$2.2M$2,200,000 $2,100,000 90 DAY $2,000,000$2.0M $1,900,000
$1,800,000 GOLDEN TICKET EVENT $1,700,000 $1,600,000 $ $1.5M$1,500,000 MOTORS UP TO 30,000 GIVE AWAY ON NOW TIL SEPT. 27/2019 $1,400,000 $1,300,000
See Dealer for details or check www.wainalta.com for rules & regulations $1,200,000 !VE7AINWRIGHT !"p4OLL&REE $1,100,000 $1.0M$1,000,000 $900,000
$800,000
$700,000
$600,000 $0.5M$500,000 Baughan Realty $400,000 INDEPENDENTLY OWNED & OPERATED $300,000 Website: baughanrealty.com $200,000 621 - 10th St., Wainwright, AB Phone: (780) 842-3855 $100,000
$000,000 Celebrating PLEDGED COMMITMENT 40 years Baughan Realty & 25 years Remax CT SCANNER PROJECT serving Wainwright & Area Donations can be made at all August 2, 2019 Wainwright Banks and Each Star News Inc. Wainwright AB. Volume 6 Number 41 Our mission: To serve our readers with news and advertising of high integrity. Encompass Credit Union in the area.
A nice cold drink to support the CT scanner project
A group of friends banded together on Wednesday, July 31, to sell lemonade and candy in front of No Frills in Wainwright to raise funds for the CT scan- Photo: Zak McLachlan ner community project. Pictured, from left, are Danna Jaber, Payton Longley, Breeanna Longley, Peyton Walker, Nevaeh Sheridan and Joss Opper.
“We love to make you smile”
$FFHSWLQJ1HZ3DWLHQWV! Dr. Nordstrom (780) 842-6838 Dr. Jacob Dr. Radasic 2 EDGE | Wainwright, AB | August 2, 2019 Rain Dog Skate Shop owner fundraising for indoor skatepark
Zak McLachlan boarding has meant so much to him. He [email protected] began skateboarding at the age of seven, and although he doesn’t skate much any- ravis Anderson has a passion for skate- more after suffering a number of injuries Tboarding, and he wants to pass on that throughout the years, he believes it is a passion to the younger generation. great activity for youths to pick up. Anderson is the owner of Rain Dog Skate “I’ve always looked at it like if you play Shop in Wainwright, which provides local hockey and you’re really good at hockey, skateboarders with a place close to home then you’re really good at hockey. But if to fill all their skateboarding needs. But he that guy tries to play soccer, he’s probably wants to take that one step further. not that good at soccer. But with skate- Anderson has started a GoFundMe page boarding, if you’re good at skateboarding to help fund a new indoor skate park in you’re going to be good at mountain board- Wainwright, and he believes it would be a ing, you’re going to be good at surfing, and great addition to the community. you’re going to work on your endurance “Looking at the surrounding area, the and balance and stamina,” he said. only indoor skate park is either in Saska- “It’s kind of a ball of talent that you can toon or Edmonton, and there’s nothing in use anywhere, and that’s how I’ve al- between. So I saw the need and I want to ways looked at it. Yeah, for a lot of people fill the need. I’ve heard some not so good it’s a hobby. But it’s just like going to the things about the current skatepark, and gym. You go 20 minutes on a skateboard I feel like if we have an indoor park we and you’re sweating, plus you’re running around in the heat and just getting good could change all of those issues,” he said. Travis Anderson, owner of Rain Dog Skate Shop, has big plans for Photo: Zak Anderson referenced the complaints he an all seasons indoor skatepark in Wainwright. McLachlan exercise.” has heard about fights, thefts, use of drugs Plans are starting to come together for and other issues at the current outdoor the indoor skatepark, and Anderson said skatepark, and he thinks an indoor facility would of the local pros who are on their way up. They want he hopes to have it up and running in the next two give local youths a chance to enjoy the sport with- to teach kids the fundamentals like how to stand years. He said having an indoor park for local skat- out having to deal with any of the negative issues on a skateboard, how to ride a skateboard properly, ers will only help to grow the sport and give more that could come into play at an how to learn the flow of a park youths more opportunities throughout the year. unsupervised park. and that sort of thing. I think it’s “People are hungry for it. Having this outdoor “It would be under surveil- “Looking around at the important that we focus on peo- park is great, but if it’s too hot you can’t skate it, if it’s lance, and if anybody was seen surrounding area, the only ple our age for skateboarding, too cold you can’t skate it and if it’s raining you can’t causing any kind of bullying indoor skatepark is either but also it’s the future of skate- skate it. And it’s also not the best beginner park with or any of that going on, they’re boarding we’re trying to develop eight foot ramps…There are just so many things out of there. It will be a safe in Saskatoon or Edmonton, with this,” Anderson said. that come into play,” he said. place where people can just go and there’s nothing in On top of the GoFundMe page, “So we want to give skaters a beginning point and skate,” he said. between. So I saw the need Anderson has a number of ideas and some big ramps for the experienced guys and a Another part of the plan is to for fundraising events such as street area as well so we can hit all the demograph- offer a skateboarding school for and I want to fill the need.” raffles and skateboard competi- ics that way.” local youths to teach them all - Travis Anderson, tions like the one hosted by Rain Keep an eye on the Rain Dog Skate Shop Face- the ins and outs of the sport. Rain Dog Skate Shop Dog Skate Shop back on June 15. book page for information on upcoming fundraisers “We’re also going to do a Anderson said he is excited or check out the project’s GoFundMe page at www. skateboarding school with two to help grow the sport amongst www.gofundme.com/f/rdss-indoor-skate-park. youth in the area because skate- EDGE ARE YOU MÉTIS? The Métis Nation of Alberta will be available to help you BACK TO SCHOOL through the Métis Citizenship application process. SEASON IS ALMOST Join us in WAINWRIGHT UNDERWAY. ASK ABOUT OUR AUG Communiplex FAMILY EYEGLASS X19074MM0700 – 2 Avenue PACKAGES TO 06 2pm - 7pm SAVE THE DAY!
Have questions about harvesting? A qualified harvesting coordinator from the MNA will be there to help.
Dr. Jones-Greenwood & Associates 2802-15 Ave. Wainwright Professional Building, Second Floor HRS: Mon/ 9:30am-5:30pm, Tues, Wed & Fri/ Ph: 780-842-6123 or 1-888-853-3937 www.prairie.vision 8:30am-5:30pm, Thurs/ 9:30am-7:30pm 20% OFF ALL IN-STOCK AMMO Gibsons Home Hardware Bullet SALE 1025 - 2nd Avenue, Wainwright ON NOW TIL AUGUST 31, 2019 Tel: (780) 842-6111 * ALL CALIBRES * FEDERAL AMMUNITION SHOWN ONLY EDGE | Wainwright, AB | August 2, 2019 3 Mosquitoes – from Kilo Oscar Sierra Hotel By Roger Holmes annoyance to menace Chapter 1
Commentary by Phyllis o anyone in- Holmes Tvolved in avia- [email protected] tion the word “Os- hkosh” has special meaning. For those t is frustrating to have a gor- not connected to avi- Igeous summer day outside ation it may mean thwarted by the buzzing of mos- children’s clothing. quitoes. They are an annoyance Aviators use that manages to spoil too much Aircraft used to travel to Oshkosh. Photo: Roger Holmes terms like “Mecca” of our already short summers. and “Pilgrims” to But as Canadians we are mostly spared describe the Osh- ity of Zika virus, (first spread to humans the more dangerous ravages of this tiny kosh experience. An analogy that resonates with a lot of people is “Osh- in 1952) potentially contracted during a creature. kosh is to aircraft as Sturgis is to motorcycles”. visit to warmer climes has made even Ca- On a trip to Africa I was told that the Oshkosh is located in east central Wisconsin on the shores of Lake Win- nadians nervous. We have reason to be. most dangerous animal was not the lion nebago. In late July each year for the past 50 years aviators have migrated The rest of the world knows the menace of or even the hippopotamus, it was the here for a week to share the experience of flight. mosquitos all too well. mosquito. The World Health Organiza- The magnitude of the event is staggering. The airport and several nearby Maclean’s warns “A warming planet tion (WHO) asserts that more deaths are airports record over 10,000 aircraft arrivals during the event. Those who do and a global population ever more on the associated with mosquitoes than any not arrive by aircraft also come in droves. Over 200,000 individuals will move will see diseases known and still other animal on the planet. Their capacity come to the 7 day event. Many stay for more than one day boosting the unknown move to now quiescent areas.” for spreading disease in humans results in week long entrance to over 600,000. It notes, “As the world warms, mosquito- millions of deaths each year. MacLean’s This is the story of one of those. bore diseases will expand into higher magazine (August, 2019) recounts the “RV over Fisk rock your wings” “good rock, turn right and follow the air- altitudes and higher latitudes. This is stark statistic that of the 108 billion peo- craft in front of you down Fisk avenue for a left base on 36 monitor tower confirmed by the Government of Canada ple who have ever lived, mosquito-borne on 126.6” website, “Canadians will likely face an diseases have killed close to half of all of I am in the back seat of a small home built aircraft. The pilot is Dennis increased risk of mosquito-borne diseases those or 52 billion people. Fox of Three Hills. It is his first approach into Oshkosh. We are lucky. The due to climate change. The Public Health More than half of the world’s popula- traffic is light. We are following a Bonanza and listening for more instruc- Agency of Canada explains, “Increases in tion lives in areas affected by the mosqui- tions. “RV on base 36 left start your decent” “RV turn final for 36 left cleared temperature, changes in rainfall patterns to-borne diseases including Zika, dengue, to land yellow dot” Dennis has the plane lined up on the left runway and and a decreased number of frost days cre- chikungunya and yellow fever, carried by we fly down to a large yellow dot half way down the 6,000 ft. runway. ate an ideal habitat for mosquitoes to live, the aedes aegypti mosquito. The WHO ad- “Welcome to Oshkosh, turn left off the runway follow the flag men to park- breed and transmit disease in Canada.” vises that the incidence of dengue has ris- ing.” I go outside to work in the yard. I put en 30 times over in the past 30 years and It is hot and humid. Dennis slides back the canopy and we hold up a sign on the requisite sunscreen and spray in- more countries are reporting their first with the large letters HBC for the ground crew to guide us to the Home sect repellant laced with DEET liberally. outbreaks. There are other types of mos- Built Camping area. Dennis is relieved, we made it. A guy on a small mo- Still, at the end of the day I see two mos- quitoes including the culex that transmits torcycle wearing a safety vest signals us to follow him. He takes us down a quito bites. How will we protect ourselves West Nile Virus and the anopheles, which taxiway then onto a large grass field with rows and rows of aircraft similar when these even scarier mosquitoes ar- transmits malaria. to ours. We cross another road and get marshalled into a smaller lot. We are rive here? What can we do now to help The presence of West Nile Virus in parked in row 303 in the home built camping area. Engine off, we are here. the half of the world’s population contend North America in 1999 and the possibil- We have arrived at the world busiest airport without speaking to any with this menace? One day the biggest one by carefully following the instructions in a 32 page Notice to Airmen health scourge for us may not be cancer which is manditory for this approach. or heart disease, but the various horrors ROSE caused by this tiny little insect. to be continued compliments of Wainwright Roseto you Flower Cart AUGUST 9 & 10 1:00-7:00pm Friday Allan Samm For all your hard work at the St. Thomas 7:30am - 3pm Saturday Anglican Church food booth at the Wainwright Stampede. NO EARLY BIRDS! Shop local online @quintastics.ca Check out our Sales Flyer Household items, lawn If you know someone furntiture, picnic coolers, In Store Inventory Reduction Sale who deserves outdoor games, 2 electric recognition, 1621 - 10A Street Quintastic’s Office Supplies is now located at call The EDGE at: printers, some furniture 930 – 6th. Avenue (Beside H & R Block) 780-842-4465 Wainwright Many other things! Call: (780) 806 - 2233 – Fax: (780) 806 - 2288 an EDGE 4-pack
Card of Thanks Why Pay Rent? When You Can Buy!
We would like to thank everyone (each office independently owned and operated) from the bottom of our hearts who have helped us in any way with Reese’s Stalco Realty accident. It’s been so overwhelming with 215 - 10 St. Wainwright, AB thoughts and prayers, monetary dona- tions, and gifts to keep Reese busy as she 1825 2A St Cres 1833 2A St Cres 524-16 St 1218-7 Ave recovers. We are so lucky to have you in MLS 64774 MLS 63869 MLS 63002 MLS 64409 our lives. Although we didn’t need to stay Valerie * * * * up in Edmonton too long we were able to Moroz $334 $355 $379 $393 stay home from work to be with her as REALTOR® she starts her recovery. We will be making quite a few trips to the city to monitor her progress and see what her next steps will Cell: 780-842-0343 be. The support has been so very kind and [email protected] generous, we are so proud to be part of such great communities. 1209-2 Ave 2834-12 Ave. 901-8 St 1110-4 AVE VALERIE’S LISTINGS MLS 64001 MLS 63877 MLS 63602 MLS 64758 We cannot thank you enough. housesforsaleinwainwright.com $419* $432* $464* $468* Darcy, Terry, Reese, Hudson & Ryder Clark *BI-WEEKLY PAYMENTS BASED ON RATE OF 2.79% FOR 5 YEARS-PRINCIPAL INTEREST & CMHC FEES/O.A.C. Information supplied by Veronica Berry Mortgage specialist with BMO-780-708-0140 4 EDGE | Wainwright, AB | August 2, 2019
GO BACK TO SCHOOL IN STYLE FROM Beautiful day for a HEAD TO TOE
Show us your Project Ladybug Picnic ,_JLS*HYK :H]L VU your Back to School Attire. Submitted article Communities In Bloom =(30+(\N:LW[*Cardholder must be present at time of purchase ainwright Communities in Bloom held a WLadybug Picnic in Wallace Park on Sunday, July 28th. Despite the wind there were about 150 families that came out to enjoy the free hot dogs, water- melon, and cookies that our CiB volunteers pre- pared. There were games as well as a paint a pot station and face painting that were a huge hit. Ladybugs were available and we are thrilled with the amount of people that purchased them as an alternative to chemical pest control in our community. Each individual ladybug can live for up to a year and consume 5000 aphids, whiteflies, mites, and mealy bugs in that time. If anyone is interested in purchasing some (]L>HPU^YPNO[() www.marks.com of our remaining ladybug packs, please contact Lynn at 780-842-2812, the ladybugs come in a pack of 250 for $20 and can be refrigerated until Children of ready to use. all ages had a blast at the WE’VE GOT YOU Communities in Bloom Ladybug Picnic on Sun- COVERED! day, July 28. The children had plenty of games For all your event coverage and activities to contact The EDGE. keep busy, while local gardeners Ph: 780-842-4465 Fax: 780-842-2760 took advantage www.starnews.ca 1027-3 Ave. Wainwright of the lady- bugs for sale to help keep their gardens free of aphids and mites. Submitted photos
The fifth annual Bordering on Disaster Conference is happy to announce two of five speakers. This year's conference will feature presentations on municipal preparedness, mental health, economic recovery and much more.
#MiracleTreatDay On April 6, 2018 the City of Humboldt DAIRY QUEEN WAINWRIGHT [email protected] Net proceeds of each Blizzard Treat sold at this DQ location ZLOOEHQHƓWWKHORFDOFKLOGUHQōV quickly became the centre of worldwide Miracle Network member hospital STOLLERY CHILDRENS HOSPITAL attention through the focus of a traumatic event which took the lives of 16 individuals and affected countless others.
Joe Day will walk attendees through his personal accounts of that day, and the steps to recovery which the municipality continues to take. Get Your Paint Projects Done with Quality Paints In post-traumatic stress disorder Visit today and let our Paint (PTSD) you are not alone in how you & Stains Built to Last. feel. It is okay to not be okay. Professionals make sure you get the best paint and Join Sundahl as he walks attendees advice to get your project through his experiences of trauma done right. related mental illness and his use of therapeutic art.
Paint Like No Other®
Quality paints, stains & accessories ZZZPFUDHŴRRULQJFRP 112 - 10 St. Wainwright PH# 780-842-3939 EDGE | Wainwright, AB | August 2, 2019 5 Tips to enjoy a meatless meal
Submitted article ear Editor, the Town does at the Cemetery, they Alberta Health Services D are doing the same with the flowers. We are writing this letter to express The entire town is just beautiful our appreciation to the Town of Wain- and we should all be very proud to ooking for vegetarian or wright for stepping up to assist the call Wainwright home. Lvegan protein choices Communities in Bloom group this for your next meal? In- year. Thank you again to the Mayor, stead of meat, you can use John did the CIB watering for three Council and especially to the water- beans, lentils, tofu, eggs, years and he can tell you first hand ing team. nuts or seed butter to make that it was not an easy task. delicious, healthy dishes. The Town agreeing to take over the Meatless meals are excel- watering has really eased the burden John and Anne Kalczak lent for anyone, not just on CIB, and like the wonderful job Wainwright, Alberta people who avoid meat for religious or cultural rea- sons. DO YOUR PART FOR OUR PLANET and spices to make a fast and easy dip Six simple ways to update some or sandwich spread. popular recipes: Ô 8VH QXW VHHG RU VR\EHDQ EXWWHUV PLEASE RECYCLE YOUR EDGE BAGS Ô 5HSODFH WKH PHDW LQ FKLOL FDVVH Add them to dips, smoothies or spread roles, stews and soups with beans, len- them thinly on breads or crackers for a tils or tofu. Blessed snack or quick protein boost. THE MUNICIPAL Ô8VHOHQWLOVRUEODFNEHDQVLQWDFRV For recipes using meat alternatives Sacrament School or quesadillas. or to find out more, go to healthyeat- DISTRICT OF ,VFXUUHQWO\DFFHSWLQJUHJLVWUDWLRQVIRU Ô 7RS VDODGV ZLWK EHDQV RU D KDUG ingstartshere.ca. WAINWRIGHT NO. 61 boiled egg. To find out more about vegetarian Pre-School/Little Steps Ô$GGWRIXWRDYHJHWDEOHVWLUIU\ diets or alternatives to meats, ask your 2019-2020 school year. Ô 3XUHH FRRNHG EODFN EHDQV ZKLWH healthcare professional to be referred PUBLIC NOTICE Ř6PDUW%RDUGWHFKQRORJ\DYDLODEOHIRULQWHUDFWLYH beans or chickpeas. Then add herbs SAFETY CODES ACT OHVVRQLPSOHPHQWDWLRQ to a dietitian. Ř2XWGRRUSOD\JURXQGHTXLSPHQWFRGHGVSHFLIL- ACCREDITED AGENCY FDOO\IRU\HDUROGV CHANGE Ř:HRIIHU\HDUROGFODVVHVIRUHLWKHU0RQGD\RU :HGQHVGD\PRUQLQJ\HDUROGFODVVHV0RQ- PUBLIC NOTICE GD\:HGQHVGD\DIWHUQRRQV7XHV7KXUVPRUQ- NOTICE OF APPLICATION The Municipal District of Wainwright LQJVRU7XHV7KXUVDIWHUQRRQV No. 61 has recently changed service Ř/LWWOH6WHSVKDV*RYHUQPHQW6XEVLG\DYDLODEOHLI ALBERTA ENVIRONMENT AND PARKS TXDOLILFDWLRQVDUHPHW ENVIRONMENTAL PROTECTION AND ENHANCEMENT ACT providers and Inspections Group Inc. Read The 7KHFKLOGPXVWEHRU\HDUVRIDJHRQRUEHIRUH will now be the accredited agency. )HEUXDU\.LQGHUJDUWHQVFKRRO In accordance with the Environmental Protection and Enhancement Act, Alberta Wainwright \HDU7KHFKLOGPXVWEH\HDUVRIDJHRQRUEHIRUH Environment and Parks, Fish and Wildlife Policy Branch, has applied to Alberta Inspections Group Inc. will be respon- )HEUXDU\ Environment and Parks for a Special Use Approval to apply pesticides in or within 30 horizontal metres of open bodies of water near Viking, Bruce, Chauvin, and sible for issuing permits, completing Strathcona County. The purpose of the pesticide applications is for the eradication inspections and ensuring compliance Kindergarten of invasive Phragmites, a prohibited aquatic invasive species, at the following E-Edition in the building, electrical, gas, plumb- locations: online weekly at 2019-2020 school year. ing and private sewage disposal disci- 7KHFKLOGPXVWEH\HDUVRIDJHRQRUEHIRUH StarNews.ca - wetland site near Viking along CN rail line located on the Southeast Quarter of plines under the Safety Codes Act. )HEUXDU\ Section 07, Township 048, Range 13, West of the 4th Meridian (Location 1); and Both PreK and Ecs Programs include: And check us Ř+DQGZULWLQJ:LWKRXW7HDUVLQWURGXFWLRQWRSULQWLQJ - wetland site near Bruce along CN rail line located on the Northeast Quarter of out daily on You can contact them at: Ř0LQLJ\PWLPHIRUVWUXFWXUHGJDPHVDFWLYLWLHVDQG Section 35, Township 048, Range 15, West of the 4th Meridian (Location 2); and facebook Phone: 1-866-554-5048 JURVVPRWRUGHYHORSPHQW Ř38)VWXGHQWVHUYLFHVDYDLODEOHRQVLWHIRUVSHHFK -wetland site near Chauvin along CN rain line located on the Southwest Quarter of facebook.com/ Website: www.inspectionsgroup.com ODQJXDJHSDWKRORJ\RFFXSDWLRQDOWKHUDS\DQG Section 16, Township 043, Range 02, West of the 4th Meridian (Location 3); and Wainwright- SK\VLRWKHUDS\ If you have any questions or concerns - wetland site in Strathcona County along CP rail line located on the Southeast StarNews 5HJLVWUDWLRQSDFNDJHVDUHDYDLODEOHRQWKH Quarter of Section 06, Township 053, Range 23, West of the 4th Meridian please contact: VFKRROZHEVLWHRUDWWKH6FKRRO2IILFH (Location 4). Kim Christensen, Development Officer DW$YH:DLQZULJKW )RUPRUHLQIRUPDWLRQSOHDVHFDOO A directly affected person may provide input into certain regulatory decisions, MD of Wainwright | 780-842-4454 %OHVVHG6DFUDPHQW6FKRRO as allowed by the Environmental Protection and Enhancement Act (section 73). RUYLVLWRXUZHEVLWHZZZEVVHFDFVDEFD Specifically, any person who is directly affected by this application may submit a written statement of concern within 30 days of the date of this notice to:
Regulatory Approvals Center 5th Floor, South Petroleum Plaza 9915 - 108 Street Edmonton, AB T5K 2G8 Fax: (780) 422-0154 % $# E-mail: [email protected] % " The written statement of concern should include the following: X19074DT1 % - the application number 001-438732 OPEN HOUSE % MUNICIPAL DISTRICT OF WAINWRIGHT - describe concerns that are relevant to matters regulated by the Environmental NO. 61 & INSPECTIONS GROUP INC. % $ LANDSCAPING Protection and Enhancement Act # LTD. - explain how the filer of the concern will be directly affected by the activities Inspections Group in partnership with the % #% proposed in the application MD of Wainwright No. 61 is hosting a pre- Dean sentation and open panel discussion on new % % - provide the legal land location of the land owned or used by the filer where the Christensen concerns described are believed to be applicable Building and Electrical code changes in 2019. The presentation will highlight key changes - state the distance between the land owned or used by the filer and the site in the 780-806-0188 application to the codes and answer any questions you may have. There will also be a general panel email: [email protected] - contact information including the full name and mailing address of the filer. Please discussion which will provide an opportunity an EDGE 4-pack provide a telephone number and/or email address for ease of contact. to ask questions of inspectors in all disci- Environment and Parks will review each written statement of concern, seek more plines any questions you may have regarding information if needed, and notify each filer by letter of the decision to accept or Building, Electrical, Plumbing, Gas, Private reject their written submission as a valid statement of concern. The Public Notice Clear Lake RIWKLVDSSOLFDWLRQZLOODOVREHSRVWHGRQWKH'HSDUWPHQW·VZHEVLWHDWKWWSVDYZ Sewage or Fire Codes. We highly recom- alberta.ca/PublicNoticesViewer.aspx. mend this to contractors and anyone who is 5 Acre Parcels exploring a construction project; as getting Statements of concern submitted regarding this application are public records which are accessible by the public and the applicant. Failure to file a statement of concern good advice early in the planning phase of may affect the right to file a Notice of Appeal with the Environmental Appeals Board. your project can greatly assist in smoothly 3 available with view of Clear Lake, East side interacting with the safety codes system. Starting @ $130,000 Copies of the application and additional information can be We look forward to seeing you at the MD obtained from: 7..0 '1#" 7,"'4'"3 *2'2*#1 Alberta Environment and Parks of Wainwright Office (717-14th Avenue, Attention: Nicole Kimmel Wainwright, AB) on Monday, August 12th, 70'4 2#"0'4#5 615'2&+ ',2 ',#" !!#110- " 24th Floor, Commerce Place 7!!#112- !0#1. 1230#%0##,1. !#,#%-2' *# 10155 102 ST NW EDMONTON, AB T5J 4G8 2019 from 4:00 – 7:00 pm Telephone: 780-975-3793 7# 1-, *#-$$#01!-,1'"#0#" E-mail: [email protected] If you have any questions please contact: 7'#5.'!230#1-,'('('" Kim Christensen, Development Officer MD of Wainwright | 780-842-4454 FOR SALE -04'#5',%-0',/3'0'#1! ** an EDGE 4-pack 6 EDGE | Wainwright, AB | August 2, 2019 PROVOST HAYTER CZAR
Mr Lin Family Restaurant in the oil patch Fireside Grill METISKOW AMISK with over 9,000 weekly followers...
Left or Right? From Hardisty to Amisk NEILBURG HARDISTY gets your advertising message to the Marketplace.
The Road less travelled The EDGE is delivered to these Rent a a potty PARADISE VALLEY communities every week. HUGHENDEN
Mannville Vermilion
Addition to house Bethany Lutheran Church
CADOGAN Paradise KINSELLA Kinsella Valley
Irma
Marsden Wainwright Neilburg
Denwood Edgerton Hardisty Chauvin Amisk
Fixing a fence Kinsella Village Street Hughenden MARSDEN Czar IRMA Hayter Metiskow Provost Cadogan
We can develop an effective Manitou Lake Regional Park Campground advertising campaign for you! EDGE boxes now moved closer to the main door CHAUVIN MANNVILLE Call or email today.
Sherry 780-842-4465 ext 112. [email protected]
Patrick 780-842-4465 ext 110 [email protected] Goodale Motors on Main Street Creighton School Site EDGERTON WAINWRIGHT VERMILION
Classes resume Sept. 3 Gazebo at Wallace Park at Sunset Vermilion Fair Midway EDGE | Wainwright, AB | August 2, 2019 7 OPINIONS
Zak McLachlan Roger Holmes Aaron Holmes Editor
Pet rescue Pedestrian Maersk
or many people, the first place they look when s a noun a pedestrian is a person walking on or aersk, a major worldwide shipping company searching for a new pet is websites like Kijiji or F Aby a road. As an adjective pedestrian means lack- has plans to be carbon neutral by 2050. Auda- the Facebook Marketplace. It seems like a quick and M ing inspiration or excitement, dull. cious? Maybe. For a company in an industry that convenient way to browse the market of puppies In Wainwright pedestrians normally have the uses some pretty dirty fuel to be on their way to car- around your area to find just the right one for you right of way over vehicles. Vehicles have to stop for a bon neutral takes some serious leadership. and your family. pedestrian in a cross walk. That seems normal and is It would be significantly easier to continue with But unfortunately sometimes those Kijiji puppy well respected by the motoring public. business as usual, but there are some advantages to sellers aren’t the pet-loving animal enthusiasts they Jaywalking is a term for crossing the street in an their approach. appear to be. unmarked area. It gets its designation from a time They also plan to do it while still making money. This past weekend, a 52-year-old woman north- when “Jay” was a slang term for a dull or stupid per- That is important, because a company that’s out of east of Edmonton was arrested and charged for son. Thus walking across the road in an unmarked business is pretty carbon neutral already. numerous offences after police discovered 72 dogs at location was considered not too bright. However it is We’re unlikely to give up the international ship- the alleged puppy mill at her home. not against the law in Wainwright to be a Jaywalker. ping we’ve become accustomed to, so making it These animals were found stuffed into small cages It gets a bit more complicated with traffic lights. Ac- carbon neutral allows it to retain a place in our low- and locked in closets in the home, which police cording to the town by-law enforcement officer Jeff carbon future. described as having puppies in every square inch Graham, we do have a by-law against crossing a high- Being carbon neutral will also appeal to the com- of the house. Police found this atrocity thanks to way (all streets and alleys are considered highways) panies worldwide who recognize that being associ- complaints from a handful of prospective puppy pur- where there is a sign against crossing it. In Wain- ated with a lower emissions carrier is good for their chasers who became suspicious about the welfare of wright you will find those signs at the traffic lights image. the puppies after showing up and finding their dog on Main Street and 5th Ave. and again at the Main Maersk is already well on their way. They’re oper- of choice looking much more unhealthy than the Street crossing of Highway 14 as well as the Highway ating as if the change to the low carbon economy is photo online indicated. 14 lights at 27th street near the Tim Hortons. At those inevitable and they need to keep up with the chang- Thankfully this woman is facing numerous charg- locations pedestrians need to push a button to get rid ing times. The scenario with the low carbon future is es and will likely be banned from ever owning an of the red hand sign and get the white walker indica- the one that allows continued industrial scale ship- animal again. But you can just imagine how many tor. ping, so it’s in their interest to keep it going. other puppy mills are out there keeping animals in What is most frustrating is the timing set up on the Their bet on a low-carbon future is a way of bet- similar conditions. walk lights at the Main and 5th intersection. All four ting on the future of civilization, and is likely to be It is appalling that anybody would do this to a directions seem to respond differently to the amount good for business. It’s good for all of us, what with poor little puppy, but there are steps the rest of us can of time it takes when the button is pushed and how civilization surviving this crisis, if their bet pays off. take to help put a stop to these situations. long you wait to cross the street. This leads to frus- There are lots of hard problems to solve as we Firstly, if you visit a place like the one described tration and a good many of us are guilty of walking move to a low-carbon economy. Like landing on above and have suspicions about the welfare of the against that sign due to the lack of any obvious logic the moon, it’ll take dedicated people to solve each animals, you should absolutely phone the police. in its operation. Walking against that sign is subject to individual problem if we’re going to make it. On the Secondly, don’t entertain the online sales pitches a $50 ticket for a by-law infraction. plus side, the companies that take the lead have the of these puppy mills. There are pet rescue centres Something needs to be done to make that intersec- best chance to profit as the conventional industries all over the province with people who passionately tion more pedestrian friendly. Just keep it simple and are disrupted. care for and raise pets who have been mistreated predictable. and abused, and those are the people who should be If something is not done more of us will choose the sought out when you’re looking for a new cute little less safe but legal Jaywalking solution out of frustra- member of the family. If you’re looking for a pet, do tion. the right thing and adopt a rescue.
Circulation 4,590 Published by 1027 - 3 Ave., Wainwright, AB T9W 1T6 Ph: 780-842-4465 Fax: 780-842-2760 website: www.starnews.ca Just Looking Around 2008 WINNER 2009 WINNER Roger Holmes Patrick Moroz Sherry Schatz Zak McLachlan Publisher Associate Publisher Sales & Promotion Editor Lots of reports this week of hail in Lots of black dirt getting leveled in [email protected] & Sales Manager [email protected] [email protected] the area Tuesday night. None actu- DW:+6IRRWEDOOêHOG7KH\ZLOOEH [email protected] ally in Wainwright but reports of laying new sod soon. This will be a Gale Aykroyd Barb Tywoniuk Carrie Phyllis Holmes large hail stones to the east almost $40,000 worth of grass. Financial Accts & Graphics Baumgartner Projects **** **** Administrator [email protected] Graphic Design [email protected] Strong winds seem to have pulled Major news sidewalk getting [email protected] [email protected] some of the siding of the Wain- poured on 1st Ave. going out to- The EDGE has 9,180 followers in print, i.e. 4,590 published with an average of two readers per printed copy. wright Clinic building on 5th Ave. wards the Stampede grounds. **** **** LETTERS POLICY: Sidewalks downtown seem to have The sign says “Intersection photo The Wainwright EDGE welcomes letters to the editor for publication. Letters must be signed and a phone We've got you covered! a lot of sand on them from the high enforced”. How do you photo en- number included so the writer’s identity can be verified. winds. force an intersection? The Wainwright EDGE reserves the right to edit letters **** **** for legal considerations, taste, and brevity. Kids playing in the park beside the Wainwright Dental Care at the Please mail, e-mail, or drop off Library. Looks like a summer fun south end of Main Steer looks like it your comments to: Letter to the Editor program. has a nice new brown awning sign. 1027-3 Ave, Wainwright, AB T9W 1T6 **** **** Phone: (780) 842-4465 Fax: (780) 842-2760 Rotary Club getting set up for their The Wainwright Golf Course is look- E-mail: [email protected] big “hole in one” golf tournament ing very green after all the rain. The letters appearing in today’s paper have been edited on Friday August 9th. Proceeds will **** for length and other considerations. Please try to keep your letters under 300 words to ensure your Letter to go to the CT Scanner project. Lots of interest in the Folk Music the Editor appears as close to its original form as pos- Read The Wainwright EDGE E-Edition online weekly **** Festival coming up later in August. sible. Thank you to everyone who took the time to send at StarNews.ca And check us out daily on facebook us comments on the important issues of the day in our facebook.com/WainwrightStarNews July is over already. Come by the hills they say. community. Keep your input coming.
FOR ALL YOUR ADVERTISING OPTIONS OR EVENT COVERAGE JVU[HJ[[OL,+.,'7O! -H_! ,THPS!PUMV'Z[HYUL^ZJH^^^Z[HYUL^ZJH (]L>HPU^YPNO[/V\YZ!4VUKH`;O\YZKH` !HT!-YPKH` !HT5VVU 8 EDGE | Wainwright, AB | August 2, 2019 Happening? Family Recipes CALL Zak @ Served with l ve (780) 842-4465
By Phyllis Holmes PUBLIC NOTICE M.D. OF PROVOST NO. 52 [email protected] TAKE NOTICE THAT A DEVELOPMENT PERMIT HAS My quest to make the perfect saskatoon pie is ongo- BEEN APPROVED AS FOLLOWS: ing. My results are often more “humble pie” than PERMIT NO. 1809 “easy as pie”. I love saskatoons, the hardy little berries APPLICANT: Tanner Sather that link me back to my foraging ancestors. There is LOCATION: S.E. 9-41-07-W4M something very satisfying about picking the saska- House toons myself. And pie made from the saskatoons is my APPROVAL SHALL COME INTO EFFECT WITHIN 15 favourite. DAYS OF THIS NOTICE. ANY APPEAL TO THE ABOVE Once I came close to making the perfect saskatoon SASKATOON PIE SHALL BE MADE WITHIN 14 DAYS TO THIS OFFICE IN pie. It was golden and crispy and impressive. It was Ingredients: WRITING. DOVRDëXNH,ZDVZLWKRXWDQRYHQZLWKRXWDSLH 4 cups saskatoons DATED: July 23rd, 2019 2 tablespoons pan, without my usual lard; so I improvised. I used Bob Hawriliuk the barbecue. I used an 8-inch cast iron frying pan. cornstarch Assistant Development Officer I used butter. The barbecue’s temperature somehow ¼ cup water inched close to 500 degrees. I thought the pie might be 2/3-cup sugar UXLQHG%XWWKHSDVWU\ZDVJROGHQëDN\HYHQRQWKH 1 ½ tablespoons lemon juice bottom. I haven’t been able to replicate that since. 1-2 tablespoons butter PUBLIC NOTICE Preheat oven to 450 degrees M.D. OF PROVOST NO. 52 I have generally found lard easier to manage than butter and like the recipe that comes on the Tender- 1. Line a 9 inch pie plate with pastry TAKE NOTICE THAT A DEVELOPMENT PERMIT HAS BEEN APPROVED AS FOLLOWS: ëDNHSDFNDJH 2. Mix cornstarch with water until smooth and then blend with 2/3-cup My “Art and Soul of Baking” manual advises: sugar. Blend this into the saskatoons and then let this mixture stand for 15 PERMIT NO. 1808 APPLICANT: Metiskow Recreation Board “Rule Number One: Don’t panic!!! The more anxious minutes before putting it into the pie shell. you become, the less fun you have. Besides, the dough 3. Sprinkle the saskatoons with the lemon juice and dot with butter. LOCATION: Block 6, Plan 3069 B.U. Metiskow Basketball Court can smell fear (or at least it seems that way). 4. Cover the pie with the top crust. APPROVAL SHALL COME INTO EFFECT WITHIN 15 Rule Number Two: Get ready to bake. Read the recipe 5. Bake at 450 degrees for 10-15 minutes and then reduce the heat to 350 DAYS OF THIS NOTICE. ANY APPEAL TO THE ABOVE before you begin and measure out your ingredients. degrees and bake for another 40-45 minutes. SHALL BE MADE WITHIN 14 DAYS TO THIS OFFICE IN And remember, it’s food, not world peace. Even less- WRITING. than-perfect pies are still delicious, especially served (If the pastry is getting too brown on the edges, cover the edges with tin foil DATED: July 23rd, 2019 strips or by cutting a circle out of a square of tin foil.) warm with plenty of ice cream.” Bob Hawriliuk Assistant Development Officer
ON NOW UNTIL SEPTEMBER 30 ,2019 Our $10,000.00 OFF Hottest Deal THE PURCHASE OF YOUR CUSTOM ORDERED HOME! *
Also be entered for your chance to win a FREE Yet! flight of up to $2000.00 Draw date will be December 20, 2019** WHY NOT Tu r n y o u r DREAMS into a REALITY and get your new home started today!
Contact us now for more info!
780-875-9260 HWY 16 West of Lloydminster, RR 14. www.newhomesforyou.ca Visit us on Facebook: Homes To Go Lloydminster Custom RTM Builder Proudly Serving Saskatchewan and Alberta Some Conditions apply talk to our Sales team today! *Contract must be signed between July 17th,2019and September 30th ,2019 for the $10,000.00 off custom ordered homes! **Purchase a show home or a customer ordered home to be entered to win the free flights EDGE | Wainwright, AB | August 2, 2019 9
Sergeant Wes Bensmiller Constable Matthew Leblanc Corporal Norm Weber Constable Chris Bilodeau Constable Ben Dixon Constable Greg Bamber Constable Michael Hamilton Constable Charles Lambright Constable Karanvir Nanuan Constable Lisa Marrower POLICEBEAT “The Police Beat” is a joint effort be- known male drinking beer in a ve- started while suspects were attempt- cate the vehicle. tween Star News and the Wainwright hicle in the area of 3rd Avenue and ing to steal the cable. 5:40 p.m. – Complaint of a break and RCMP and is put together by a repre- » 5th Street. Members made patrols, 10:40 p.m. – Complaint of a suspi- enter and a theft at a rural property sentative of both organizations. » but they could not locate the vehicle. cious vehicle northeast of Wain- north of Irma. Various items were July 15-21 wright. Complainant advised a vehi- taken. No suspects at this time. July 16 cle parked near his residence quickly Zak McLachlan with files from » 1:00 p.m. – Request to assist EMS » 8:35 p.m. – Members on routine Sgt. Wes Bensmiller drove away when he approached it. patrol on Highway 14 west of Wain- with a suicidal male. Members at- No suspects at this time. tended, but EMS did not require po- wright performed a traffic stop on a vehicle for speeding. Driver was is- There were 68 complaints/incidents, six lice assistance by the time members July 18 deer-related incidents, eleven ‘not a police sued a $167 violation ticket. arrived. » 6:10 a.m. – Complaint of a possible matters’, no false 911 calls, three cases » 2:10 p.m. – Complainant attended breach of a no contact order. Investi- » 8:50 p.m. – Members on routine of failure to appear and two false alarms Detachment to advise he believed gation determined the no contact or- patrol on Highway 14 west of Wain- were reported during the week. his license plate had been stolen in der was no longer in place. No charg- wright performed a traffic stop on a Wainwright and was being used in es considered. vehicle for speeding. Driver was is- sued a $120 violation ticket. Edmonton, as he had received a by- » 7:30 a.m. – Complaint of a theft of July 15 law ticket related to the plate which cable from a lease site northeast of » 11:10 p.m. – Complaint of a distur- » 2:50 a.m. – Complaint of an attempt- had been missing. No suspects at this Wainwright. No suspects at this time. bance in the area of 6th Street and ed break and enter to a business in time. 6th Avenue. Members attended and Edgerton. Complainant advised sus- » 7:35 p.m. – Complaint of a theft of mediated the situation. No further » 6:15 p.m. – 911 hangup from the tailgate from a vehicle while parked pects attempted to gain access by Battle River Lodge. Members deter- complaints. breaking windows on the building, in the area of 15th Street and 15th Av- mined it was a mis-dial. No emer- enue. No suspects at this time. but they were scared off when the gency. July 20 alarm sounded. No suspects at this » 11:30 a.m. – Complaint of a theft of » 3:30 p.m. – Complaint of a theft of time. » 7:10 p.m. – Complaint of a vehicle cable from a lease site northeast of wire from a lease site northeast of speeding through a construction » 8:30 a.m. – Complaint of a suspicious Wainwright. Individuals attempted Wainwright. No suspects at this time. zone on Highway 14 west of Wain- to steal cable, but left it on the site vehicles backed up into the brush on wright. No suspects at this time. » 4:10 p.m. – Complaint of a possible a rural east of Wainwright. Members once they determined it was alumi- breach of a no contact order. Investi- made patrols in the area and located » 11:45 p.m. – Complaint of a suspi- num and not copper. No suspects at gation determined the no contact or- the vehicle, which was determined cious female in the area of 11th Street this time. der was no longer in place. No charg- to be stolen out of Amisk. No suspects and 8th Avenue. Complainant ad- » 12:00 p.m. – Complaint of an at- es considered. at this time. Vehicle was returned to vised the female was laying on some tempted theft of truck from a rural steps outside an open door. Members » 4:45 p.m. – Complaint of vehicles the registered owner. residence north of Irma. The ignition speeding on Airport Road. Continued attended and determined there was was damaged, but the vehicle was » 9:30 a.m. – Complaint of a theft. no need for police. patrols being made by members in Complainant advised a battery kit not stolen. No suspects at this time. the area. was stolen from their business and July 17 » 12:30 p.m. – Members on routine was found online listed for sale. Sus- » 9:00 a.m. – Complaint of a theft from patrol in Wainwright performed a July 21 pect has been identified. Matter is an oilfield site north of Wainwright. traffic stop on a vehicle for driving » 12:50 a.m. – Complaint of a domes- still under investigation. Suspects gained access by cutting a while distracted. Driver was issued a tic assault at a residence in Wain- » 9:35 a.m. – Complaint of an aban- fence and stole a generator, power $287 violation ticket. wright. Members determined a male doned vehicle on Highway 14 west converter and a helmet. No suspects » 3:30 p.m. – Complaint of a suspi- had assaulted his partner. Male was of Fabyan. Members made patrols at this time. cious female on Highway 14 east of later located, arrested, charged and and determined the vehicle was not Wainwright. Members made patrols, released on court compelling docu- » 4:20 p.m. – Complaint of shoplifting ments. stolen, but instead it was broken from a business in Wainwright. Com- but they could not locate the indi- down. Registered owner advised plainant advised a suspect entered vidual. » 10:00 a.m. – Complaint of a break the vehicle was going to be towed, the business and stole a pair of boots. and enter to a shop north of Wain- but sometime overnight unknown Suspect was identified, located and July 19 wright. Various items were stolen. suspects stole the vehicle’s battery arrested and later released on court » 2:30 a.m. – Request to assist EMS No suspects at this time. and license plate. No suspects at this compelling documents. with an aggressive patient. Members » 1:18 p.m. – Complaint of an erratic time. License plate has been added to made patrols. Upon police arrival, driver on Highway 14 east of Wain- police database as stolen. » 5:30 p.m. – Complaint of vehicle EMS advised they did not need assis- wright. Complainant advised the speeding north of Wainwright. Sus- tance. » 1:10 p.m. – Complaint of a fraud. pects were identified and a warning vehicle was speeding, crossing the Complainant advised of fraudulent was given to the drivers about their » 5:00 a.m. – Request to assist EMS centre line and passing unsafely. transactions in their bank account. actions. with a suicidal male. Members made Members made patrols, but they No suspects. Still under investiga- patrols and assisted EMS. Male was could not locate the vehicle. No fur- tion. » 7:50 p.m. – Complaint of excessive transported to hospital for further as- ther complaints received. noise in the area of 6th Avenue and sessment. » 1:40 p.m. – Request to assist Wain- 6th Street. Members made patrols » 3:30 p.m. – Complaint of a theft of a wright Health Centre with a violent and advised subjects of complaint to » 8:30 a.m. – Complaint of a theft of license plate off a vehicle northeast patient. Members assisted hospital keep the noise to a minimum. a vehicle from a business in Wain- of Irma. No suspects at this time. Li- staff, and the patient was later trans- wright. Vehicle was later recovered cense plate added to police database ported by EMS to a mental health fa- » 8:30 p.m. – Complaint of suspi- abandoned on Highway 14 east of as stolen. cility for assessment. cious activity on Highway 14 west of Wainwright. No suspects at this time. Wainwright. Complainant advised a » 2:30 p.m. – Request for a wellbeing suspicious vehicle with two females » 10:00 a.m. – Complaint of fraudu- check on a female in Wainwright. inside seemed suspicious. Members lent cheques which were attempt- Members made patrols and located later determined the individuals ing to be deposited from a business the female safe and sound. were in the area geocaching. Noth- in Wainwright. Matter is still under » 5:30 p.m. – Report of a two-vehicle ing suspicious. investigation. WAINWRIGHT PHOTO collision in the area of 21st Street and » 10:00 p.m. – Complaint of damage to » 5:20 p.m. – Complaint of an erratic 10th Avenue. Complainant advised a lease site northeast of Wainwright. driver on Highway 14 east of Wain- TRAFFIC ENFORCEMENT they were rear ended while backing Complainant advised unknown sus- wright. Complainant advised a truck out of the driveway. No injuries. Col- pects appeared to be attempting to pulling a trailer was driving errati- LOCATIONS FOR NEXT WEEK: lision report completed. steal cable from the site and caused cally and passing unsafely. Members AUGUST made patrols, but they could not lo- 3 - 18 ST @/NEAR 11 AVE » 7:45 p.m. – Complaint of an un- damage to property. A small fire was 4 - 5 AVE @/NEAR 1ST 5 - 8 AVE @ 14 ST 6 - 6 AVE @/NEAR 8 ST 7 - 10A ST @/NEAR 13 AVE 8 - 10 ST @ HWY 14 DO YOUR PART FOR OUR PLANET 9 - 27 ST @/NEAR 10 AVE
PLEASE RECYCLE YOUR EDGE BAGS Additional locations may be photo enforced on the above dates. Photo enforcement may not operate on all dates listed above. star news inc. 1027 3rd ave. Tel: (780) 842 -4465 FAX: (780) 842 -2760 For more information call 780-842-1691 10 EDGE | Wainwright, AB | August 2, 2019
Forty Creek Barrel Wisers Deluxe Tito’s Vodka Provincial Vodka Sky Vodka 95 Select 95 1.14L 95 1.75L 95 1.14L 95 750ml $21 750ml $31 $49 $27 $18
Bacardi White Bacardi 8yr Appleton Signature Captain Morgan Carolans Irish Bom Bom 95 Rum 95 750ml 95 V/X 95 Spiced Rum 95 Cream 95 Nilli Vanilla $19 750ml $27 $33 1.14L $46 1.75L $26 1.14L $24 750ml
Cabernet Sauvignon Smooth Red Sauvignon Merlot Blanc Smooth White Pinot Grigio Chardonnay Sweet Shiraz Cabernet Moscato Malbec Sauv Blanc Red Blend Sweet White Sauvignon Rose Santa Julia Villa Maria Columbia Winery Jam Jar Kunde Bodacious 95 Argentina 95 New Zealand 95 US 95 South Africa 95 US 50 Canada $9 750ml $9 750ml $12 750ml $9 750ml $17 750ml $7 750ml
Sleeman Clear 2.0 95 Canadian or 95 Coors Banquet 95 15pk cans $21 Coors light $69 24 pk cans $37 FREE GOLF GEAR IN CASE 48 pk cans WORKS OUT TO $34.98/24PK
FREE FREE BAG OF BAG OF ICE ICE Alexander Keiths 95 India Pale Ale $27 15 cans Obolon 95 Lager, Premium $29 20 x 500ml Btls works out to 29 x 341ml btls Bud or Bud Light 95 or Kokanee $69 Moosehead 95 48 pk cans 15 pk cans $22 WORKS OUT TO $34.98/24PK BONUS COOLER BAG
Alberta 95 Genuine Draft $17 15 pk cans
Bonus American 95 TShirt Vintage Hard Iced $18 Tea, Variety Pack 12pk cans
Pabst Bue 95 Nutrl 7% 95 Ribbon $18 Blk Cherry, Blk $8 15 pk cans Raspberry, Blk Berry 6 pk cans
W5 Hard Tea 95 Traditional, Baja $14 NEW Cinnamon 6pk btls Nude 95 Peach, Strawberry $10 Kiwi 6pk cans
NEW GROWLER BAR WEEKLY FEATURE Titanium Caesar 95 Okanagan Springs Twisted Tea 95 Mixer Pack Original, Dill Pickle, $10 SAVE $19 Switchback Summer Ale 12pk cans Spicy 1.75L $2.00 95 2L $12 BONUS GLASS
elebrating C th
1994 - 2019 - ANNIVERSARY SALE ENDS AUGUST 8TH PLUS MANY MORE IN-STORE SPECIALS Ř6WUHHW:DLQZULJKW VISIT US ON WAINWRIGHT CHAMBER OF COMMERCE HOURS: “Your Community Minded Liquor Store” Locally Owned & Operated BUSINESS OF THE YEAR 2010 MON. - SAT. 10:00 am - 10:00 pm Please don’t drink and drive /wainwrightliquor by Jay & Sandra Robinson 2007 Alberta Retailer of The Year SUN. 11:00 am - 7:00 pm EDGE | Wainwright, AB | August 2, 2019 11
RESERVE SEAT August 14-18, 2019 YOUR NOW! Lloydminster
RACE SCHEDULE: CHUCKWAGON CABARET WEDNESDAY - SATURDAY AUGUST 17th 9:00PM 5PM: Beer Gardens/Gates 6PM: Pre Show - Races to follow SUNDAY: 12:30PM: Beer Gardens/Gates 1:30PM: Pre-Show - Races to follow
TICKETS TO THE RACES: 5 Day Reserve: $95 1 Day Rush: $20 Children 12 & under FREE With special guest The Dirt Rich Band!
BEER GARDENS TICKETS: $45 - ADVANCE ENTERTAINMENT: $55 - AT THE DOOR (pending availability) The Dirt Rich Band | Garrett Gregory &5/71@?-B-58-.81-@!ő/1;> | Kendra Kay Lammles Western Wear Lloydminster
LLOYDEXH.COM/CPCAFINALS 306-825-5571 | 5521-49 Ave. Lloyd. SK S9V 0Y7 12 EDGE | Wainwright, AB | August 2, 2019
THE EDGESPORTS
The Irma Golf Course has been a busy place the past few weeks. Irma Golf The local nine-hole course hosted its Seniors’ Tournament on Monday, July 15. The seniors enjoyed a great day on the golf course with a bountiful meal to keep them going throughout the day. Course hosts On the men’s side, the Seniors’ Tour- nament winners were Charlie Shin, Lee Cooper and Charlie Soucy. For the women, the winners were Correen Lar- Seniors’ son, Donna Hollar and Marlus Larson. The Irma Golf Course also recently hosted its Ladies’ Club Championship Tournament, on a hot Tuesday evening on July 23. Fourteen golfers competed for the club championship, and Lois Larson came out on top to win the title on her birthday. Ladies Club Pictured left, Kelly Short presented the Club Championship trophy to Larson following the tournament.
The Men’s Club Championship was post- Championship poned due to inclement weather. No alternate date has yet been set.
Submitted photo Chauvin’s Kris Molle making a charge up CPCA driver standings
Kris Molle is making a push up the CPCA driver standings after a strong showing in Little Pine, Saskatchewan two weekends ago. Molle finished third in the aggregate after being top five in the fast times each day of the event. Unfortunately inclement weather restricted the Poundmaker, Saskatchewan event to just one day of races, but Molle came away with the win in his heat and the fifth fastest time of the day. Molle now sits sixth in the driver standings behind Jamie Laboucane (5), Dale Mitsuing (4), Ray Mitsuing (3), Brad McMann (2) and Todd Baptiste at the top of the leaderboard. Photo: Zak McLachlan ATHLETE of the week Proudly Sponsored by Communities in Bloom ladies The Wainwright EDGE is pleased to announce the Com- munities in Bloom ladies as this week’s Athletes of the Week. MOTORS The ladies of Communities in Bloom put in many, many 2110 - 15 Ave. Wainwright, AB T9W 1L2 hours of work throughout the summer every year to make Wainwright look lovely with the many flower beds and 780-842-4471 planters. TOLL FREE 1-888-842-4471 Great job, ladies! www.wainalta.com EDGE | Wainwright, AB | August 2, 2019 13 Wainwright Public Library, Wainwright Museum team up for Train Day
The Wainwright Public Library hosted Train Day on Wednesday, July 31, in partnership with the Wainwright Museum. The children who took part in the day’s events had Photos: Zak McLachlan the opportunity to learn all about trains, and they even got to build their own paper train as pictured above. Train Day is just one of the many events and summer programs hosted by the local library throughout the summer months. To learn all about what the library has to offer, stop by the Wainwright Public Library or visit their Facebook page. Donations continue to roll in for CT scanner community
Portage La Prairie Mutual Insurance recently made a donation of $5,000 towards the Submitted photo fundraiser project CT scanner community fundraiser project. From left to right, the donation was presented to Arthur Schwentner of the Rotary Club by Stalco Insurance owners Adam Doyle and Randy Stafford as well as Stalco employee Brady Berg. Wainwright falls behind in Walk ‘n’ Roll Challenge
For the first time in a long time Wainwright is trailing Ponoka and Stettler in the Walk ‘n’ Roll Challenge.
Wainwright held the lead for many weeks throughout the summer, but the two other towns recently surpassed Wainwright in the number of trips logged for the annual summer challenge.
Residents are encouraged to park the vehicle and make trips to work, shopping or other activities by way of physical activity like walking, biking or rollerblad- ing. Residents in Wainwright and area can register on the Town of Wainwright website or smartphone app to log their trips and help contribute to Wain- wright’s total. The Walk ‘n’ Roll Challenge runs through the end of August.
Are you tired of having to drive hours to your IMPORT import vehicle’s dealership? SPECIALISTS At Vic’s Service, we offer local, warranty approved, service and repair on all imported makes and models. Not only can we service your imported car, we can access, track, and manage all of your vehicle’s maintenance inter- vals and send you reminders on when these warranty required services are due. To Find out more stop by, give us a call or check out our Facebook Page!
We offer a 10 yr 400,000km power train warranty for vehicles serviced, free of charge Stop by, give us a call or check 2YEAR to clients with vehicles under 4 yrs of age and under 60,000km of mileage, we also (780) 842-4172 40,000KM offer a 2 yr, 40,000km warranty on parts and labor. out our Facebook Page! Email: [email protected] Warranty Complimentary Vehicle pick-up provided 14 EDGE | Wainwright, AB | August 2, 2019 New Super Lucky’s Tale
Rod Oracheski every facet of the game, from the art Game Guru and music to the controls. NHL 20 Let’s recap to keep this straight. We Open Beta got Lucky’s Tale in VR on the Oculus never played the original VR ver- Rift in 2016. Then a year later we got Live I sion of Lucky’s Tale which released Super Lucky’s Tale, a non-VR sequel on exclusively on Oculus Rift, but found PC and Xbox One. Now this November The Beta will show- Super Lucky’s Tale – the non-VR there’s New Super Lucky’s Tale is a case a host of new fea- sequel that hit PC and Xbox One – reimagining of the first game, but non- tures coming to NHL 20 a fun little distraction. Super bright VR and exclusive to the Switch… this year, highlighted by environments and characters had my I bet the next version is a kart racer. the brand-new Elimi- The EA Sports NHL 20 Beta showcased plenty Xbox One X kids entranced, even if the controls All that aside, it looks like New nator mode, a winner- of new features for this year’s edition of the screenshot weren’t quite refined enough to make Super Lucky’s Tale will be a great fit popular hockey game. The full game will become me fall in love with it the same for the Switch, with simple but bright take-all competition that available on September 13. pits 81 players against New Super Lucky’s Tale release will graphics and gameplay that’s easy each other in a surviv- make this probably the most convo- enough to take in bite-sized sections al tournament bracket. nents to be crowned the ultimate win- luted IP on the market, as it’s releas- or stretch into a couple hours of play. Playable in either NHL ONES or NHL ner. Think Battle Royale on ice. ing exclusively – at least at launch I’m really interested in seeing how THREES, players will attempt to win World of CHEL will also be featured – for the Nintendo Switch and is a the revamped controls fare, because four back-to-back elimination rounds in the Beta, as players can unlock pond top-down reimagining of the original that was really the only reason I against increasingly competitive oppo- hockey inspired pieces of gear for their game, with all new levels and cine- wasn’t completely in love with the character, giving users a jump start matics, and with upgrades to nearly Xbox One release. towards express- ing their person- See us on ality within the Irma Golf Club game. NHL 20 Irma boasts a beautiful 9 hole course Online Versus with grass greens and several RV sites. You will be impressed! play will be avail- Call the able with all 31 Ř0RQGD\0RUQLQJ*ROIDP Clubhouse NHL teams made 780-754-2184 available, provid- 5HJLVWUDWLRQ 2SHQWR$OO6WD\IRU/XQFK Check our website Ř/DGLHV1LJKWV7XHVGD\V7HHRIISP www.irmagolfcourse.com ing the first look Ř0HQV1LJKWV7KXUVGD\V*DPHVIRUKLJKORZ to register for tournaments at Superstar Sig- or book a Tee Time KDQGLFDSV6WHDN6XSSHU nature Shots and Ř0LG:HHN6SHFLDO7XHV Ř)DPLO\)ULGD\6FUDPEOH$XJ 6HSW$OOOHYHOV other innovations :HG7KXUVDPSP DJHVRIJROIHUVZHOFRPH,QFOXGHVVXSSHU SUL]HV Ř0L[HG&DVK6FUDPEOH$XJRegistration in RPM Technol- JROIIRUWKHSULFHRI #DP6KRWJXQVWDUW#DPSHUVRQ ogy. Ř:HHNO\6XQGD\%UXQFK Ř3DU1LJKWV/DGLHV$XJ0HQōV$XJ Additional DPSP SUL]HDWHYHU\KROH information can Ř2LOPHQōV$XJ5HJLVWHUE\FDOOLQJ.HQODURIƓFH be found on the Super Lucky’s Tale is full of bright and cheery environments. Xbox One X NHL 20 blog. screenshot
24 HOUR PAY AT THE PUMP Now Available at Your Co-op Gas Bar in Wainwright
THE ONLY PUMPS IN TOWN OPEN ALL NIGHT! FUEL UP ON YOUR SCHEDULE! EDGE | Wainwright, AB | August 2, 2019 15 The ONLY $350 Business&ProfessionalDirectory FOR 3 MONTHS! CALL 780-842-4465 TODAY
ADVERTISING IN DIRECTORIES can be an affordable and effective marketing tool YOUR AD HERE for small businesses. Advertising offers a targeted way of spreading the word about your business to large numbers of people. ONLY $350 FOR 3 MONTHS! 1B5: &;C1> " CALL >1-::1)-871> " PATRICK OR SHERRY TODAY ->91881 5/718 " 780.842.4465 XT] UT%@>11@w)-5:C>534@ 8.1>@-w&])U ] "4;:1 I[\TJ\XV WYTUw-D I[\TJ\XV ZVU[
YOUR AD HERE Safety Services FEED GRAINS A Division of Jaws Contracting WANTED ONLY $350 Proudly serving Wainwright, Hardisty, Lloydminster Sunhaven Farms Milling, Irma, AB FOR 3 MONTHS! & surrounding area! We are looking to purchase Feed Grains: NOW SELLING 4-Head Monitors, Bump Test & Calibration Wheat, Peas, Fabas, Barley. CALL Gas, Safety Glasses & More! We offer competitive pricing and prompt payment. NOW OFFERING SAFETY CONSULTING PATRICK OR SHERRY TODAY For more information and pricing, please contact: Visit our website www.jawssafety.com 780.842.4465 Ted Ratte, Manager Cell: 780-806-9245 or call 780-842-6733 Phone: 780-754-2708 Fax: 780-754-2709 for upcoming schedules & online courses. e-mail: [email protected]
VETERINARY MEDICAL CENTER #20 2902-15Ave Wainwright (Across from McDonald’s)
3HW/DVHU6XUJHU\ 0),6+")"3%)&06 3HW/DVHU7KHUDS\ +RXU 7.,/+&2& *1*.-6&&"+2)5",17.-2"$2&-1&1 *HQHUDO0HGLFLQH +HDOWK6HUYLFHV 6HUYLFH 7"'&26+"11&17&1*(-&06&4&"073-(+"11&1 +HDOWK6HUYLFHV FRQVXOWDWLRQ Phone: 780-842-4224 IRUODUJHDQLPDOV Hrs: Mon. - Fri., 9:00am-5:30pm "5 Dr. David Weeks 780-845-8838 Open Late Thurs. til 7:30pm ,"*+*-'.&6&1*-2.4-$" Dr. Hannah Poulin 617-10 St. Wainwright, AB T9W 1P2 !*2&444&6&1*-2.4-$" VERMILION BOTTLE DEPOT 4612-48A Ave. Vermilion, AB PH: 780-853-2222 OILFIELD & GENERAL CONSTRUCTION BRING YOUR BOTTLES HERE! SITE SERVICES Kitchens & Baths We sort the bottles for you 14+<106#.+4'%6+10#.4+..+0)X :%#8#6+10X #7.+0) Offices No bag limit (Bring as much as you want) %%'55#66+0)h#.'5n'06#.5 Authorized Dealers of: Desks & Lockers We also take sorted & counted bottles +4'7224'55+100+65 Home Renovations We accept bottle drive & large load drop-offs LOCATIONS:Tg#+094+)*6X'#%'+8'4X 4#0&' 99% OF WHAT’S DRINKABLE IS REFUNDABLE! 4#+4+'X 4#0&'#%*'g:$19 1135 - 1st Avenue ' & & 3VYSLZZ¢ Pop & Beer Cans 10¢6]LY3¢ n U Wainwright, AB % & & Hours: Monday to Saturday 9:00am to 5:30pm 1'#<.';hKLNgLHFgNLKF www.creekwoodcabinets.ca “WE GUARANTEE THE BEST SERVICE” 14#0+'. 1&)'KLNgLHFgMHEI
Finding the right answer starts ADVERTISING IN DIRECTORIES here can be an affordable and effective marketing tool for small businesses. Advertising offers a targeted way of spreading the word about your business to large numbers of people.
Heavy Equipment, Truck & Trailer Repairs “Successful people are not gifted, they just 2102-23 Avenue, Wainwright, BA work hard, then succeed on purpose.” G.K. Nielson Call 780-842-0080 711 - 10th St, Wainwright 780.842.4171 www.dlipc.ca
www.facebook.com/ wainrepair FULL SERVICE YOUR AD HERE AUTOMOTIVE REPAIR & MAINTENANCE Wainwright, AB ONLY $350 All makes & models of vehicles Mike Bond, Journeyman Carpenter Shop Rate $100/hr Serving Wainwright & area for 20 years FOR 3 MONTHS! Locally Owned with over 30 years combined experience. - Renovations - Insulation - Windows - Decks - Drywall - Framing CALL Curtis Fletcher | Brian Doolittle | Chris McLean - Fences - Laminate flooring - Trim/baseboards - Soffit / fascia - Hardwood - Overhead door PATRICK OR SHERRY TODAY #1-2205 23 Street (North of UFA) Wainwright - Siding flooring installation 780.842.4465 780-806-9178 [email protected] - Shingles - Doors - AND MORE www.wainwrightautorepair.ca Call for your free Estimate 780-842-0073 16 EDGE | Wainwright, AB | August 2, 2019
The ONLY $350 Business&ProfessionalDirectory FOR 3 MONTHS! CALL 780-842-4465 TODAY
BATT LE R NICKERSON ROBERTS IVE R D. Barristers & Solicitors More Than Just Tires: ELECTRIC LT Providing Full Legal & Rim & tire packages Lift & leveling kits Full brake service Full shock & strut service Full steering & suspension service ELECTRICAL / VOICE & DATA Real Estate Services Wheel alignments Oil changes U-joints & drivetrain Approved Relocation Lawyers service Engine tune-ups Electrical Lighting upgrades Serving Wainwright & Area Suspension air bags & compressors Full accessories Since 1974 Terry B. Roberts, Q.C. Mechanical Services Available 2317-14 Ave., Wainwright, AB WARRANTY APPROVED DEALER Wainwright (780) 842-4485 608 – 10 St. Wainwright AB T9W 1E2 Phone: 780-842-4451 Provost (780) 704-0596 Saturdays 8:00am - Noon 780-842-6185 After Hours/Emergency Toll Free 1-855-852-5646 www.battleriverelectric.com
MAYFIELD ELECTRIC J.D. BARBER Residential | Commercial EQUIPMENT LTD.
dā3+,) /34#J/'-#Y-30 ,-d Warren Roberts C.M.E., S.C.O., P.E.C. / *!!4-3!/4 *!/'##*, /4- -/'-3 Professional Electrical Contractor >=C@[=@0-/ !53 ("4 R.R. #1 FULLY INSURED AND LICENSED PLUMBER/GASFITTER 780.842.5711 Wainwright, AB 780-842-0853 Serving Wainwright & Surrounding Communities within 100km radius *3''*+3Ă-/07 +47ā3+,) T9W 1W1 [email protected] Dora Coté Kyle Lawrence /34#J-30 ,-Y-%/ 3T
Central Vac Installation and Sales $872027,9( YOUR AD HERE Vacuum Sales, Repairs, and Accessories 6(59,&( 5(3$,5 ONLY $350 Tim Landrie, Owner FOR 3 MONTHS! The Vac Shack CALL Unit#3 5214 51 St. Lloydminster &857,6&855 PATRICK OR SHERRY TODAY PH: 780-874-1666 FAX: 780-874-1667 $YH:DLQZULJKW$% Email: [email protected] %XV+RXUV0RQ)ULSP 780.842.4465 HRS: Mon-Fri, 9-5, Sat 10-2, Closed Sundays & Stat holidays &9,3$1'2872)3529,1&(,163(&7,216
AW NA These blanket classified ads are produced through a joint agreement with The Wainwright EDGE and Alberta Weekly Newspaper Association (AWNA). These ads appear in all AWNA member papers (111 BlanketClassifieds papers) for the cost of $269.00 for the first 25 words, $8.00 per word over 25. To place a blanket classified, call The Wainwright EDGE at 780-842-4465.
BUSINESS FOR AUGUST 17th, buying Green, Heated or Service available at sup- els, Overweight, Trouble three rivers and by gov- ad. Only $269 (based on consultation. 1-800-347- OPPORTUNITIES 2019 Live & Online Auc- Springthrashed Canola. porting Distributors. Call Dressingμ and hundreds ernment land. Wonderful 25 words or less). Reach 2540. www.accessle- HIP/KNEE REPLACE- WLRQ 5LÁHV 6KRWJXQV Buying: oats, barley, 1-888-263-8254. more. All ages & medi- seclusion 30 minutes from over 100 weekly newspa- galmjf.com. MENT. Trouble walk- Handguns, Militaria, Auc- wheat & peas for feed. HEALTH cal conditions qualify. McBride, British Colum- pers. Call NOW for de- GET BACK ON TRACK! ing or other conditions tion or Purchase: Collec- Buying damaged or off- &DOOWKHEHQHÀWVSURJUDP bia. Wild game abounds. tails. 1-800-282-6903 ext Bad credit? Bills? Unem- tions, Estates, individual grade grain. “On Farm GET UP TO $50,000 1-(800)-211-3550 or send Stunning Mountain 200. www.awna.com. causing restrictions in from the Government ployed? Need Money? We daily activities? Up to items. Contact Paul, Swit- Pickup”. Westcan Feed & a text message with your views. Excellent access, CRIMINAL RECORD? Lend! If you own your zer’s Auction. Toll-Free Grain. 1-877-250-5252. of Canada. Do you or name and mailing address electricity, cell phone. 3 $50,000.00 in Refunds & someone you know have Why suffer employment/ own home - you qualify. %HQHÀWVDYDLODEOH&$// 1-800-694-2609; info@ FOR SALE to 403-980-3605 for your KRPHV/DUJHÀHOGVJRRG licensing loss? Travel/ Pioneer Acceptance Corp. switzersauction.com or any of these conditions? IUHHEHQHÀWVSDFNDJH barns. Owners retired. Ph. NOW! Disability Tax METAL ROOFING & ADHD, Anxiety, Arthritis, business opportunities? Member BBB. 1-877- Credit 1-844-453-5372. www.switzersauction. REAL ESTATE 1-250-569-7747. Be embarrassed? Think: 987-1420. www.pioneer- com. SIDING. 37+ colours Asthma, Cancer, COPD, BBB Approved. available at over 55 Dis- Depression, Diabetes, RANCH FOR SALE SERVICES Criminal Pardon. US en- west.com. COMING EVENTS FEED AND SEED tributors. 40 year war- 'LIÀFXOW\:DONLQJ)LEUR $2,700,000 CAD. 1262 BLANKET THE PROV- try waiver. Record purge. File destruction. Free FIREARMS WANTED HEATED CANOLA ranty. 24-48 hour Express myalgia, Irritable Bow- Acres - bordered by ,1&( ZLWK D FODVVLÀHG
Need a New Truck? Squeeze One “small” ad •Great BIG Results Get the ride YOU WANT! the MOST out of your advertising dollars You find it, We finance it... Place your ad in this newspaper 100+ weekly newspapers 12345 123456 $269+GST Any make! and province wide $ Over 1.6 million readers (based on 25 words) $8. Each additional word Any model! with a combined circulation Reach: Over 80% of Alberta’s Metro households of over 710,000 for only... 995 Readership: Over 95% of all adults living in those households Anywhere! plus GST/HST Want to reach beyond Alberta? Text or call 780-266-5436 Value Ad Network We can help you reach right across Canada Phone 780-483-2320 [email protected] Alberta Weekly Newspapers Association 2 toll free 1-800-282-6903 x200 Maurizia Hinse email [email protected] 780-434-8746 ext. 200 or visit this community newspaper classifi[email protected] SERVING THE BLUE COLLAR COMMUNITY FOR 30 YEARS
NEWSPAPERS ARE TRENDING 88% ARE READING ON ANY PLATFORM
NEWSMEDIACANADA.CA * Totum Research; Canadians 18+, weekly readership, March 2019 EDGE | Wainwright, AB | August 2, 2019 17
Scribner Acution is preparing for their 16th annual Summer Antique & Collector Auction on Saturday, August 10.
This old 1917 Ford was dropped off at Scribner Auction on Wednes- day, July 31, and will be one of the hundreds of items auctioned off at the big event next weekend.
The auction will kick off at 11:00 a.m. on August 10, with previews at 1:00p.m. on the Friday afternoon and 9:00 a.m. Saturday morning.
Photo: Zak McLachlan Happy 100Th Birthday Wishes to Mom, Gramma, Great Gramma Mildred Dais Elvira Davis (nee Gould) born August 5, 1919 near Czar Send Greetings to Walden Heights Seniors Community, 250 Walden Drive SE, Calgary, AB
The Municipal District of Wainwright Presents……
Send us your photos that capture the diversity of our agriculture industry and the environment within the M.D. of Wainwright. BLESSED SACRAMENT CATHOLIC CHURCH EVANGELICAL FREE CHURCH ST. PAUL’S CHAPEL (PROTESTANT) Contest Information: 906 - 6th8)17)< 6,8)17)< 7-/(-1+ <!"$%-194-+,6 ͻApplications can be downloaded from the M.D. website or picked up at the office %0!71(%:$245,-3 Saturday 5:00 p.m Mass, %0241-1+$245,-3!)48-') ͻPlease no emails! Hard copies of pictures or USB stick only !71(%: %0%55 !)1-24 %5624%48-1 )11)4 %-6,20071-6:224(-1%624 )8#-'244-5 ͻPhotos must be taken within the M.D. of Wainwright & you must be an M.D. ratepayer CANADIAN MARTYRS’ CHAPEL (CATHOLIC) GRACE UNITED CHURCH ͻYou can mail in entries or drop them off at the office 7-/(-1+ <!"$%-194-+,6 6,8)17)< ST. THOMAS ANGLICAN CHURCH Sun 9:00 a.m. Mass %0$245,-3,)/(-16,)!%1'67%4: 6,!64))6< ͻSend us photos that showcase all seasons %0$245,-3!71(%:!',22/ ͻDeadline August 16, 2019 %-6,20071-6:224(-1%624 JEHOVAH’S WITNESS CONGREGATION )811%4-)-'./-1 4 2:%7()124-2 8)17)< If you have any questions please contact Asst. Agricultural Fieldman Tanis Ponath at email: %3256/)66)/751)6 CHURCH OF JESUS CHRIST OF LATTER DAY SAINTS %0$245,-3 780-842-4454 WAINWRIGHT PENTECOSTAL ASSEMBLY 6,8)17)< PEACE LUTHERAN CHURCH 6,8)17)< Here are some of last years winners: %0$245,-3 6,8)17)< %0!71(%:!',22/ CHURCH OF THE NAZARENE %0$245,-3!71(%:!',22/ %030$245,-3 %0(7/6!71(%:!',22/ )8)4)1( 212&()1 3021$)(1)5(%: %0$245,-3 )8)4)1(/%-1)2&()1 -&/)!67(:-(;21) !)48-')!71(%:!',22/(74-1+$245,-3 LORD OF THE NATIONS FULL GOSPEL CHURCH %56245%17(:%4',7. !)48-')*24%//%+)5 %5624 :%1$22( !64))6< !)48-')5%6%0 30 Rachel Lawson “Peek-a-Boo” Jen Koss “Tranquility” Sheri White “Winter Sunset”
CALL NOW for Blow Out Pricing!
2020 MODELS ARE IN STOCK 18 EDGE | Wainwright, AB | August 2, 2019
Society to offer local youth the oppor- tunity to become a crime-fighter with their “Kids ‘N’ Kops program. Accommodations wanted for pipe- line workers for August to November. Saturday’s hit and miss rain showers didn’t dampen the community spirit One-Year Compiled by Phyllis Holmes from the newspaper archives Ago [email protected] of Irma as the village held its annual Irma Daze celebration. Nine-month- August 3, 2018 “History cannot give us a program old Sierra Mark was named 1999 Baby for the future, but it can give us a fuller Queen during the Street Fair Saturday understanding of ourselves, and of our afternoon. common humanity, so that we can bet- Jennifer Fenton of Irma has won ter face the future” Robert Penn Warren $11,000 at the Calgary Stampede for her Championship Steer. An overheating vehicle caught fire Twenty on Monday afternoon, which led to Years Ago a large grass fire just south of Wain- August 4, wright. The hot and dry conditions 1999 made it tough to corner the grass fire. Three local baseball players, Mitchell Forty Forster, Brett Moran, and Jason Frank Years Ago earned a silver medal at the Midget August 1, Ten Years Ago ‘AAA’ Tier II Provincial Champion- 1979 ships in Okotoks with the East Central Dr. Martin Botha arrives in Wain- July 31, ‘AAA’ Bulls. wright, setting up his practice at the 2009 Wainwright Medical Clinic on Main Street. The Irma Chamber of Commerce Annette Semple received a plaque on organized the Mud Drags out by Ron her retirement from the Wainwright Thurston’s land. MD of Wainwright councilor Phil Post Office after 24 years of service. Wainwright Fire Captain Brent Greer Valleau would like to see the entire The plaque included an expression of led a delegation to the M.D Council MD have physical addresses to help gratitude and well wishes from Prime Chambers asking the M.D. to look into emergency services. Minister Joe Clark. drawing up a formal policy regard- A full house enjoys “Paper Wheat” ing fire department responsibilities to St. Mary’s Anglican Church in Edger- presentation, sponsored by the Wain- MVAs that occur within the munici- ton celebrated 100 years in the com- Happening? wright Band Boosters. pality. munity this summer. Wainwright RCMP has teamed up Edgerton Chief Administrative Offi- CALL Zak @ with the Big Brothers & Big Sisters cer, Terry Tiffen retires after 11 years (780) 842-4465 in the post. New Expansion NOW OPEN for Tours, Call and ask us!
Real People, Real Food, Real Family! Reserve a tour and receive a FREE meal! Come Join the Fun!!
# " # ! # # # # RENT A NEW SUITE in Wainwright Points West Living and RECEIVE A $500 CREDIT WITH ARMSTRONG FURNITURE to spend how you like!
Call 780-845-2080 for more information. 2710-11 Ave. Wainwright AB. | pointswestliving.com
Follow us on Facebook facebook.com/ WainwrightStarNews EDGE | Wainwright, AB | August 2, 2019 19 Classified ads get results! To place a classified ad by, call (780) 842-4465 CLASSIFIEDS email [email protected] or visit our website at www.starnews.ca. We take credit card payments by phone for your convenience. FOR RENT FOR RENT FOR RENT FOR RENT FOR RENT ASK USFOR ABOUT RENT OUR FOR RENT PLEASE %('5220 ',))(5(17 $9$,/$%/(,0 )255(17EHG %('5220$55/MTH$9$,/$%/(,0 PROMOTION)255(17EHG +286( Z ELJ %8,/',1*61RZ 0(',$7/< URRP EDWK +286( Z ELJ 0(',$7/< URRP EDWK RECYCLE \DUGGHFNDSSOL 6HFXULW\ &DPHUDV %HGURRP WRZQ VLQJOHZLGHPRELOH \DUGGHFNDSSOLGOING%HGURRP ON WRZQ NOW!VLQJOHZLGHPRELOH DQFHV IRU\RXUSURWHFWLRQ KRXVH LQ )DE\DQ DQFHV KRXVH LQ )DE\DQ '' 8WLOLWLHV %DFKHORU $SWV PRQWKSOXV PRQWK$YDLO '' 8WLOLWLHV PRQWKSOXV PRQWK$YDLO YOUR EDGE $YDLODEOHLPPHGL 6WDUWLQJ DW SRZHUDQGGDPDJH DEOH LPPHGLDWHO\ $YDLODEOHLPPHGL SRZHUDQGGDPDJH DEOH LPPHGLDWHO\ DWHO\ 12 SHWV 6PDOO%HG GHSRVLW LQFOXGHV 3KRQH'HQQLV DWHO\ 12 SHWV GHSRVLW LQFOXGHV 3KRQH'HQQLV BAGS SDUWLHV VPRNLQJ URRP$SWV6WDUWLQJ JDVDQGZDWHU &DOO RU SDUWLHV VPRNLQJ JDVDQGZDWHU &DOO RU $OOXWLOLW 5115 - 25LLOYDMINSTER STREET | 780-875-3335 LHV LQFOXGHG LQ The Wainwright EDGE ERWK HYHQ SRZHU The Wainwright EDGE Classified ads give The WainwrightTOLL EDGE FREE: The 1-866-995-3335 Wainwright EDGE Classified ads give offers readers a chance DQGFDEOH&ORVHWR offers the best classified the best results in offers readers a nissanlloydminster.comchance offers the best classified the best results in to place classifed ads Wainwright, AB to place classifed ads Wainwright, AB +RVSLWDO&DOO section available. section available. with in the classified with in the classified section Classified get results section Classified get results
Classifieds Ads Get Results GOT NEWS? Whether you’re buying or selling For coverage of your event contact To place classified ad’s Call 780-842-4465 or email [email protected] Zak McLachlan (780) 842-4465 (780) 806-8404 EMPLOYMENT OPPORTUNITY or submit to [email protected] Full Time CLASS 3 DRIVER with air ticket required immediately. Safety Tickets required. Must have current drivers abstract. EMPLOYMENT
Co-operative Limited Drop resumes off at Wayside UFA 2202-17 Ave. Wainwright, AB T9W 1L2 Fax to 780-842-4700 Email: [email protected] The Village of Irma EMPLOYMENT OPPORTUNITY CHIEF ADMINISTRATIVE OFFICER FULL-TIME EMPLOYMENT BARTENDERS For the Messes at 3 CDSB Grn Wainwright 7KH9LOODJHRI,UPDLVVHHNLQJDIXOOWLPH&KLHI$GPLQLVWUDWLYH2IƓFHUWRSURYLGH Part Time Positions FRPSUHKHQVLYHDGYLFHWRLWV&RXQFLORQDOODVSHFWVRIPXQLFLSDOJRYHUQDQFHDQG Successful Candidate must be available OHJLVODWLYHUHTXLUHPHQWVWRHQVXUHWKHGLUHFWLRQRI&RXQFLOLVLPSOHPHQWHGDQG Evenings and/or Weekends. WRSURYLGHHIIHFWLYHOHDGHUVKLSWRWKHZKROHRUJDQL]DWLRQDQGFRPPXQLW\ WHAT YOU DO: Bartender greets customers, prepares and serves 7KHVHOHFWHGFDQGLGDWHZLOOEHUHVSRQVLEOHIRUSUHSDULQJPRQLWRULQJDQGUH mixed drinks, wine, draft or bottled beer and non-alcoholic beverages - for patrons; maintain inventory of bar stock and ensures a clean bar SRUWLQJRQWKHDQQXDOƓQDQFLDOSODQ7KHLQFXPEHQWZLOOXQGHUVWDQGWKHORFDO area including washing glassware. Also ensures compliance with JRYHUQPHQWQHHGVDQGFKDOOHQJHVRIVPDOOUXUDOFRPPXQLWLHVHQMR\VFRRUGL- provincial liquor legislation and regulations. QDWLQJLQIRUPDWLRQDQGPDNLQJGHFLVLRQVDQGWDNHVDQLQWHUHVWLQJOREDOLVVXHV Join Team Repsol - WKDWDIIHFWXVDOO7KHLGHDOFDQGLGDWHZLOOEHSURƓFLHQWLQYDULRXVFRPSXWHUVRIW WHAT YOU REQUIRE: High school diploma, AND some bartender - experience OR a demonstrated equivalent combination of education, ZDUHDSSOLFDWLRQVLQFOXGLQJ:RUG([FHOƓQDQFLDODFFRXQWLQJVRIWZDUHHWF+ROG training and/or experience. We are hiring in Chauvin H[FHOOHQWFRPPXQLFDWLRQDQDO\WLFDODQGOHDGHUVKLSVNLOOV'HVLUHGFDQGLGDWHV ZRXOGQRUPDOO\UHTXLUHWKHFRPSOHWLRQRIDFHUWLƓFDWHLQ/RFDO*RYHUQPHQW$G- AND Must be of legal age to serve alcohol in Alberta (18); Smart Serve Employment Opportunities include: PLQLVWUDWLRQRUHTXLYDOHQWWUDLQLQJDQGH[SHULHQFH &HUWLƓFDWLRQRUHTXLYDOHQW ' !" #" " (51194) WHAT YOU RECEIVE: above minimum hourly wage; tips, vacation '!" " !!" " (51212) 7KH9LOODJHRI,UPDRIIHUVDFRPSHWLWLYHFRPSHQVDWLRQDQGEHQHƓWVSDFNDJHDQG SD\KROLGD\SD\DFFHVVWRƓWQHVVIDFLOLW\FDQH[EHQHƓWV ' #" (51211) FRQWLQXRXVOHDUQLQJRSSRUWXQLWLHVLQDFRPPXQLW\WKDWHQDEOHVDVXSHULRUZRUN Check out www.cfmws.com for more information about our company '!" "$!!!"" "!" (51191) OLIHEDODQFH and to view the job poster. ,QWHUHVWHGFDQGLGDWHVDUHLQYLWHGWRVXEPLWWKHLUDSSOLFDWLRQLQFRQƓGHQFHE\ NPF employees must demonstrate the following shared competen- 4:00 P.M. August 20, 2019 to: cies: Client Service, Communication, Organizational Knowledge, In- $%"% !"! ! novation, Teamwork and Leadership. $!"# ! 9LOODJHRI,UPDŏ&21),'(17,$/Ő NPF is committed to Employment Equity and Diversity and invites ap- "" ! !%&% &! FR%R[,UPD$OEHUWD7%+ plications from Women, Aboriginal People, Persons with Disabilities ! $WWHQWLRQ'HQQLV)XGHU and Visible Minorities. To receive the job poster in an alternative for- 3KRQH (PDLOGIXGHU#LUPDFD mat, please contact the NPF Human Resources Manager. Only those :HEVLWHZZZLUPDFD selected for an interview will be contacted. To learn more about Repsol visit our website: apply online at www.cfmws.com https://www.repsol.com/en/index.cshtml We thank all applicants for interest expressed in this competition however only candidates who most Competition closes 6 August 2019 FORVHO\ƓWRXUQHHGVZLOOEHFRQWDFWHGIRULQWHUYLHZV
What’s Happening is a community events calendar intended for Non-Profit Groups only. $40 plus GST To Put Your Event on the Calendar for a 6-week maximum run (40 word maximum) We do not accept Bridal Shower, Wedding, Birthday or Anniversary Announcements. WHAT'S HAPPENING? CALL 780-842-4465 FOR DETAILS AUGUST ANNOUNCEMENTS 16 & 17 Come by the Hills Music Festival on site camping, Group & family sites, Food Concession & childrens Lakeland College Administration Professional Program. September 3–April 24 (Evenings & Weekends) in Wain- program, vendors. Inquiries: [email protected] (Ad#55380) wright. For information on program, schedule, admissions/requirements, student loans & careers, visit wainwright. 19 - 23 The Evangelical Free Church of Wainwright will be hosting a free Vacation Bible School ca/living/education-and-childcare/post-secondary/ or contact Carley at 780.842.3381/ [email protected] or program for children entering kindergarten to grade 6, Aug 19 - 23 from 9:30 am to noon. The theme Claudinei at 780.842.3455/ [email protected]. Application deadline is August 12th. (AD# 55524) this year is “The Incredible Race”! Grab your gear and get ready for the race of a lifetime! (Ad#55663)
STAR NEWS INC. 1027 3RD AVE. TEL: (780) 842 -4465 FAX: (780) 842 -2760 EMAIL: [email protected] 20 EDGE | Wainwright, AB | August 2, 2019 WAINWRIGHT, AB 780-842-4408 CONSORT, AB 403-577-3899 ST. PAUL, AB 780-645-4465
927245 927174 927187 927201
2013 New Holland CR8090 2011 New Holland CR9090Z 2012 New Holland CR9090 2013 New Holland CR8090 Combine, Eng Hrs 2617, Sep Hrs 1967. Combine, Excellent cond., C/W 790CP Combine, Sep Hrs 1356 No Pickup Combine, Eng Hrs 2441 Sep Hrs 1827. C/W 790CP Header. Stock # 12473B Header Sep Hrs. 957 Stock # 12420A header Stock # 12533B C/W 790CP header. Stock # 12477A $165,000 $200,000 $189,000 $170,000
927212 927224 927225
2011 New Holland CX8080 2013 New Holland CR8090 2010 New Holland CR9070 2012 New Holland CR9090 Combine, 1758 Sep Hrs. Combine, Eng Hrs. 1479. Sep Hrs 1107. Combine, Eng Hrs 3328. Sep Hrs 2547, Combine, Sep Hrs 1068hrs, 449HP, Stock # 12533A C/W 790CP header. Stock # 12546B C/W 76C header. Stock # 12475A Excellent cond., Stock # 12420B $165,000 $199,000 $130,000 $200,000
927257 927275 927276 927280
2015 Claas 760 2015 Claas 760 2017 Claas 670 2016 New Holland CR9.90Z Combine, Sep Hrs 490 Combine, Unit # 12532A No Header Combine, Sep Hrs 340 Combine, 1065hrs, Sep Hrs 740, Stock # 12511A Stock # 12532 Stock # 12546A Stock # 12465A $435,000 $425,000 $368,000 $395,000
HEADERS 2013 Macdon FD75-45, Stock#40252A ...... $69,000 2009 New Holland 94C, Stock#12004A ...... $25,000 2016 Macdon FD75-40, Stock# 40253A ...... $88,000 2009 New Holland 94C-36ft., Stock# 12391B ...... $27,000 2015 Macdon FD75-40 No Transport, Stock# 40254A ...... $73,000 2002 New Holland 94C-36Ft, Stock # 40154B...... $14,000 2015 Madcon FD75-40 No Transport, Stock# 40255A ...... $73,000 2010 New Holland 94C, Stock # 40204B ...... $28,000 2016 Macdon FD75-40, Stock#40256A ...... $88,000 2004 New Holland 94C-36FT, Stock# 40208B ...... $16,000 2014 Macdon D65-40, Stock# 40257A ...... $59,000 2010 New Holland 94C, Stock # 40210A ...... $29,000 2014 Macdon D65-40, Stock# 40258A ...... $59,000 2008 New Holland 94C-36ft, Stock # 40212A ...... $25,000 2016 Macdon FD75-40, Stock# 40259A ...... $84,500 2011 New Holland 94C-36ft, Stock # 40231A ...... $25,000 2017 Macdon FD75-45, Stock #40260A ...... $95,000 2012 New Holland 94C, Stock # 40233C ...... $29,000 2014 Macdon D65-35, Stock# 40261A ...... $64,500 2013 New Holland 840CD-35ft, Stock#40247A...... $30,000 2014 Macdon D65-40, Stock #40262A ...... $59,000 2016 Macdon FD75-35. C/W Lexion adapter., Stock # 12547A ...... $75,000 2018 Macdon FD135-35, Stock #40266A ...... $ 98,900 2015 Macdon FD75-35 C/W JD adapter, Stock # 12552C ...... $69,500 2012 John Deere 635D, Stock # 40209A ...... $38,000 COMBINES 2016 Macdon FD75-45, Stock# 40250A ...... $85,000 2015 CX8090 Sep HRS 605, Stock#30452B ...... $325,000. CASH 2016 Macdon FD75-45, Stock# 40251A ...... $85,000 2010 CX8080 Sep Hrs 1803, Stock # 12447B ...... $145,000
2018 New Holland CR9.90Z 2014 John Deere S680 2011 John Deere 9870STS Combines, Abrasive Elevator Kit ,Twin Pitch Rotors, Variable Hydrostat. 790CP HeaderDynamic Sep Hrs 760 c/w 615P Header Sep Hrs 1170 c/w 615P Header, Feedroll. X’s 3. Unit #’s12513A/12515A/12517A Stock# 12532A Stock# 12552B $549,000 $310,000 $180,000
Find us at www.triag.ca Follow us on @triagimp @triagimplements
0% fi nancing for 12 months OAC
© 2018 CNH Industrial America LLC. All rights reserved. New many other countries, owned by or licensed to CNH Industrial