FBXO24 (Human) Recombinant Protein (P01)

Total Page:16

File Type:pdf, Size:1020Kb

FBXO24 (Human) Recombinant Protein (P01) FBXO24 (Human) Recombinant Storage Instruction: Store at -80°C. Aliquot to avoid Protein (P01) repeated freezing and thawing. Entrez GeneID: 26261 Catalog Number: H00026261-P01 Gene Symbol: FBXO24 Regulation Status: For research use only (RUO) Gene Alias: DKFZp434I1122, FBX24 Product Description: Human FBXO24 full-length ORF ( NP_277041.1, 1 a.a. - 580 a.a.) recombinant protein with Gene Summary: This gene encodes a member of the GST-tag at N-terminal. F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box Sequence: proteins constitute one of the four subunits of the MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPI ubiquitin protein ligase complex called SCFs SIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGE (SKP1-cullin-F-box), which function in GVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLY phosphorylation-dependent ubiquitination. The F-box FQAFGGRRRCLSKSVAPLLAHGYRRFLPTKDHVFILDY proteins are divided into 3 classes: Fbws containing VGTLFFLKNALVSTLGQMQWKRACRYVVLCRGAKDF WD-40 domains, Fbls containing leucine-rich repeats, ASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCV and Fbxs containing either different protein-protein EVYLQSSGQRVFKMTFHHSMTFKQIVLVGQETQRALL interaction modules or no recognizable motifs. The LLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLP protein encoded by this gene belongs to the Fbxs class. HLRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLF Multiple transcript variants encoding different isoforms GTLQAFDPLDQQMPLALSLPAKILFCALGYNHLGLVDE have been found for this gene. [provided by RefSeq] FGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPI TLWCGLNHSLVLSQSSEFSKELLGCGCGAGGRLPGW PKGSASFVKLQVKVPLCACALCATRECLYILSSHDIEQ HAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACE EYLSQIHSCQTLQDRTEKMKEIVGWMPLMAAQKDFF WEALDMLQRAEGGGGGVGPPAPET Host: Wheat Germ (in vitro) Theoretical MW (kDa): 91.3 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Page 1/1 Powered by TCPDF (www.tcpdf.org).
Recommended publications
  • Dissecting the Genetic Relationship Between Cardiovascular Risk Factors and Alzheimer's Disease
    UC San Diego UC San Diego Previously Published Works Title Dissecting the genetic relationship between cardiovascular risk factors and Alzheimer's disease. Permalink https://escholarship.org/uc/item/7137q6g1 Journal Acta neuropathologica, 137(2) ISSN 0001-6322 Authors Broce, Iris J Tan, Chin Hong Fan, Chun Chieh et al. Publication Date 2019-02-01 DOI 10.1007/s00401-018-1928-6 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Acta Neuropathologica https://doi.org/10.1007/s00401-018-1928-6 ORIGINAL PAPER Dissecting the genetic relationship between cardiovascular risk factors and Alzheimer’s disease Iris J. Broce1 · Chin Hong Tan1,2 · Chun Chieh Fan3 · Iris Jansen4 · Jeanne E. Savage4 · Aree Witoelar5 · Natalie Wen6 · Christopher P. Hess1 · William P. Dillon1 · Christine M. Glastonbury1 · Maria Glymour7 · Jennifer S. Yokoyama8 · Fanny M. Elahi8 · Gil D. Rabinovici8 · Bruce L. Miller8 · Elizabeth C. Mormino9 · Reisa A. Sperling10,11 · David A. Bennett12 · Linda K. McEvoy13 · James B. Brewer13,14,15 · Howard H. Feldman14 · Bradley T. Hyman10 · Margaret Pericak‑Vance16 · Jonathan L. Haines17,18 · Lindsay A. Farrer19,20,21,22,23 · Richard Mayeux24,25,26 · Gerard D. Schellenberg27 · Kristine Yafe7,8,28 · Leo P. Sugrue1 · Anders M. Dale3,13,14 · Danielle Posthuma4 · Ole A. Andreassen5 · Celeste M. Karch6 · Rahul S. Desikan1 Received: 22 September 2018 / Revised: 28 October 2018 / Accepted: 28 October 2018 © Springer-Verlag GmbH Germany, part of Springer Nature 2018 Abstract Cardiovascular (CV)- and lifestyle-associated risk factors (RFs) are increasingly recognized as important for Alzheimer’s disease (AD) pathogenesis. Beyond the ε4 allele of apolipoprotein E (APOE), comparatively little is known about whether CV-associated genes also increase risk for AD.
    [Show full text]
  • A Clinicopathological and Molecular Genetic Analysis of Low-Grade Glioma in Adults
    A CLINICOPATHOLOGICAL AND MOLECULAR GENETIC ANALYSIS OF LOW-GRADE GLIOMA IN ADULTS Presented by ANUSHREE SINGH MSc A thesis submitted in partial fulfilment of the requirements of the University of Wolverhampton for the degree of Doctor of Philosophy Brain Tumour Research Centre Research Institute in Healthcare Sciences Faculty of Science and Engineering University of Wolverhampton November 2014 i DECLARATION This work or any part thereof has not previously been presented in any form to the University or to any other body whether for the purposes of assessment, publication or for any other purpose (unless otherwise indicated). Save for any express acknowledgments, references and/or bibliographies cited in the work, I confirm that the intellectual content of the work is the result of my own efforts and of no other person. The right of Anushree Singh to be identified as author of this work is asserted in accordance with ss.77 and 78 of the Copyright, Designs and Patents Act 1988. At this date copyright is owned by the author. Signature: Anushree Date: 30th November 2014 ii ABSTRACT The aim of the study was to identify molecular markers that can determine progression of low grade glioma. This was done using various approaches such as IDH1 and IDH2 mutation analysis, MGMT methylation analysis, copy number analysis using array comparative genomic hybridisation and identification of differentially expressed miRNAs using miRNA microarray analysis. IDH1 mutation was present at a frequency of 71% in low grade glioma and was identified as an independent marker for improved OS in a multivariate analysis, which confirms the previous findings in low grade glioma studies.
    [Show full text]
  • Greg's Awesome Thesis
    Analysis of alignment error and sitewise constraint in mammalian comparative genomics Gregory Jordan European Bioinformatics Institute University of Cambridge A dissertation submitted for the degree of Doctor of Philosophy November 30, 2011 To my parents, who kept us thinking and playing This dissertation is the result of my own work and includes nothing which is the out- come of work done in collaboration except where specifically indicated in the text and acknowledgements. This dissertation is not substantially the same as any I have submitted for a degree, diploma or other qualification at any other university, and no part has already been, or is currently being submitted for any degree, diploma or other qualification. This dissertation does not exceed the specified length limit of 60,000 words as defined by the Biology Degree Committee. November 30, 2011 Gregory Jordan ii Analysis of alignment error and sitewise constraint in mammalian comparative genomics Summary Gregory Jordan November 30, 2011 Darwin College Insight into the evolution of protein-coding genes can be gained from the use of phylogenetic codon models. Recently sequenced mammalian genomes and powerful analysis methods developed over the past decade provide the potential to globally measure the impact of natural selection on pro- tein sequences at a fine scale. The detection of positive selection in particular is of great interest, with relevance to the study of host-parasite conflicts, immune system evolution and adaptive dif- ferences between species. This thesis examines the performance of methods for detecting positive selection first with a series of simulation experiments, and then with two empirical studies in mammals and primates.
    [Show full text]
  • Human Lectins, Their Carbohydrate Affinities and Where to Find Them
    biomolecules Review Human Lectins, Their Carbohydrate Affinities and Where to Review HumanFind Them Lectins, Their Carbohydrate Affinities and Where to FindCláudia ThemD. Raposo 1,*, André B. Canelas 2 and M. Teresa Barros 1 1, 2 1 Cláudia D. Raposo * , Andr1 é LAQVB. Canelas‐Requimte,and Department M. Teresa of Chemistry, Barros NOVA School of Science and Technology, Universidade NOVA de Lisboa, 2829‐516 Caparica, Portugal; [email protected] 12 GlanbiaLAQV-Requimte,‐AgriChemWhey, Department Lisheen of Chemistry, Mine, Killoran, NOVA Moyne, School E41 of ScienceR622 Co. and Tipperary, Technology, Ireland; canelas‐ [email protected] NOVA de Lisboa, 2829-516 Caparica, Portugal; [email protected] 2* Correspondence:Glanbia-AgriChemWhey, [email protected]; Lisheen Mine, Tel.: Killoran, +351‐212948550 Moyne, E41 R622 Tipperary, Ireland; [email protected] * Correspondence: [email protected]; Tel.: +351-212948550 Abstract: Lectins are a class of proteins responsible for several biological roles such as cell‐cell in‐ Abstract:teractions,Lectins signaling are pathways, a class of and proteins several responsible innate immune for several responses biological against roles pathogens. such as Since cell-cell lec‐ interactions,tins are able signalingto bind to pathways, carbohydrates, and several they can innate be a immuneviable target responses for targeted against drug pathogens. delivery Since sys‐ lectinstems. In are fact, able several to bind lectins to carbohydrates, were approved they by canFood be and a viable Drug targetAdministration for targeted for drugthat purpose. delivery systems.Information In fact, about several specific lectins carbohydrate were approved recognition by Food by andlectin Drug receptors Administration was gathered for that herein, purpose. plus Informationthe specific organs about specific where those carbohydrate lectins can recognition be found by within lectin the receptors human was body.
    [Show full text]
  • FBXO24 Rabbit Polyclonal Antibody – TA330492 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA330492 FBXO24 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-FBXO24 antibody: synthetic peptide directed towards the middle region of human FBXO24. Synthetic peptide located within the following region: LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 65 kDa Gene Name: F-box protein 24 Database Link: NP_277041 Entrez Gene 26261 Human O75426 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 FBXO24 Rabbit Polyclonal Antibody – TA330492 Background: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.
    [Show full text]
  • Supplementary Table 1. List of Genes Up-Regulated in Abiraterone-Resistant Vcap Xenograft Samples PIK3IP1 Phosphoinositide-3-Kin
    Supplementary Table 1. List of genes up-regulated in abiraterone-resistant VCaP xenograft samples PIK3IP1 phosphoinositide-3-kinase interacting protein 1 TMEM45A transmembrane protein 45A THBS1 thrombospondin 1 C7orf63 chromosome 7 open reading frame 63 OPTN optineurin FAM49A family with sequence similarity 49, member A APOL4 apolipoprotein L, 4 C17orf108|LOC201229 chromosome 17 open reading frame 108 | hypothetical protein LOC201229 SNORD94 small nucleolar RNA, C/D box 94 PCDHB11 protocadherin beta 11 RBM11 RNA binding motif protein 11 C6orf225 chromosome 6 open reading frame 225 KIAA1984|C9orf86|TMEM14 1 KIAA1984 | chromosome 9 open reading frame 86 | transmembrane protein 141 KIAA1107 TLR3 toll-like receptor 3 LPAR6 lysophosphatidic acid receptor 6 KIAA1683 GRB10 growth factor receptor-bound protein 10 TIMP2 TIMP metallopeptidase inhibitor 2 CCDC28A coiled-coil domain containing 28A FBXL2 F-box and leucine-rich repeat protein 2 NOV nephroblastoma overexpressed gene TSPAN31 tetraspanin 31 NR3C2 nuclear receptor subfamily 3, group C, member 2 DYNC2LI1 dynein, cytoplasmic 2, light intermediate chain 1 C15orf51 dynamin 1 pseudogene SAMD13 sterile alpha motif domain containing 13 RASSF6 Ras association (RalGDS/AF-6) domain family member 6 ZNF167 zinc finger protein 167 GATA2 GATA binding protein 2 NUDT7 nudix (nucleoside diphosphate linked moiety X)-type motif 7 DNAJC18 DnaJ (Hsp40) homolog, subfamily C, member 18 SNORA57 small nucleolar RNA, H/ACA box 57 CALCOCO1 calcium binding and coiled-coil domain 1 RLN2 relaxin 2 ING4 inhibitor of
    [Show full text]
  • 1 Novel Expression Signatures Identified by Transcriptional Analysis
    ARD Online First, published on October 7, 2009 as 10.1136/ard.2009.108043 Ann Rheum Dis: first published as 10.1136/ard.2009.108043 on 7 October 2009. Downloaded from Novel expression signatures identified by transcriptional analysis of separated leukocyte subsets in SLE and vasculitis 1Paul A Lyons, 1Eoin F McKinney, 1Tim F Rayner, 1Alexander Hatton, 1Hayley B Woffendin, 1Maria Koukoulaki, 2Thomas C Freeman, 1David RW Jayne, 1Afzal N Chaudhry, and 1Kenneth GC Smith. 1Cambridge Institute for Medical Research and Department of Medicine, Addenbrooke’s Hospital, Hills Road, Cambridge, CB2 0XY, UK 2Roslin Institute, University of Edinburgh, Roslin, Midlothian, EH25 9PS, UK Correspondence should be addressed to Dr Paul Lyons or Prof Kenneth Smith, Department of Medicine, Cambridge Institute for Medical Research, Addenbrooke’s Hospital, Hills Road, Cambridge, CB2 0XY, UK. Telephone: +44 1223 762642, Fax: +44 1223 762640, E-mail: [email protected] or [email protected] Key words: Gene expression, autoimmune disease, SLE, vasculitis Word count: 2,906 The Corresponding Author has the right to grant on behalf of all authors and does grant on behalf of all authors, an exclusive licence (or non-exclusive for government employees) on a worldwide basis to the BMJ Publishing Group Ltd and its Licensees to permit this article (if accepted) to be published in Annals of the Rheumatic Diseases and any other BMJPGL products to exploit all subsidiary rights, as set out in their licence (http://ard.bmj.com/ifora/licence.pdf). http://ard.bmj.com/ on September 29, 2021 by guest. Protected copyright. 1 Copyright Article author (or their employer) 2009.
    [Show full text]
  • View a Copy of This Licence, Visit
    Robertson et al. BMC Biology (2020) 18:103 https://doi.org/10.1186/s12915-020-00826-z RESEARCH ARTICLE Open Access Large-scale discovery of male reproductive tract-specific genes through analysis of RNA-seq datasets Matthew J. Robertson1,2, Katarzyna Kent3,4,5, Nathan Tharp3,4,5, Kaori Nozawa3,5, Laura Dean3,4,5, Michelle Mathew3,4,5, Sandra L. Grimm2,6, Zhifeng Yu3,5, Christine Légaré7,8, Yoshitaka Fujihara3,5,9,10, Masahito Ikawa9, Robert Sullivan7,8, Cristian Coarfa1,2,6*, Martin M. Matzuk1,3,5,6 and Thomas X. Garcia3,4,5* Abstract Background: The development of a safe, effective, reversible, non-hormonal contraceptive method for men has been an ongoing effort for the past few decades. However, despite significant progress on elucidating the function of key proteins involved in reproduction, understanding male reproductive physiology is limited by incomplete information on the genes expressed in reproductive tissues, and no contraceptive targets have so far reached clinical trials. To advance product development, further identification of novel reproductive tract-specific genes leading to potentially druggable protein targets is imperative. Results: In this study, we expand on previous single tissue, single species studies by integrating analysis of publicly available human and mouse RNA-seq datasets whose initial published purpose was not focused on identifying male reproductive tract-specific targets. We also incorporate analysis of additional newly acquired human and mouse testis and epididymis samples to increase the number of targets identified. We detected a combined total of 1178 genes for which no previous evidence of male reproductive tract-specific expression was annotated, many of which are potentially druggable targets.
    [Show full text]
  • Comparative Analysis of the Ubiquitin-Proteasome System in Homo Sapiens and Saccharomyces Cerevisiae
    Comparative Analysis of the Ubiquitin-proteasome system in Homo sapiens and Saccharomyces cerevisiae Inaugural-Dissertation zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen Fakultät der Universität zu Köln vorgelegt von Hartmut Scheel aus Rheinbach Köln, 2005 Berichterstatter: Prof. Dr. R. Jürgen Dohmen Prof. Dr. Thomas Langer Dr. Kay Hofmann Tag der mündlichen Prüfung: 18.07.2005 Zusammenfassung I Zusammenfassung Das Ubiquitin-Proteasom System (UPS) stellt den wichtigsten Abbauweg für intrazelluläre Proteine in eukaryotischen Zellen dar. Das abzubauende Protein wird zunächst über eine Enzym-Kaskade mit einer kovalent gebundenen Ubiquitinkette markiert. Anschließend wird das konjugierte Substrat vom Proteasom erkannt und proteolytisch gespalten. Ubiquitin besitzt eine Reihe von Homologen, die ebenfalls posttranslational an Proteine gekoppelt werden können, wie z.B. SUMO und NEDD8. Die hierbei verwendeten Aktivierungs- und Konjugations-Kaskaden sind vollständig analog zu der des Ubiquitin- Systems. Es ist charakteristisch für das UPS, daß sich die Vielzahl der daran beteiligten Proteine aus nur wenigen Proteinfamilien rekrutiert, die durch gemeinsame, funktionale Homologiedomänen gekennzeichnet sind. Einige dieser funktionalen Domänen sind auch in den Modifikations-Systemen der Ubiquitin-Homologen zu finden, jedoch verfügen diese Systeme zusätzlich über spezifische Domänentypen. Homologiedomänen lassen sich als mathematische Modelle in Form von Domänen- deskriptoren (Profile) beschreiben. Diese Deskriptoren können wiederum dazu verwendet werden, mit Hilfe geeigneter Verfahren eine gegebene Proteinsequenz auf das Vorliegen von entsprechenden Homologiedomänen zu untersuchen. Da die im UPS involvierten Homologie- domänen fast ausschließlich auf dieses System und seine Analoga beschränkt sind, können domänen-spezifische Profile zur Katalogisierung der UPS-relevanten Proteine einer Spezies verwendet werden. Auf dieser Basis können dann die entsprechenden UPS-Repertoires verschiedener Spezies miteinander verglichen werden.
    [Show full text]
  • The Potential Genetic Network of Human Brain SARS-Cov-2 Infection
    bioRxiv preprint doi: https://doi.org/10.1101/2020.04.06.027318; this version posted April 6, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. The potential genetic network of human brain SARS-CoV-2 infection. Colline Lapina 1,2,3, Mathieu Rodic 1, Denis Peschanski 4,5, and Salma Mesmoudi 1, 3, 4, 5 1 Prematuration Program: linkAllBrains. CNRS. Paris. France 2 Graduate School in Cognitive Engineering (ENSC). Talence. France 3 Complex Systems Institute Paris île-de-France. Paris. France 4 CNRS, Paris-1-Panthéon-Sorbonne University. CESSP-UMR8209. Paris. France 5 MATRICE Equipex. Paris. France Abstract The literature reports several symptoms of SARS-CoV-2 in humans such as fever, cough, fatigue, pneumonia, and headache. Furthermore, patients infected with similar strains (SARS-CoV and MERS-CoV) suffered testis, liver, or thyroid damage. Angiotensin-converting enzyme 2 (ACE2) serves as an entry point into cells for some strains of coronavirus (SARS-CoV, MERS-CoV, SARS-CoV-2). Our hypothesis was that as ACE2 is essential to the SARS-CoV-2 virus invasion, then brain regions where ACE2 is the most expressed are more likely to be disturbed by the infection. Thus, the expression of other genes which are also over-expressed in those damaged areas could be affected. We used mRNA expression levels data of genes provided by the Allen Human Brain Atlas (ABA), and computed spatial correlations with the LinkRbrain platform.
    [Show full text]
  • Targeting the DEK Oncogene in Head and Neck Squamous Cell Carcinoma: Functional and Transcriptional Consequences
    Targeting the DEK oncogene in head and neck squamous cell carcinoma: functional and transcriptional consequences A dissertation submitted to the Graduate School of the University of Cincinnati in partial fulfillment of the requirements to the degree of Doctor of Philosophy (Ph.D.) in the Department of Cancer and Cell Biology of the College of Medicine March 2015 by Allie Kate Adams B.S. The Ohio State University, 2009 Dissertation Committee: Susanne I. Wells, Ph.D. (Chair) Keith A. Casper, M.D. Peter J. Stambrook, Ph.D. Ronald R. Waclaw, Ph.D. Susan E. Waltz, Ph.D. Kathryn A. Wikenheiser-Brokamp, M.D., Ph.D. Abstract Head and neck squamous cell carcinoma (HNSCC) is one of the most common malignancies worldwide with over 50,000 new cases in the United States each year. For many years tobacco and alcohol use were the main etiological factors; however, it is now widely accepted that human papillomavirus (HPV) infection accounts for at least one-quarter of all HNSCCs. HPV+ and HPV- HNSCCs are studied as separate diseases as their prognosis, treatment, and molecular signatures are distinct. Five-year survival rates of HNSCC hover around 40-50%, and novel therapeutic targets and biomarkers are necessary to improve patient outcomes. Here, we investigate the DEK oncogene and its function in regulating HNSCC development and signaling. DEK is overexpressed in many cancer types, with roles in molecular processes such as transcription, DNA repair, and replication, as well as phenotypes such as apoptosis, senescence, and proliferation. DEK had never been previously studied in this tumor type; therefore, our studies began with clinical specimens to examine DEK expression patterns in primary HNSCC tissue.
    [Show full text]
  • Download Validation Data
    PrimePCR™Assay Validation Report Gene Information Gene Name conserved helix-loop-helix ubiquitous kinase Gene Symbol Chuk Organism Mouse Gene Summary Description Not Available Gene Aliases AI256658, Chuk1, Fbx24, Fbxo24, IKBKA, IKK1, Ikka, NFKBIKA RefSeq Accession No. NC_000085.6, NT_039687.8 UniGene ID Mm.3996 Ensembl Gene ID ENSMUSG00000025199 Entrez Gene ID 12675 Assay Information Unique Assay ID qMmuCID0005344 Assay Type SYBR® Green Detected Coding Transcript(s) ENSMUST00000026217, ENSMUST00000119591 Amplicon Context Sequence TGTTTCACGCTCAATTCGAGACTGTAGTGAATGAAGACTTTCATCACATGGTAAC AGAAAAGAAATGATTTTTGCAGAAGTCATATTTAGGATGTGCACTATCTTTAAATT GAGAATGTGATCCATTAATGCAAAACATCTTGGCT Amplicon Length (bp) 116 Chromosome Location 19:44091026-44096267 Assay Design Intron-spanning Purification Desalted Validation Results Efficiency (%) 97 R2 0.9995 cDNA Cq 19.92 cDNA Tm (Celsius) 77.5 gDNA Cq 29.84 Specificity (%) 100 Information to assist with data interpretation is provided at the end of this report. Page 1/4 PrimePCR™Assay Validation Report Chuk, Mouse Amplification Plot Amplification of cDNA generated from 25 ng of universal reference RNA Melt Peak Melt curve analysis of above amplification Standard Curve Standard curve generated using 20 million copies of template diluted 10-fold to 20 copies Page 2/4 PrimePCR™Assay Validation Report Products used to generate validation data Real-Time PCR Instrument CFX384 Real-Time PCR Detection System Reverse Transcription Reagent iScript™ Advanced cDNA Synthesis Kit for RT-qPCR Real-Time PCR Supermix SsoAdvanced™ SYBR® Green Supermix Experimental Sample qPCR Mouse Reference Total RNA Data Interpretation Unique Assay ID This is a unique identifier that can be used to identify the assay in the literature and online. Detected Coding Transcript(s) This is a list of the Ensembl transcript ID(s) that this assay will detect.
    [Show full text]