DOCSLIB.ORG

Global Journal of Human Social Science but It Is Still Very Difficult to Implement in School Practice

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Global Journal of Human Social Science but It Is Still Very Difficult to Implement in School Practice Online ISSN: 2249-460X Print ISSN: 0975-587X DOI: 10.17406/GJHSS TheStateofOutside-The-School RealEstateMarketPrices&Floods NatureEthics,Life,Purity&Ontology TheCaseofDowntownBudapestSchools VOLUME20ISSUE4VERSION1.0 Global Journal of Human-Social Science: B Geography, Geo-Sciences, Environmental Science & Disaster Management Global Journal of Human-Social Science: B Geography, Geo-Sciences, Environmental Science & Disaster Management Volume 2 0 Issue 4 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2020. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Global Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU Packaging & Continental Dispatching FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG Global Journals Pvt Ltd (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ E-3130 Sudama Nagar, Near Gopur Square, ULVN Indore, M.P., Pin:452009, India 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG Find a correspondence nodal officer near you &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ To find nodal officer of your country, please email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH eContacts UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI Press Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG Investor Inquiries: [email protected] RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Technical Support: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Media & Releases: [email protected] Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 Pricing (E xcluding Air Parcel Charges): Employer Identification Number (EIN): USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional) 250 USD (B/W) & 350 USD (Color) Editorial Board Global Journal of Human-Social Science Dr. Heying Jenny Zhan Dr. Adrian Armstrong B.A., M.A., Ph.D. Sociology, University of Kansas, USA BSc Geography, LSE, 1970 Ph.D. Geography Department of Sociology Georgia State University, (Geomorphology) Kings College London 1980 Ordained United States Priest, Church of England 1988 Taunton, Somerset, United Kingdom Dr. Prasad V Bidarkota Dr. Gisela Steins Ph.D., Department of Economics Florida International Ph.D. Psychology, University of Bielefeld, Germany University United States Professor, General and Social Psychology, University of Duisburg-Essen, Germany Dr. Alis Puteh Dr. Stephen E. Haggerty Ph.D. (Edu.Policy) UUM Sintok, Kedah, Malaysia M.Ed Ph.D. Geology & Geophysics, University of London (Curr. & Inst.) University of Houston, United States Associate Professor University of Massachusetts, United States Dr. André Luiz Pinto Dr. Helmut Digel Doctorate in Geology, PhD in Geosciences and Ph.D. University of Tbingen, Germany Honorary President Environment, Universidade Estadual Paulista Julio of German Athletic Federation (DLV), Germany de Mesuita Filho, UNESP, Sao Paulo, Brazil Dr. Tanyawat Khampa Dr. Hamada Hassanein Ph.d in Candidate (Social Development), MA. in Social Ph.D, MA in Linguistics, BA & Education in English, Development, BS. in Sociology and Anthropology, Department of English, Faculty of Education, Mansoura Naresuan University, Thailand University, Mansoura, Egypt Dr. Gomez-Piqueras, Pedro Dr. Asuncin Lpez-Varela Ph.D in Sport Sciences, University Castilla La Mancha, BA, MA (Hons), Ph.D. (Hons) Facultad de Filolog?a. Spain Universidad Complutense Madrid 29040 Madrid Spain Dr. Faisal G. Khamis Dr. Mohammed Nasser Al-Suqri Ph.D in Statistics, Faculty of Economics & Ph.D., M.S., B.A in Library and Information Management, Administrative Sciences / AL-Zaytoonah University of Sultan Qaboos University, Oman Jordan, Jordan Dr. Giaime Berti Dr. Vesna Stankovic Pejnovic Ph.D. School of Economics and Management University Ph. D. Philosophy Zagreb, Croatia Rusveltova, Skopje of Florence, Italy Macedonia Dr. Valerie Zawilski Dr. Raymond K. H. Chan Associate Professor, Ph.D., University of Toronto MA - Ph.D., Sociology, University of Essex, UK Associate Ontario Institute for Studies in Education, Canada Professor City University of Hong Kong, China Dr. Edward C. Hoang Dr. Tao Yang Ph.D., Department of Economics, University of Ohio State University M.S. Kansas State University B.E. Colorado United States Zhejiang University, China Dr. Intakhab Alam Khan Mr. Rahul Bhanubhai Chauhan Ph.D. in Doctorate of Philosophy in Education, King B.com., M.com., MBA, PhD (Pursuing), Assistant Professor, Abdul Aziz University, Saudi Arabia Parul Institute of Business Administration, Parul University, Baroda, India Dr. Kaneko Mamoru Dr. Rita Mano Ph.D., Tokyo Institute of Technology Structural Ph.D. Rand Corporation and University of California, Los Engineering Faculty of Political Science and Economics, Angeles, USA Dep. of Human Services, University of Haifa Waseda University, Tokyo, Japan Israel Dr. Joaquin Linne Dr. Cosimo Magazzino Ph. D in Social Sciences, University of Buenos Aires, Aggregate Professor, Roma Tre University Rome, 00145, Argentina Italy Dr. Hugo Nami Dr. S.R. Adlin Asha Johnson Ph.D.in Anthropological Sciences, Universidad of Ph.D, M. Phil., M. A., B. A in English Literature, Bharathiar Buenos Aires, Argentina, University of Buenos Aires, University, Coimbatore, India Argentina Dr. Luisa dall’Acqua Dr. Thierry Feuillet Ph.D. in Sociology (Decisional Risk sector), Master MU2, Ph.D in Geomorphology, Master’s Degree in College Teacher, in Philosophy (Italy), Edu-Research Geomorphology, University of Nantes, France Group, Zrich/Lugano Contents of the Issue i. Copyright Notice ii. Editorial Board Members iii. Chief Author and Dean iv. Contents of the Issue 1. Do Children go to Field? - The State of Outside-the-School Environmental Education in the Case of Downtown Budapest Schools. 1-9 2. Real Estate Market Prices and Floods in Rio Do Sul (Santa Catarina, Brasil): Evidences of Correlations under a Territorial Perspective. 11-26 3. Ecopoetics in Thoreau: Nature Ethics, Life, Purity and Ontology. 27-34 4. Glaucomatous Process in Conditions of Sharply Continental Climate: Chronobiological Clinical Features and Forecasting Issues. 35-37 v. Fellows vi. Auxiliary Memberships vii. Preferred Author Guidelines viii. Index Global Journal of HUMAN-SOCIAL SCIENCE: B Geography, Geo-Sciences, Environmental Science & Disaster Management Volume 20 Issue 4 Version 1.0 Year 2020 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Do Children go to Field? - The State of Outside-the-School Environmental Education in the Case of Downtown Budapest Schools By Szőcs Levente Álmos, Angyal Zsuzsanna & Varga Attila Eötvös Loránd University Abstract- In the rapidly evolving world of the 21st century, scientific knowledge is becoming more and more valuable. Today’s engineering and technological developments are inconceivable without specialists with excellent scientific knowledge. But how can today’s young people be interested in science? In our opinion, this is no longer possible with traditional methods, practice- oriented experiential pedagogy is needed for this, preferably in a natural environment. But what can a downtown school do if it wants to hold a science class outside the school building? We are looking for the answer to this in our study. Keywords: out-of-school teaching, downtown schools, science, environmental education. GJHSS-B Classification: FOR Code: 040699 DoChildrengotoFieldTheStateofOutsidetheSchoolEnvironmentalEducationintheCaseofDowntownBudapestSchools Strictly as per the compliance and regulations of: © 2020. Szőcs Levente Álmos, Angyal Zsuzsanna & Varga Attila. This is a research/ review paper, distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License http://creativecommons.org/licenses/by-nc/3.0/), permitting all non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. Do Children go to Field? - The State of Outside- the-School Environmental Education in the Case of Downtown Budapest Schools α σ ρ Szőcs Levente Álmos , Angyal Zsuzsanna & Varga Attila Abstract - In the rapidly evolving world of the 21st century, schools and their teachers?
Load more

Recommended publications
  • Kate Galloway 274 Court St
    Kate Galloway 274 Court St. Apt. 104, Middletown, CT 06457 Mobile: (959) 888-2803; E-Mail: [email protected] Wesleyan University, Department of Music Website: https://wesleyan.academia.edu/KateGalloway EMPLOYMENT Visiting Assistant Professor 2016-2019 Wesleyan University, Department of Music, Middletown, CT Postdoctoral Research Fellow and Adjunct Assistant Professor 2012-2016 Memorial University of Newfoundland, St. John’s, NL School of Music and the Research Centre for the Study of Music, Media and Place (MMaP) Funded by the Social Sciences and Humanities Research Council of Canada (SSHRC) Postdoctoral Fellowship and Insight Development Grant, 2012 SSHRC Postdoctoral Prize awarded to the most outstanding SSHRC Postdoctoral award recipient Sessional Assistant Professor University of Western Ontario, Faculty of Music, London, ON 2012 Sessional Assistant Professor University of Guelph, School of Fine Art & Music, Guelph, ON 2010-2012 Sessional Assistant Professor Wilfrid Laurier University, Faculty of Music, Waterloo, ON 2011 Graduate Teaching Assistant and Instructor of Record University of Toronto, Faculty of Music and University of Toronto ScarborouGh Campus, Department of Visual and PerforminG Arts & Department of the Humanities, Toronto, ON 2003-2010 EDUCATION Doctor of Philosophy, Musicology/Ethnomusicology University of Toronto, Faculty of Music, Toronto, ON 2010 “Sounding Nature, Sounding Place”: Alternative Performance Spaces, Participatory Experience, and Ritual Performance in R. Murray Schafer’s Patria Cycle” Master of
    [Show full text]
  • The Concept Master Plan
    ACKNOWLEDGEMENTS Acknowledgements The Columbia Land Conservancy is very pleased Hudson to our 714-acre Greenport Public Conserva- to present this Concept Master Plan for the North Bay tion Area – all within a short walk or bicycle ride Recreation and Natural Area. The vision presented from the County’s most densely populated residential here includes a particularly exciting combination of district, we were only too glad to take it on. This, features that go to the heart of our work. truly, is a great conservation project that strengthens connections between people and the land. We are a conservation organization, and we are fortunate to work in a county that is uniquely rich in We recognize that the information presented here lands that are high in conservation value – farmland, is nothing more than an idea – a well developed idea, forests, wildlife habitat, sensitive ecosystems and sce- to be sure, but in the end, a concept. It will be up to nic landscapes, very prominently including the lands City of Hudson and Columbia County officials to and ecosystems along the mighty Hudson River. But decide whether and how to implement it. CLC would at CLC our work with people and communities has welcome the opportunity to partner in the project always been equally important as our work with the and to assist in the search for funding or in any other land. Thus, when presented with an opportunity to capacity if and as they move forward, which we develop a plan that would at once restore a riverfront earnestly hope they will do.
    [Show full text]
  • Grassy Hollow Trail Guide
    California State University, San Bernardino CSUSB ScholarWorks Theses Digitization Project John M. Pfau Library 2008 Grassy hollow trail guide Judy Ann Eindboden Follow this and additional works at: https://scholarworks.lib.csusb.edu/etd-project Part of the Outdoor Education Commons Recommended Citation Eindboden, Judy Ann, "Grassy hollow trail guide" (2008). Theses Digitization Project. 3376. https://scholarworks.lib.csusb.edu/etd-project/3376 This Project is brought to you for free and open access by the John M. Pfau Library at CSUSB ScholarWorks. It has been accepted for inclusion in Theses Digitization Project by an authorized administrator of CSUSB ScholarWorks. For more information, please contact [email protected]. GRASSY HOLLOW TRAIL GUIDE A Project Presented to the Faculty of California State University, San Bernardino In Partial Fulfillment of the Requirements for the Degree Master of Arts in Education: Environmental Education by Judy Ann Einboden June 2008 GRASSY HOLLOW TRAIL GUIDE A Project Presented to the Faculty of California State University, San Bernardino by Judy Ann Einboden June 2008 Approved by: Dr. Darleen Stoner, First Reader Dr. Gai/y Negin, ABSTRACT The Grassy Hollow Trail Guide was designed for use at the Grassy Hollow Visitor Center, located six miles west of Wrightwood, California, in the San Gabriel Mountains in the Angeles National Forest. The guide is intended to■ enable volunteers of the United States Forest Service and primary teachers from the Snowline Unified School District to utilize the educational opportunities available at this location with kindergarten through second grade students. A map and instructions in the guide provide activities for students which promote environmental sensitivity using constructivism and place-based education at 12 stops on a nature hike which follows a portion of the Pacific Crest Trail.
    [Show full text]
  • Squatting My Mind – Towards an Architectural Ecosophy
    163 ISSN: 1755-068 www.field-journal.org vol.4 (1) Squatting My Mind – Towards an Architectural Ecosophy Catharina Gabrielsson Understanding ecology as “a widely-drawn category that encompasses objects and ideas, organic species and their habitats, inseparably linked 1 Andrew Ballantyne, Architecture together”,1 ecology clearly involves architecture on countless levels, by far Theory: a Reader in Philosophy and Culture (London, New York: exceeding the parameters of sustainable building technology that dominate Continuum, 2005) p. 36. conceptions of this field. Primarily addressing the ‘mental ecology’ of architecture – that is, how architecture is thought and constructed within the discipline – this article furthers an understanding of how occupancy has the power to undo central architectural concepts. Such an undoing is seen as a prerequisite for what Félix Guattari has denoted ecosophy – the ethico-political articulation between the three, interconnected ecological registers: that of the environment, of social relations and the realm of ideas. Considered within an ecological intellectual framework, notions of resistance, spatial appropriation and indeterminacy in architecture are seen to evolve as steps along the way in the urgent task of re-writing architecture’s ontology. It points towards an architecture of shifts and additions, of re-uses and re-inventions; an architecture that generously permits a variety of uses and a continuous production of meaning. 164 www.field-journal.org vol.4 (1) Fig 1. Squatters make the headlines. Catharina Gabrielsson. Shortly after the financial crisis struck London in the autumn of 2008, newspapers were flooded with reports on how a group of artists had invaded an empty eighteenth century property in Mayfair and had opened it to the public as a “non-hierarchical centre for knowledge and learning”, called ‘Temporary School of Thought.’ During a few winter months, in a neighbourhood dominated by embassies and offices, the house at No.
    [Show full text]
  • Materializing Transversal Potential: an Ecosophical Analysis of The
    Spivak, G. (1987). Subaltern studies: Deconstructing historiography. Chap. in Materializing Transversal Potential: An Ecosophical G. Spivak, In Other Worlds (pp. 197-221). NY: Routledge. Analysis of the Dissensual Aestheticization of a Decom- Spyrou, S. (2002). Images of ‘the Other’: The Turk’ in Greek Cypriot children’s missioned Missile Base imagination. Race, Ethnicity and Education, 5 (3), 252-272. Cala Coats Ph.D.1 Stephen F. Austin State University Sivertsen, M. L. (1994). How teachers’ beliefs about learners, the teacher’s role and subject matter shape classroom instruction. Washington, D. C.: Office of Research, U.S. ABstraCT Department of Education. In this article, the researcher maps the collective aesthetic practices of a com- Tamir, T. (2006). Painting against the current. In G. Bar Or (Ed.), Ruth Schloss: munity of makers who have transformed a decommissioned missile base into Local Testimony (pp. xxxiii- lxxxi). Tel Aviv, Israel: Museum of Ein Harod. a residence and community space. The site of the missile base is framed as an assemblage of physical and temporal universes mixed and layered, where its Woolf, V. (1929), A room of one’s own. Retrieved from http://ebooks.adelaide. previous uses and occupation have formed a subjective residue that expresses edu.au/w/woolf/virginia/w91r/index.html. itself physically via objects and architecture and mentally through a kind of col- lective memory inscribed in the site. Félix Guattari’s (1992/1995) ecosophical approach to analysis is used to consider how subjectivity is produced through collective aesthetic practices, fo- cusing on the potential of bringing communities together through anti-capitalist exchanges of time and skill.
    [Show full text]
  • Nez Perce (Nee-Me-Poo) National Historic Trail Progress Report
    United States Department of Agriculture Nez Perce (Nee-Me-Poo) National Historic Trail Progress Report Fall 2019 Administrator ’s Corner I asked our partners why they felt so passionately about our work. They said that they learned more about the Nez Perce (Nee-Me-Poo) National Historic Trail (NPNHT) and Nez Perce culture in our interpretative and educational materials than they did in all their years in school. I totally agreed. Through our posters, desk planners, interpretive signs, brochures, website, videos, presentations, and progress reports our work is designed to give people today and future generations a broader and more holistic understanding of the history and living culture of our treasured NPNHT. Our educational outreach connects with thousands of students, teachers, longtime residents, tribal youth, visitors, and people from countries outside the United States every year. Our work together is just beginning! We are looking forward to another year of excitement and discovery on the Trail and Auto Tour Route. This means our ambitious plans for the federal fiscal year can be a reality with your continued support. Thank you for recognizing your own legacy- U.S. Forest Service photo U.S. Forest Service “The NPNHT.” You are a part of our goal of being a part of this Sandra Broncheau-McFarland, at important generational change. By working together we will be Smoking Place, along the NPNHT and successful when people like you take action to volunteer and become our Lolo Trails. partners. Your feedback helps ensure that the Trail and Auto Tour Route continues to be yours. Give us a call, send an email, or stop by our offices; we would enjoy hearing from you.
    [Show full text]
  • Introducing Light Pollution Through Nature Trails
    Vol. 10, No. 3, 2020 pp. 129-146 http://doi.org/10.24368/jates.v10i3.192 18 129 Journal of Applied Technical and Educational Sciences jATES ISSN 2560-5429 http://jates.org Introducing light pollution through nature trails Éva Fodor a aEszterházy Károly University, 3300 Eger, Eszterházy square 1., [email protected] Abstract This study aims to present possible options for introducing light pollution through nature trails to the citizens. The first part of the study grants a general introduction about light pollution by explaining the concept, forms and sources of the phenomenon; as well as by describing possible ways of its reduction and prevention. The second part gives a summary about nature trails, based on general and certain special characteristics of the facilities. The goal of the third part is twofold: presenting possible ways of introducing light pollution through nature trails, as well as examining the different types of trails that might be appropriate for introducing the topic to the visitors. Keywords: environmental education; light pollution; nature trail. 1. Introduction Light pollution is considered as one of the least noticeable, but at the same time the most widespread environmental hazard caused by human acts (Sciezor, 2019). It is a serious international concern: according to the World Atlas of Artificial Night Sky Brightness (2016) 80 percent of the world’s population lives under skyglow, which prevents people from experiencing a natural night (https://www.darksky.org/light-pollution/). Based on the aforementioned facts, it is important to inform citizens about the complex phenomenon and reduction of light pollution.
    [Show full text]
  • Lincoln In-Town Trails Plan
    Lincoln In-Town Trails Plan July 2018 Lincoln In-Town Trails Plan July 2018 Students learn about Tree Circus at Sculpture in the Wild, photo by Caleb Fey Cover photo: The Blackfoot River, photo by Chris Gibisch The Trust for Public Land Blackfoot Challenge 1007 East Main St., Suite 300 405 Main St. Bozeman, MT 59715 Ovando, MT 59854 406-522-7450 406-793-3900 tpl.org blackfootchallenge.org 2 Lincoln In-Town Trails Plan Table of Contents 4 Preface 5 Introduction Lincoln, Montana Lincoln In-Town Trails Plan Trail Benefits 8 Purpose Vision Statement 9 Public Input Envision Lincoln 2018 Survey 2018 Workshops 11 Proposed Trails Types of Trails Field Verification Trail Prioritization Highway 200 Pedestrian Crossings 15 Implementation Trail Development Constraints Education Funding 18 Action Plan 21 Conclusion 24 Appendix 1. Lincoln In-Town Trails Plan Participants 26 Appendix 2. Summary of the 2018 Lincoln In-Town Trails Plan Community Survey 31 Appendix 3. Funding for Trails Lincoln In-Town Trails Plan 3 1. Preface ACKNOWLEDGMENTS PROJECT PartNERS THE LINCOLN IN-TOWN Trails Plan (Trails Plan) The Trust for Public Land is a national non- was made possible with generous support from profit organization dedicated to creating parks the LOR Foundation, Blackfoot Challenge, and and protecting land for people, ensuring healthy, The Trust for Public Land. More than a hundred livable communities for generations to come. people participated in the Lincoln community trail survey. In addition, more than 25 people Blackfoot Challenge coordinates efforts that committed their valuable time to Trails Plan conserve and enhance natural resources and the workshops, and 15 provided local knowledge rural way of life in the Blackfoot watershed for and expertise to the trails plan steering commit- present and future generations.
    [Show full text]
  • 2010-Youth-Programs-On-The-National
    Outreach, Leadership, & Career Development: Youth Programs on the National Trails System 2010 An overview of programs and partnerships engaging youth in trails stewardship, historical interpretation, and conservation initiatives. Compiled by the Partnership for the National Trails System with the assistance of trail stewardship organizations, the National Park Service, the US Forest Service, and the Bureau of Land Management. Youth Programs on the National Trails System A Glance at Outreach, Employment, and Volunteer Programs for Youth on the National Trails System Published by the Partnership Much has been written about and discussed in recent years about the for the National Trails System alienation of American youth and young adults from nature. Author Richard Louv 222 S. Hamilton Street #13 compellingly described t the growing problem and coined the term “nature deficit disorder.” Madison, WI 53703 With the great majority of Americans living in cities and automobile-dominated suburbs, fewer www.pnts.org opportunities exist for today’s youth to directly experience and explore the natural world than there were for earlier generations. Public agencies and private organizations are mounting heroic efforts A special thanks to our to try to connect the younger generations to the outdoors. federal partners: America’s National Scenic and Historic Trails provide countless opportunities for children and youth NPS, BLM, USFS, USFWS, to experience the beauty, wonder, and mystery of our American landscapes. Young people can and the FHWA, imagine and feel the drama, struggles, and discoveries of the Native Americans, explorers, traders, for their dedication to and immigrants as they traversed the continent on foot, by boat or by real horsepower, and better youth programming understand the quilt of many cultures that comprise our country.
    [Show full text]
  • 0832-6193 an Ecophilosophy Approach, the Deep Ecology Move- Ment and Diverse Ecosophies
    Trumpeter (1997) ISSN: 0832-6193 An Ecophilosophy Approach, the Deep Ecology Move- ment and Diverse Ecosophies Alan Rike Drengson Trumpeter An Ecophilosophy Approach, the Deep Ecology Movement and Diverse Ecosophies 2 FRANK TROCCO was an expedition guide and director for 38 semesters with the National Audubon Society Expedition Insti- tute. Currently working on a Ph.D. in the Social Studies of Sci- ence, he teaches science at Lesley College and Vermont College. The Trumpeter's mission is to pursue and present ecosophies. "Ecosophy" was introduced by Arne Naess in 1972 in an ecophilosophy talk given at a conference in Eastern Europe on the future of research. He coined the word from two ancient Greek roots, ecos - meaning home place, and sophia - meaning wisdom. Naess used the term to refer to any articulated philosophy of life in harmony with ecocentric values. Pursuing an ecosophy is searching for ecologically wise and harmonious living. There are multitudes of diverse ecosophies. Ecosophies are often elaborated through an existing ultimate philosophy such as Buddhism or Taoism, or they can be premised on pure normative principles and elaborated through philosophical analysis. Naess calls his own ecosophy, Ecosophy T. It is deeply influenced by Norwegian friluftsliv (a movement to experience living in the outdoors, see Trumpeter, Spr 97, p. 93f), Gandhian nonviolence, Mahayana Buddhism and Spinozan pantheism. The T stands for Tvergastein, Naess' mountain hut in Norway, where much of Ecosophy T was worked out. A basic norm in Naess' Ecosophy T is self realization! - for all beings. In his ecophilosophy framework for cross cultural analysis of grass roots social- political movements, Naess distinguishes between four levels of discourse (see the chart below).
    [Show full text]
  • Nez Perce (Nee-Me-Poo) National Historic Trail Progress Report Winter 2018
    United States Department of Agriculture Nez Perce (Nee-Me-Poo) National Historic Trail Progress Report Winter 2018 Administrator’s Corner Greetings, The Nez Perce (Nee-Me-Poo) National Historic Trail (NPNHT) belongs to each of us. With use comes a responsibility to care for your Trail. How will you exercise that responsibility? As a Friend of the Trail, we’ll show you how. Become a Friend at www.fs.usda.gov/npnht. McFarland McFarland Join the many volunteers who play a part in helping to care for the - Trail…everyday, if you are one of those who love to hike, camp, ski, hunt, fish, or paddle, we invite you to stay informed and get involved. The experiences of the NPNHT and Auto Tour Route are not-to-be- missed. Cold weather and your favorite segment of the Trail and Auto Tour Broncheau of Sandra Courtesy Photo Route beckon on a winter day. Heed the call, yes, and go prepared Sandra Broncheau-McFarland on the left not only with the proper clothing and gear but also with the proper at the recent Renegades Celebration and knowledge. Remember, one needs at least as much fluid in winter as Pow Wow in Lapwai, ID. in summer. One should preferably drink water to stay hydrated and warm in the winter. During the past year, the programs, events, and trail work have enriched the lives of many school children and hundreds of community members, through meaningful and engaging exhibits, open houses, and youth programs. You can read more about these activates in this and past Progress Reports.
    [Show full text]
  • Lara M. Browning College of Architecture Clemson University [email protected] 3-108 Lee Hall, Clemson, SC 29634 423.737.3517 (P) 864.656.1810 (F)
    Lara M. Browning College of Architecture Clemson University [email protected] 3-108 Lee Hall, Clemson, SC 29634 423.737.3517 (P) 864.656.1810 (F) EDUCATION Master of Landscape Architecture University of Georgia, 2010 California State Polytechnic University, 2006- 2007 MLA student. Coursework at John T. Lyle Center for Regenerative Studies. Cumulative units: 62.00. UC Berkeley Extension, 2004-2005 Coursework: Fundamentals of Drawing I, Spring Plants and their Applications, Introduction to Landscape Architecture. Bachelor of Arts in Environmental Studies Wellesley College, 2004 Graduated Cum Laude. James Cook University, Spring 2003 Study abroad in Cairns, Australia. Coursework: Environmental & Regional Planning, Environmental Chemistry, Environmental Law & Policy. Studied indigenous methods of rainforest conservation under an Aboriginal tribe. Universidad de Córdoba, Fall 2002 Study abroad in Córdoba, Spain. PRESCHO program. Coursework in Spanish. Assisted in hydrotherapy for children with Cerebral Palsy. Marista Dom Silverio, 1999- 2000 High School Exchange Student in Belo Horizonte, Brazil. Coursework in Portuguese. ACADEMIC EXPERIENCE Clemson University School of Architecture, 2019- Present Landscape Architecture Program Lecturer University of Illinois at Champaign-Urbana College of Applied Health Sciences, 2015- 2019 Department of Recreation, Sport, and Tourism Lecturer and Landscape Designer for the Office of Recreation and Park Resources Virginia Tech College of Architecture and Urban Studies, 2012- 2015 Community Design Assistance Center Project Associate Managed the projects of Virginia Tech’s College of Architecture and Urban Studies’ outreach program. Oversaw student teams in research, community engagement, and interdisciplinary design that promotes healthy living in communities within Virginia, Kentucky, Tennessee, and North Carolina (i.e. park and open space planning, greenways, trails, recreational areas, sports complexes, community branding, eco-tourism development, and interpretive signage).
    [Show full text]