FBXO24 (Human) Recombinant Protein (P01)

FBXO24 (Human) Recombinant Storage Instruction: Store at -80°C. Aliquot to avoid Protein (P01) repeated freezing and thawing.

Entrez GeneID: 26261 Catalog Number: H00026261-P01

Gene Symbol: FBXO24 Regulation Status: For research use only (RUO)

Gene Alias: DKFZp434I1122, FBX24 Product Description: Human FBXO24 full-length ORF ( NP_277041.1, 1 a.a. - 580 a.a.) recombinant protein with Gene Summary: This gene encodes a member of the GST-tag at N-terminal. F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box Sequence: proteins constitute one of the four subunits of the MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPI ubiquitin protein ligase complex called SCFs SIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGE (SKP1-cullin-F-box), which function in GVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLY phosphorylation-dependent ubiquitination. The F-box FQAFGGRRRCLSKSVAPLLAHGYRRFLPTKDHVFILDY proteins are divided into 3 classes: Fbws containing VGTLFFLKNALVSTLGQMQWKRACRYVVLCRGAKDF WD-40 domains, Fbls containing leucine-rich repeats, ASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCV and Fbxs containing either different protein-protein EVYLQSSGQRVFKMTFHHSMTFKQIVLVGQETQRALL interaction modules or no recognizable motifs. The LLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLP protein encoded by this gene belongs to the Fbxs class. HLRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLF Multiple transcript variants encoding different isoforms GTLQAFDPLDQQMPLALSLPAKILFCALGYNHLGLVDE have been found for this gene. [provided by RefSeq] FGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPI TLWCGLNHSLVLSQSSEFSKELLGCGCGAGGRLPGW PKGSASFVKLQVKVPLCACALCATRECLYILSSHDIEQ HAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACE EYLSQIHSCQTLQDRTEKMKEIVGWMPLMAAQKDFF WEALDMLQRAEGGGGGVGPPAPET

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 91.3

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Page 1/1