DOCSLIB.ORG

(USP7) in Histone H2A Ubiquitination

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(USP7) in Histone H2A Ubiquitination Characterization of E2E Ubiquitin-Conjugating Enzymes and Ubiquitin-Specific Protease 7 (USP7) in Histone H2A Ubiquitination Hossein Davarinejad A thesis submitted to the Faculty of Graduate Studies in partial fulfillment of the requirements for the degree of Master of Science Graduate Program in Biology York University Toronto, Ontario December 2017 © Hossein Davarinejad, 2017 Abstract Ubiquitin(Ub)-conjugating E2 enzymes play essential roles in ubiquitination of proteins. The UbE2E sub-family members UbE2E1, UbE2E2, and UbE2E3 have N-terminal extensions to the conserved E2 core which contain Ubiquitin-Specific Protease 7 (USP7) binding sequences (P/A/ExxS). Here, we continued our investigations to established that USP7 can interact with E2Es in vitro and in vivo. Our new data indicated that the N-terminal extensions of E2E2 or E2E3 can directly associate with USP7 TRAF domain. We demonstrated that E2E2 or E2E3 are stabilized by USP7 in cells. We also showed that E2Es interact with Ring1B:BMI1, the core components of the Polycomb Repressive Complex 1 (PRC1) and established E2E1 as an in vivo E2 for monoubiquitination of histone H2A on lysine(K) 119. We demonstrated that E2Es can modulate the levels of H2A monoubiquitination in cells and that USP7 may exert an effect on K119-UbH2A levels through regulating E2Es. ii Dedications For my dearest, and departed grandmother. Your memories, love, and grace are eternal. I also dedicate this to Agnieszka, GhoorGhoor, and Charlie for their invaluable support. And for science; may our collective and ever developing understanding of the universe and life lead us to make the world a better and a more peaceful place, for all life is precious. iii Acknowledgements I am grateful to my two dear supervisors, Dr. Vivian Saridakis and Dr. Yi Sheng, for the opportunity to start and complete these projects, a great work and learning experience, and their guidance. Thank you, Dr. Peter Cheung, for your time and efforts as my advisor. A special thanks to Raghav, Heather, Rahima, Ira, Anna, Olga, Niharika, Varvara, Sahar, and Roland in my two labs for all the help, teachings, and great memories. I am forever indebted to my father Masoud Davarinejad for his continuous financial support throughout my studies and beyond. Thank you, governments of Ontario and Canada, for providing student loans and grants. Thank you, the York University administration and CUPE 3903, for the employment opportunities during my degree. Thank you Canadian Institute of Health Research (CIHR) for funding my projects. Thank you Jelena & Giga and Jyotsna for your kindness, support, and help for my defense. Thank you, lab members in Bayfield [Sam, Jyotsna, Ana, Rawa], Audette [Agnesa, Ayat, Cristina], Peng [Mohamed, Stephanie, Jelena, Heyam, Shahin, Alina], Donaldson [Jamie, Sarah, Kate], Zoidl [Paige, Cherie, Ryan], Rosonina [Veroni, John, Akhi], Cheung [Marlee, Keyur], Kubiseski [Dayana, Queenie], McDermott [Saviz, Stephanie, Dandan, Christina, Ali], and Yusaf [Paul, Sina] groups and all the supervisors and personnel on the 3rd floor of the Life Sciences Building (LSB) including the custodian Maria, for a wonderful and enjoyable time while completing my degree. Thank you executives, directors, administrators, staff and members of the York University Graduate Students’ Association (YUGSA), Association of Graduate Students in Biological Sciences (AGSBS), the Canadian Federation of Students (CFS); Department of Biology, Faculty of Graduate Studies, and the Office of the President at York University for extending my education beyond biology into advocacy, governance, politics, administration, and student movements. iv Table of Contents Abstract ................................................................................................................................... ii Dedications ............................................................................................................................ iii Acknowledgements ................................................................................................................ iv Table of Contents .................................................................................................................... v List of Tables............................................................................................................................ x List of Figures ..........................................................................................................................xi List of Abbreviations .............................................................................................................. xiii Chapter 1: Ubiquitin Systems ............................................................................................. 1 1.1 Ubiquitin: A Ubiquitous Small Signalling Protein ............................................................ 1 1.2 Ubiquitin and Ubiquitin-Like Post-Translational Modification ....................................... 2 1.3 Diversity of Ubiquitin Signaling ....................................................................................... 5 1.4 The Ubiquitination Pathway & Machinery ..................................................................... 6 1.5 E1 Ubiquitin-Activating Enzymes .................................................................................... 7 1.6 E3 Ubiquitin-Ligases ........................................................................................................ 8 1.7 E2 Ubiquitin-Conjugating Enzymes ............................................................................... 10 1.7.1 E2 Classification: A Tail of Tails ............................................................................................................ 12 1.7.2 Mechanism of E2 Conjugation by UBA1 .............................................................................................. 14 1.7.3 E2 Functional Roles and Specificities ................................................................................................... 15 v 1.7.4 E2E Sub-Family of Ubiquitin-Conjugating Enzymes ............................................................................. 17 1.8 Deubiquitinating Enzymes (DUBs) ................................................................................ 20 1.8.1 DUB Classification ................................................................................................................................ 20 1.8.2 DUBs Regulate Ubiquitin Pathways ..................................................................................................... 23 1.8.3 Ubiquitin-Specific Protease 7 (USP7): One DUB, Many Roles .............................................................. 25 1.8.3.1 USP7 Structure and Mechanism of Function ............................................................................. 26 1.8.3.2 USP7’s TRAF Domain has a Consensus Binding Site ................................................................... 29 1.9 Ubiquitin & The Histone Code ...................................................................................... 31 1.9.1 Mono-Ubiquitination of H2A by Polycomb Group Proteins ................................................................ 32 1.10 Ub-Ligases and Ub-Conjugases as Targets of USP7 ...................................................... 34 1.10.1 USP7 is a Regulator of Ring1B ......................................................................................................... 34 1.10.2 USP7 is a Regulator of E2E1 ............................................................................................................ 35 1.10.3 USP7 Is a Potential Regulator of E2E2 and E2E3 ............................................................................. 35 1.10.3.1 E2E2 and E2E3 Contain TRAF Binding Motif ............................................................................... 35 1.10.3.2 Full-Length E2E2 and E2E3 Proteins Bind USP7 TRAF ................................................................ 35 1.10.3.3 USP7 Binds E2E2 and E2E3 in vivo .............................................................................................. 36 1.10.3.4 Molecular Analysis of the USP7:E2E2 or E2E3 Interactions ....................................................... 36 1.11 Rationale ....................................................................................................................... 37 Chapter 2: Materials & Methods ...................................................................................... 39 2.1 Bacteria | Culture, Gene Expression, and Protein Purification .................................... 39 2.1.1 DNA Plasmid Constructs and Amplifications ....................................................................................... 39 2.1.2 Preparation of Chemically-Competent Bacteria .................................................................................. 40 2.1.3 Gene Expression (Transformations)..................................................................................................... 40 2.1.4 Inducible Protein Expression ............................................................................................................... 41 vi 2.1.5 Harvest and Lysis ................................................................................................................................. 41 2.1.6 Histidine-Nickel Protein Purifications (His-Tag) ................................................................................... 41 2.1.7 GST-Glutathione Protein
Load more

Recommended publications
  • The HECT Domain Ubiquitin Ligase HUWE1 Targets Unassembled Soluble Proteins for Degradation
    OPEN Citation: Cell Discovery (2016) 2, 16040; doi:10.1038/celldisc.2016.40 ARTICLE www.nature.com/celldisc The HECT domain ubiquitin ligase HUWE1 targets unassembled soluble proteins for degradation Yue Xu1, D Eric Anderson2, Yihong Ye1 1Laboratory of Molecular Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD, USA; 2Advanced Mass Spectrometry Core Facility, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD, USA In eukaryotes, many proteins function in multi-subunit complexes that require proper assembly. To maintain complex stoichiometry, cells use the endoplasmic reticulum-associated degradation system to degrade unassembled membrane subunits, but how unassembled soluble proteins are eliminated is undefined. Here we show that degradation of unassembled soluble proteins (referred to as unassembled soluble protein degradation, USPD) requires the ubiquitin selective chaperone p97, its co-factor nuclear protein localization protein 4 (Npl4), and the proteasome. At the ubiquitin ligase level, the previously identified protein quality control ligase UBR1 (ubiquitin protein ligase E3 component n-recognin 1) and the related enzymes only process a subset of unassembled soluble proteins. We identify the homologous to the E6-AP carboxyl terminus (homologous to the E6-AP carboxyl terminus) domain-containing protein HUWE1 as a ubiquitin ligase for substrates bearing unshielded, hydrophobic segments. We used a stable isotope labeling with amino acids-based proteomic approach to identify endogenous HUWE1 substrates. Interestingly, many HUWE1 substrates form multi-protein com- plexes that function in the nucleus although HUWE1 itself is cytoplasmically localized. Inhibition of nuclear entry enhances HUWE1-mediated ubiquitination and degradation, suggesting that USPD occurs primarily in the cytoplasm.
    [Show full text]
  • Ubiquitination Is Not Omnipresent in Myeloid Leukemia Ramesh C
    Editorials Ubiquitination is not omnipresent in myeloid leukemia Ramesh C. Nayak1 and Jose A. Cancelas1,2 1Division of Experimental Hematology and Cancer Biology, Cincinnati Children’s Hospital Medical Center and 2Hoxworth Blood Center, University of Cincinnati Academic Health Center, Cincinnati, OH, USA E-mail: JOSE A. CANCELAS - [email protected] / [email protected] doi:10.3324/haematol.2019.224162 hronic myelogenous leukemia (CML) is a clonal tination of target proteins through their cognate E3 ubiq- biphasic hematopoietic disorder most frequently uitin ligases belonging to three different families (RING, Ccaused by the expression of the BCR-ABL fusion HERCT, RING-between-RING or RBR type E3).7 protein. The expression of BCR-ABL fusion protein with The ubiquitin conjugating enzymes including UBE2N constitutive and elevated tyrosine kinase activity is suffi- (UBC13) and UBE2C are over-expressed in a myriad of cient to induce transformation of hematopoietic stem tumors such as breast, pancreas, colon, prostate, lym- cells (HSC) and the development of CML.1 Despite the phoma, and ovarian carcinomas.8 Higher expression of introduction of tyrosine kinase inhibitors (TKI), the dis- UBE2A is associated with poor prognosis of hepatocellu- ease may progress from a manageable chronic phase to a lar cancer.9 In leukemia, bone marrow (BM) cells from clinically challenging blast crisis phase with a poor prog- pediatric acute lymphoblastic patients show higher levels nosis,2 in which myeloid or lymphoid blasts fail to differ- of UBE2Q2
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • UBE2E1 (Ubch6) [Untagged] E2 – Ubiquitin Conjugating Enzyme
    UBE2E1 (UbcH6) [untagged] E2 – Ubiquitin Conjugating Enzyme Alternate Names: UbcH6, UbcH6, Ubiquitin conjugating enzyme UbcH6 Cat. No. 62-0019-100 Quantity: 100 µg Lot. No. 1462 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the ubiquitylation Species: human Protein Sequence: pathway play a pivotal role in a num- GPLGSPGIPGSTRAAAM SDDDSRAST ber of cellular processes including Source: E. coli expression SSSSSSSSNQQTEKETNTPKKKESKVSMSKN regulated and targeted proteasomal SKLLSTSAKRIQKELADITLDPPPNCSAGP degradation of substrate proteins. Quantity: 100 μg KGDNIYEWRSTILGPPGSVYEGGVFFLDIT FTPEYPFKPPKVTFRTRIYHCNINSQGVI Three classes of enzymes are in- Concentration: 1 mg/ml CLDILKDNWSPALTISKVLLSICSLLTDCNPAD volved in the process of ubiquitylation; PLVGSIATQYMTNRAEHDRMARQWTKRYAT activating enzymes (E1s), conjugating Formulation: 50 mM HEPES pH 7.5, enzymes (E2s) and protein ligases 150 mM sodium chloride, 2 mM The residues underlined remain after cleavage and removal (E3s). UBE2E1 is a member of the E2 dithiothreitol, 10% glycerol of the purification tag. ubiquitin-conjugating enzyme family UBE2E1 (regular text): Start bold italics (amino acid and cloning of the human gene was Molecular Weight: ~23 kDa residues 1-193) Accession number: AAH09139 first described by Nuber et al. (1996). UBE2E1 shares 74% sequence ho- Purity: >98% by InstantBlue™ SDS-PAGE mology with UBE2D1 and contains an Stability/Storage: 12 months at -70˚C; N-terminal extension of approximately aliquot as required 40 amino acids. A tumour suppressor candidate, tumour-suppressing sub- chromosomal transferable fragment Quality Assurance cDNA (TSSC5) is located in the re- gion of human chromosome 11p15.5 Purity: Protein Identification: linked with Beckwith-Wiedemann syn- 4-12% gradient SDS-PAGE Confirmed by mass spectrometry.
    [Show full text]
  • The Ubiquitination Enzymes of Leishmania Mexicana
    The ubiquitination enzymes of Leishmania mexicana Rebecca Jayne Burge Doctor of Philosophy University of York Biology October 2020 Abstract Post-translational modifications such as ubiquitination are important for orchestrating the cellular transformations that occur as the Leishmania parasite differentiates between its main morphological forms, the promastigote and amastigote. Although 20 deubiquitinating enzymes (DUBs) have been partially characterised in Leishmania mexicana, little is known about the role of E1 ubiquitin-activating (E1), E2 ubiquitin- conjugating (E2) and E3 ubiquitin ligase (E3) enzymes in this parasite. Using bioinformatic methods, 2 E1, 13 E2 and 79 E3 genes were identified in the L. mexicana genome. Subsequently, bar-seq analysis of 23 E1, E2 and HECT/RBR E3 null mutants generated in promastigotes using CRISPR-Cas9 revealed that the E2s UBC1/CDC34, UBC2 and UEV1 and the HECT E3 ligase HECT2 are required for successful promastigote to amastigote differentiation and UBA1b, UBC9, UBC14, HECT7 and HECT11 are required for normal proliferation during mouse infection. Null mutants could not be generated for the E1 UBA1a or the E2s UBC3, UBC7, UBC12 and UBC13, suggesting these genes are essential in promastigotes. X-ray crystal structure analysis of UBC2 and UEV1, orthologues of human UBE2N and UBE2V1/UBE2V2 respectively, revealed a heterodimer with a highly conserved structure and interface. Furthermore, recombinant L. mexicana UBA1a was found to load ubiquitin onto UBC2, allowing UBC2- UEV1 to form K63-linked di-ubiquitin chains in vitro. UBC2 was also shown to cooperate with human E3s RNF8 and BIRC2 in vitro to form non-K63-linked polyubiquitin chains, but association of UBC2 with UEV1 inhibits this ability.
    [Show full text]
  • UBE2E2 Antibody Cat
    UBE2E2 Antibody Cat. No.: 29-870 UBE2E2 Antibody Antibody used in WB on recombin ant protein at: 1:500 (Lanes: 1: 40ng HIS- UBE2D1 protein, 2: 40ng HIS- UBE2D2 protein, 3: 40ng HIS- UBE2D3 proteinm, 4: 40ng HIS- UBE2D4 protein, 5: 40ng HIS- UBE2E1 protein, 6: Antibody used in WB on Human Jurkat 0.125 ug/ml. 40ng HIS- UBE2E2 protein, 7: 40ng HIS- UBE2E3 protein, 8: 40ng HIS- UBE2K protein, 9: 40ng HIS- UBE2L3 protein, 10: 40ng HIS- UBE2N protein, 11: 40ng HIS- UBE2V1 protein, 12: 40ng HIS- UBE2V2 protein.). September 24, 2021 1 https://www.prosci-inc.com/ube2e2-antibody-29-870.html Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Dog, Human, Mouse, Rat Antibody produced in rabbits immunized with a synthetic peptide corresponding a region IMMUNOGEN: of human UBE2E2. TESTED APPLICATIONS: ELISA, IHC, WB UBE2E2 antibody can be used for detection of UBE2E2 by ELISA at 1:1562500. UBE2E2 APPLICATIONS: antibody can be used for detection of UBE2E2 by western blot at 0.125 μg/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. POSITIVE CONTROL: 1) Cat. No. 1205 - Jurkat Cell Lysate PREDICTED MOLECULAR 22 kDa WEIGHT: Properties PURIFICATION: Antibody is purified by peptide affinity chromatography method. CLONALITY: Polyclonal CONJUGATE: Unconjugated PHYSICAL STATE: Liquid Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% BUFFER: sucrose. CONCENTRATION: batch dependent For short periods of storage (days) store at 4˚C. For longer periods of storage, store STORAGE CONDITIONS: UBE2E2 antibody at -20˚C. As with any antibody avoid repeat freeze-thaw cycles.
    [Show full text]
  • Regulation of Canonical Wnt Signalling by the Ciliopathy Protein MKS1 and the E2
    bioRxiv preprint doi: https://doi.org/10.1101/2020.01.08.897959; this version posted March 28, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Regulation of canonical Wnt signalling by the ciliopathy protein MKS1 and the E2 ubiquitin-conjugating enzyme UBE2E1. Katarzyna Szymanska1, Karsten Boldt2, Clare V. Logan1, Matthew Adams1, Philip A. Robinson1+, Marius Ueffing2, Elton Zeqiraj3, Gabrielle Wheway1,4#, Colin A. Johnson1#* *corresponding author: [email protected] ORCID: 0000-0002-2979-8234 # joint last authors + deceased 1 Leeds Institute of Medical Research, School of Medicine, University of Leeds, Leeds, UK 2 Institute of Ophthalmic Research, Center for Ophthalmology, University of Tübingen, Tübingen, Germany 3 Astbury Centre for Structural Molecular Biology, School of Molecular and Cellular Biology, Faculty of Biological Sciences, University of Leeds, Leeds, UK 4 Faculty of Medicine, University of Southampton, Human Development and Health, UK; University Hospital Southampton NHS Foundation Trust, UK 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.01.08.897959; this version posted March 28, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract A functional primary cilium is essential for normal and regulated signalling. Primary ciliary defects cause a group of developmental conditions known as ciliopathies, but the precise mechanisms of signal regulation by the cilium remain unclear.
    [Show full text]
  • A Systematic Analysis of Nuclear Heat Shock Protein 90 (Hsp90) Reveals A
    Max Planck Institute of Immunobiology und Epigenetics Freiburg im Breisgau A systematic analysis of nuclear Heat Shock Protein 90 (Hsp90) reveals a novel transcriptional regulatory role mediated by its interaction with Host Cell Factor-1 (HCF-1) Inaugural-Dissertation to obtain the Doctoral Degree Faculty of Biology, Albert-Ludwigs-Universität Freiburg im Breisgau presented by Aneliya Antonova born in Bulgaria Freiburg im Breisgau, Germany March 2019 Dekanin: Prof. Dr. Wolfgang Driever Promotionsvorsitzender: Prof. Dr. Andreas Hiltbrunner Betreuer der Arbeit: Referent: Dr. Ritwick Sawarkar Koreferent: Prof. Dr. Rudolf Grosschedl Drittprüfer: Prof. Dr. Andreas Hecht Datum der mündlichen Prüfung: 27.05.2019 ii AFFIDAVIT I herewith declare that I have prepared the present work without any unallowed help from third parties and without the use of any aids beyond those given. All data and concepts taken either directly or indirectly from other sources are so indicated along with a notation of the source. In particular I have not made use of any paid assistance from exchange or consulting services (doctoral degree advisors or other persons). No one has received remuneration from me either directly or indirectly for work which is related to the content of the present dissertation. The work has not been submitted in this country or abroad to any other examination board in this or similar form. The provisions of the doctoral degree examination procedure of the faculty of Biology of the University of Freiburg are known to me. In particular I am aware that before the awarding of the final doctoral degree I am not entitled to use the title of Dr.
    [Show full text]
  • The UBE2L3 Ubiquitin Conjugating Enzyme: Interplay with Inflammasome Signalling and Bacterial Ubiquitin Ligases
    The UBE2L3 ubiquitin conjugating enzyme: interplay with inflammasome signalling and bacterial ubiquitin ligases Matthew James George Eldridge 2018 Imperial College London Department of Medicine Submitted to Imperial College London for the degree of Doctor of Philosophy 1 Abstract Inflammasome-controlled immune responses such as IL-1β release and pyroptosis play key roles in antimicrobial immunity and are heavily implicated in multiple hereditary autoimmune diseases. Despite extensive knowledge of the mechanisms regulating inflammasome activation, many downstream responses remain poorly understood or uncharacterised. The cysteine protease caspase-1 is the executor of inflammasome responses, therefore identifying and characterising its substrates is vital for better understanding of inflammasome-mediated effector mechanisms. Using unbiased proteomics, the Shenoy grouped identified the ubiquitin conjugating enzyme UBE2L3 as a target of caspase-1. In this work, I have confirmed UBE2L3 as an indirect target of caspase-1 and characterised its role in inflammasomes-mediated immune responses. I show that UBE2L3 functions in the negative regulation of cellular pro-IL-1 via the ubiquitin- proteasome system. Following inflammatory stimuli, UBE2L3 assists in the ubiquitylation and degradation of newly produced pro-IL-1. However, in response to caspase-1 activation, UBE2L3 is itself targeted for degradation by the proteasome in a caspase-1-dependent manner, thereby liberating an additional pool of IL-1 which may be processed and released. UBE2L3 therefore acts a molecular rheostat, conferring caspase-1 an additional level of control over this potent cytokine, ensuring that it is efficiently secreted only in appropriate circumstances. These findings on UBE2L3 have implications for IL-1- driven pathology in hereditary fever syndromes, and autoinflammatory conditions associated with UBE2L3 polymorphisms.
    [Show full text]
  • Deubiquitylases in Developmental Ubiquitin Signaling and Congenital Diseases
    Cell Death & Differentiation (2021) 28:538–556 https://doi.org/10.1038/s41418-020-00697-5 REVIEW ARTICLE Deubiquitylases in developmental ubiquitin signaling and congenital diseases 1 1,2 1 Mohammed A. Basar ● David B. Beck ● Achim Werner Received: 16 October 2020 / Revised: 20 November 2020 / Accepted: 24 November 2020 / Published online: 17 December 2020 This is a U.S. government work and not under copyright protection in the U.S.; foreign copyright protection may apply 2020 Abstract Metazoan development from a one-cell zygote to a fully formed organism requires complex cellular differentiation and communication pathways. To coordinate these processes, embryos frequently encode signaling information with the small protein modifier ubiquitin, which is typically attached to lysine residues within substrates. During ubiquitin signaling, a three-step enzymatic cascade modifies specific substrates with topologically unique ubiquitin modifications, which mediate changes in the substrate’s stability, activity, localization, or interacting proteins. Ubiquitin signaling is critically regulated by deubiquitylases (DUBs), a class of ~100 human enzymes that oppose the conjugation of ubiquitin. DUBs control many essential cellular functions and various aspects of human physiology and development. Recent genetic studies have fi 1234567890();,: 1234567890();,: identi ed mutations in several DUBs that cause developmental disorders. Here we review principles controlling DUB activity and substrate recruitment that allow these enzymes to regulate ubiquitin signaling during development. We summarize key mechanisms of how DUBs control embryonic and postnatal differentiation processes, highlight developmental disorders that are caused by mutations in particular DUB members, and describe our current understanding of how these mutations disrupt development. Finally, we discuss how emerging tools from human disease genetics will enable the identification and study of novel congenital disease-causing DUBs.
    [Show full text]
  • Characterization of the Cellular Network of Ubiquitin Conjugating and Ligating Enzymes Ewa Katarzyna Blaszczak
    Characterization of the cellular network of ubiquitin conjugating and ligating enzymes Ewa Katarzyna Blaszczak To cite this version: Ewa Katarzyna Blaszczak. Characterization of the cellular network of ubiquitin conjugating and ligating enzymes. Cellular Biology. Université Rennes 1, 2015. English. NNT : 2015REN1S116. tel-01547616 HAL Id: tel-01547616 https://tel.archives-ouvertes.fr/tel-01547616 Submitted on 27 Jun 2017 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. ANNÉE 2015 THÈSE / UNIVERSITÉ DE RENNES 1 sous le sceau de l’Université Européenne de Bretagne pour le grade de DOCTEUR DE L’UNIVERSITÉ DE RENNES 1 Mention : BIOLOGIE École doctorale Vie-Agro-Santé présentée par Ewa Katarzyna Blaszczak Préparée à l’unité de recherche UMR 6290, IGDR Institut de Génétique et Développement de Rennes Université Rennes 1 Thèse soutenue à Rennes le 26.06.2015 Characterization of devant le jury composé de : Aude ECHALIER-GLAZER the cellular network Maître de conférence University of Leicester / rapporteur of ubiquitin Lionel PINTARD Directeur de recherche
    [Show full text]
  • Ube1a Suppresses Herpes Simplex Virus-1 Replication
    viruses Article UBE1a Suppresses Herpes Simplex Virus-1 Replication Marina Ikeda 1 , Akihiro Ito 2, Yuichi Sekine 1 and Masahiro Fujimuro 1,* 1 Department of Cell Biology, Kyoto Pharmaceutical University, Kyoto 607-8412, Japan; [email protected] (M.I.); [email protected] (Y.S.) 2 Laboratory of Cell Signaling, School of Life Sciences, Tokyo University of Pharmacy and Life Sciences, Tokyo 192-0392, Japan; [email protected] * Correspondence: [email protected]; Tel.: +81-75-595-4717 Academic Editors: Magdalena Weidner-Glunde and Andrea Lipi´nska Received: 7 November 2020; Accepted: 1 December 2020; Published: 4 December 2020 Abstract: Herpes simplex virus-1 (HSV-1) is the causative agent of cold sores, keratitis, meningitis, and encephalitis. HSV-1-encoded ICP5, the major capsid protein, is essential for capsid assembly during viral replication. Ubiquitination is a post-translational modification that plays a critical role in the regulation of cellular events such as proteasomal degradation, protein trafficking, and the antiviral response and viral events such as the establishment of infection and viral replication. Ub-activating enzyme (E1, also named UBE1) is involved in the first step in the ubiquitination. However, it is still unknown whether UBE1 contributes to viral infection or the cellular antiviral response. Here, we found that UBE1a suppressed HSV-1 replication and contributed to the antiviral response. The UBE1a inhibitor PYR-41 increased HSV-1 production. Immunofluorescence analysis revealed that UBE1a highly expressing cells presented low ICP5 expression, and vice versa. UBE1a inhibition by PYR-41 and shRNA increased ICP5 expression in HSV-1-infected cells.
    [Show full text]