doi.org/10.1101/214213; this version posted December 22, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 15 Abstract 16 Mobile genetic elements (MGEs) drive extensive horizontal transfer in the gut microbiome. This transfer 17 could benefit human health by conferring new metabolic capabilities to commensal microbes, or it could 18 threaten human health by spreading antibiotic resistance genes to pathogens. Despite their biological 19 importance and medical relevance, MGEs from the gut microbiome have not been systematically 20 characterized.
  • The Association of Group IIB Intron with Integrons in Hypersaline Environments Sarah Sonbol1 and Rania Siam1,2*

    The Association of Group IIB Intron with Integrons in Hypersaline Environments Sarah Sonbol1 and Rania Siam1,2*

    Sonbol and Siam Mobile DNA (2021) 12:8 https://doi.org/10.1186/s13100-021-00234-2 RESEARCH Open Access The association of group IIB intron with integrons in hypersaline environments Sarah Sonbol1 and Rania Siam1,2* Abstract Background: Group II introns are mobile genetic elements used as efficient gene targeting tools. They function as both ribozymes and retroelements. Group IIC introns are the only class reported so far to be associated with integrons. In order to identify group II introns linked with integrons and CALINS (cluster of attC sites lacking a neighboring integron integrase) within halophiles, we mined for integrons in 28 assembled metagenomes from hypersaline environments and publically available 104 halophilic genomes using Integron Finder followed by blast search for group II intron reverse transcriptases (RT)s. Results: We report the presence of different group II introns associated with integrons and integron-related sequences denoted by UHB.F1, UHB.I2, H.ha.F1 and H.ha.F2. The first two were identified within putative integrons in the metagenome of Tanatar-5 hypersaline soda lake, belonging to IIC and IIB intron classes, respectively at which the first was a truncated intron. Other truncated introns H.ha.F1 and H.ha.F2 were also detected in a CALIN within the extreme halophile Halorhodospira halochloris, both belonging to group IIB introns. The intron-encoded proteins (IEP) s identified within group IIB introns belonged to different classes: CL1 class in UHB.I2 and bacterial class E in H.ha.Fa1 and H.ha.F2. A newly identified insertion sequence (ISHahl1)ofIS200/605 superfamily was also identified adjacent to H.
  • Rapid Protein Sequence Evolution Via Compensatory Frameshift Is Widespread in RNA Virus Genomes

    Rapid Protein Sequence Evolution Via Compensatory Frameshift Is Widespread in RNA Virus Genomes

    Park and Hahn BMC Bioinformatics (2021) 22:251 https://doi.org/10.1186/s12859-021-04182-9 RESEARCH Open Access Rapid protein sequence evolution via compensatory frameshift is widespread in RNA virus genomes Dongbin Park and Yoonsoo Hahn* *Correspondence: [email protected] Abstract Department of Life Science, Background: RNA viruses possess remarkable evolutionary versatility driven by the Chung-Ang University, Seoul 06794, South Korea high mutability of their genomes. Frameshifting nucleotide insertions or deletions (indels), which cause the premature termination of proteins, are frequently observed in the coding sequences of various viral genomes. When a secondary indel occurs near the primary indel site, the open reading frame can be restored to produce functional proteins, a phenomenon known as the compensatory frameshift. Results: In this study, we systematically analyzed publicly available viral genome sequences and identifed compensatory frameshift events in hundreds of viral protein- coding sequences. Compensatory frameshift events resulted in large-scale amino acid diferences between the compensatory frameshift form and the wild type even though their nucleotide sequences were almost identical. Phylogenetic analyses revealed that the evolutionary distance between proteins with and without a compensatory frameshift were signifcantly overestimated because amino acid mismatches caused by compensatory frameshifts were counted as substitutions. Further, this could cause compensatory frameshift forms to branch in diferent locations in the protein and nucleotide trees, which may obscure the correct interpretation of phylogenetic rela- tionships between variant viruses. Conclusions: Our results imply that the compensatory frameshift is one of the mecha- nisms driving the rapid protein evolution of RNA viruses and potentially assisting their host-range expansion and adaptation.
  • Article Download (79)

    Article Download (79)

    wjpls, 2020, Vol. 6, Issue 6, 152-161 Review Article ISSN 2454-2229 Pratik et al. World Journal of Pharmaceutical World Journaland Life of Pharmaceutica Sciencesl and Life Science WJPLS www.wjpls.org SJIF Impact Factor: 6.129 THE NOVEL CORONAVIRUS (COVID-19) CAUSATIVE AGENT FOR HUMAN RESPIRATORY DISEASES Pratik V. Malvade1*, Rutik V. Malvade2, Shubham P. Varpe3 and Prathamesh B. Kadu3 1Pravara Rural College of Pharmacy, Pravaranagar, 413736, Dist. - Ahmednagar (M.S.) India. 2Pravara Rural Engineering College, Loni, 413736, Dist. - Ahmednagar (M.S.) India. 3Ashvin College Of Pharmacy, Manchi Hill, Ashvi Bk., 413714, Dist.- Ahmednagar (M.S.) India. *Corresponding Author: Pratik V. Malvade Pravara Rural College of Pharmacy, Pravaranagar, 413736, Dist. - Ahmednagar (M.S.) India. Article Received on 08/04/2020 Article Revised on 29/04/2020 Article Accepted on 19/05/2020 ABSTRACT The newly founded human coronavirus has named as Covid-19. The full form of Covid-19 is “Co-Corona, vi- virus and d- disease”. The Covid-19 is also named as 2019-nCoV because of it was firstly identified at the end of 2019. The coronavirus are the group of various types of viruses i.e. some have positive-sense, single stranded RNA and they are covered within the envelope made up of protein. Still now days seven human coronaviruses are identified are Nl 63, 229E, OC43, HKU1, SARS-CoV, MERS-CoV and latest Covid-19 also known as SARS-CoV-2. From above all, the SARS-CoV and MERS-CoV causes the highest outbreak but the outbreak of Covid-19 is much more than the other any virus.
  • Viruses of Hyperthermophilic Archaea: Entry and Egress from the Host Cell

    Viruses of Hyperthermophilic Archaea: Entry and Egress from the Host Cell

    Viruses of hyperthermophilic archaea : entry and egress from the host cell Emmanuelle Quemin To cite this version: Emmanuelle Quemin. Viruses of hyperthermophilic archaea : entry and egress from the host cell. Microbiology and Parasitology. Université Pierre et Marie Curie - Paris VI, 2015. English. NNT : 2015PA066329. tel-01374196 HAL Id: tel-01374196 https://tel.archives-ouvertes.fr/tel-01374196 Submitted on 30 Sep 2016 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Université Pierre et Marie Curie – Paris VI Unité de Biologie Moléculaire du Gène chez les Extrêmophiles Ecole doctorale Complexité du Vivant ED515 Département de Microbiologie - Institut Pasteur 7, quai Saint-Bernard, case 32 25, rue du Dr. Roux 75252 Paris Cedex 05 75015 Paris THESE DE DOCTORAT DE L’UNIVERSITE PIERRE ET MARIE CURIE Spécialité : Microbiologie Pour obtenir le grade de DOCTEUR DE L’UNIVERSITE PIERRE ET MARIE CURIE VIRUSES OF HYPERTHERMOPHILIC ARCHAEA: ENTRY INTO AND EGRESS FROM THE HOST CELL Présentée par M. Emmanuelle Quemin Soutenue le 28 Septembre 2015 devant le jury composé de : Prof. Guennadi Sezonov Président du jury Prof. Christa Schleper Rapporteur de thèse Dr. Paulo Tavares Rapporteur de thèse Dr.
  • The Obscure World of Integrative and Mobilizable Elements Gérard Guédon, Virginie Libante, Charles Coluzzi, Sophie Payot-Lacroix, Nathalie Leblond-Bourget

    The Obscure World of Integrative and Mobilizable Elements Gérard Guédon, Virginie Libante, Charles Coluzzi, Sophie Payot-Lacroix, Nathalie Leblond-Bourget

    The obscure world of integrative and mobilizable elements Gérard Guédon, Virginie Libante, Charles Coluzzi, Sophie Payot-Lacroix, Nathalie Leblond-Bourget To cite this version: Gérard Guédon, Virginie Libante, Charles Coluzzi, Sophie Payot-Lacroix, Nathalie Leblond-Bourget. The obscure world of integrative and mobilizable elements: Highly widespread elements that pirate bacterial conjugative systems. Genes, MDPI, 2017, 8 (11), pp.337. 10.3390/genes8110337. hal- 01686871 HAL Id: hal-01686871 https://hal.archives-ouvertes.fr/hal-01686871 Submitted on 26 May 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License G C A T T A C G G C A T genes Review The Obscure World of Integrative and Mobilizable Elements, Highly Widespread Elements that Pirate Bacterial Conjugative Systems Gérard Guédon *, Virginie Libante, Charles Coluzzi, Sophie Payot and Nathalie Leblond-Bourget * ID DynAMic, Université de Lorraine, INRA, 54506 Vandœuvre-lès-Nancy, France; [email protected] (V.L.); [email protected] (C.C.); [email protected] (S.P.) * Correspondence: [email protected] (G.G.); [email protected] (N.L.-B.); Tel.: +33-037-274-5142 (G.G.); +33-037-274-5146 (N.L.-B.) Received: 12 October 2017; Accepted: 15 November 2017; Published: 22 November 2017 Abstract: Conjugation is a key mechanism of bacterial evolution that involves mobile genetic elements.