Not Dicer but Argonaute Is Required for a Microrna Production

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Cell Research (2010) 20:735-737. npg © 2010 IBCB, SIBS, CAS All rights reserved 1001-0602/10 $ 32.00 RESEARCH HIGHLIGHT www.nature.com/cr A new twist in the microRNA pathway: Not Dicer but Argonaute is required for a microRNA production Gabriel D Bossé1, Martin J Simard1 1Laval University Cancer Research Centre, Hôtel-Dieu de Québec (CHUQ), Quebec City, Québec G1R 2J6, Canada Cell Research (2010) 20:735-737. doi:10.1038/cr.2010.83; published online 15 June 2010 Found in all metazoans, microRNAs A Canonical pathway B Ago2-dependent pathway or miRNAs are small non-coding RNA Nucleus Cytoplasm Nucleus Cytoplasm of ~22 nucleotides in length that com- Exp.5 Exp.5 pletely reshaped our understanding of gene regulation. This new class of gene pre-miR-451 regulator is mostly transcribed by the pre-miRNA RNA polymerase II producing a long stem-loop structure, called primary- or Ago2 pri-miRNA, that will first be processed Ago2 Dicer in the cell nucleus by a multiprotein TRBP complex called microprocessor to gen- erate a shorter RNA structure called Ago2 RISC precursor- or pre-miRNA. The precisely Ago2 RISC processed pre-miRNA will next be ex- ported into the cytoplasm by Exportin 5 and loaded onto another processing machine containing the ribonuclease III enzyme Dicer, an Argonaute protein Ago2 Ago2 and other accessory cellular factors mRNA mRNA (Figure 1A; [1]). Dicer will mediate the Translation inhibition Translation inhibition cleavage of the pre-miRNA to form the mature miRNA that will then be bound Figure 1 (A) Canonical microRNA biogenesis. In mammals, the pre-miRNA is by the Argonaute protein to form, most loaded onto a multiprotein complex consisting minimally of Dicer, Tar RNA Bind- likely with other cellular factors, the ef- ing Protein (TRBP) and Ago2. The RNase III enzyme Dicer processes the pre- fector silencing complex or RISC able cursor by cleaving the stem-loop to produce the mature miRNA. Ago2 bind this miRNA to form the RISC complex to target specific mRNA.(B) Ago2-dependent to modulate protein expression upon microRNA biogenesis. For miR-451, the precursor is loaded directly onto Ago2, binding by sequence complementarity and this Argonaute cleaves the precursor RNA of this miRNA. The mature miR- to the specific region of 3′ untranslated 451 is bound by Ago2 to form the RISC complex that targets erythropoietic- region (UTR) of mRNA to alter protein specific mRNAs. synthesis. In animals, some Argonaute proteins can cleave RNA molecules while others that does not require RNA cleavage [2]. domain confers the endonucleolytic ac- have lost their catalytic activity and par- This family of proteins possesses four tivity of Argonaute proteins and requires ticipate in a gene regulatory mechanism structural domains: the N-terminus, coordination of divalent cations by PAZ, MID and PIWI domains. The PAZ Aspartate-Aspartate-Histidine (DDH) Correspondence: Martin J Simard domain is implicated in the binding of motif for catalysis. Interestingly, all four E-mail: [email protected] single-stranded RNA while the PIWI Argonautes found in mammals can form npg 736 a functional RISC but only Ago2 diplays enzyme cannot recognize and process form the RISC complex. an endonuclease activity [3, 4]. short pre-miRNA efficiently [10]. Sec- The recent work of Cheloufi and The discovery of a new class of ond, they also observed that the mature colleagues represents an important small RNAs in mammal oocytes [5] miR-451 includes the sequence of the breakthrough in the understanding of and embryonic stem cells [6] that have loop region and expands into the com- the catalytically competent Argonaute the potential to cleave complementary plementary strand of the precursor. The Ago2 and thus in the miRNA biogen- RNA sequences has provided part of authors concluded from these findings esis in animals. In addition to clearly the reason why Ago2 has conserved its that the biogenesis of miR-451 must be demonstrating the biological relevance enzymatic activity. However, the dele- unusual, most likely not inferring Dicer of Argonaute cleavage in the matura- tion of Ago2 does not only lead to sterile to process the precursor structure and tion of miRNAs as previously proposed animals but lethality is observed during produce mature miRNA. [11-14], this study represents the first gestation [3, 7, 8] suggesting a role of To further test this hypothesis, the evidence of a miRNA maturation that Ago2 apart of the female germline. authors used embryonic stem cells car- is independent of Dicer. This unex- In order to understand the catalytic rying a conditional Dicer allele. Using pected miRNA biogenesis seems to be function of Ago2 in animals, the Han- that system, they observed that the pro- conserved among species as recently non’s group generated a mouse in which duction of mature miR-451 was not af- reported in Zebrafish by Cifuentes and they replaced the endogenous allele by fected by the absence of Dicer whereas colleagues [15]. The implication of a catalytically inactive Ago2 carrying the loss-of-function of Dicer caused a Ago2 in the processing of pre-miRNA mutation in the DDH motif (Ago2ADH) strong decrease of other miRNA levels. provides interesting evidence of the [9]. They observed that the animal un- To confirm this observation, the authors importance of the endonuclease activ- derwent a normal embryogenesis but performed an in vitro assay to measure ity of this Argonaute. It will be next died within a few hours after birth and the efficiency of a recombinant Dicer interesting to know how many animal displayed severe sign of anemia. These protein to processed pre-miRNA into miRNAs require Ago2 to be produced. embryos have an important reduction mature miRNA. While a pre-let-7 RNA Since the cleavage of pre-miR-451 by in red blood cell caused by a defect in molecule was effectively process into Ago2 should generate a 30 nucleotides the maturation of erythroid cells. These a mature miRNA form, recombinant long RNA specie, it will be of great results represent the first evidence that Dicer was unable to generate the ma- interest to understand how this miRNA the catalytic domain of Ago2 is essential ture miR-451 from its precursor. These precursor can be trimmed precisely for the survival of mammals. results clearly indicate that in contrast to generate a 21-23 nucleotides long To next determine the molecular phe- to other miRNAs the biogenesis of functional miRNA. To conclude, this notypes of Ago2ADH mice, Cheloufi and miRNA miR-451 is Dicer independent exciting work is yet another example colleagues performed deep sequencing and thus, the Argonaute protein Ago2 that clearly illustrates that we should analysis of short RNAs in the liver, one could be responsible for the biogenesis be extremely cautious of making “gen- of the organ contributing to erythroid of this miRNA. eral” rule in biology; especially in a fast cells maturation in fetus [9]. Among all To confirm this hypothesis, the au- pacing field like the miRNA-mediated the miRNAs expressed in these tissues, thors performed a thorough analysis of silencing. they surprisingly observed that only one the small RNA species sequenced from miRNA in normal fetal liver, miR-451, the Ago2ADH animal fetal liver [9]. They References is strongly decreased in mice carrying observed a significant accumulation catalytically inefficient Ago2. Since of the pre-miR-451 and confirmed the 1 Winter J, Jung S, Keller S, Gregory RI, ADH Diederichs S. Many roads to maturity: the expression of the precursor miRNA absence of mature miR-451 in Ago2 microRNA biogenesis pathways and form of miR-451 was not affected, the samples. The immunoprecipitation of their regulation. Nat Cell Biol 2009; authors concluded that the mutation of the Ago2 complex from a fetal liver 11:228-234. Ago2 most likely impact the maturation homogenate of the transgenic animal 2 Hutvagner G, Simard MJ. Argonaute of miR-451. A careful analysis of the revealed that pre-miR-451 can bind proteins: key players in RNA silencing. miR-451 precursor and mature RNA to the mutated Argonaute. Finally, in Nat Rev Mol Cell Biol 2008; 9:22-32. structure reveals significant differences vitro assays using both wild-type and 3 Liu J, Carmell MA, Rivas FV, et al. Argonaute2 is the catalytic engine between miR-451 and others miRNAs. catalytically inactive affinity purified of mammalian RNAi. Science 2004; At first, they noted that the pre-miR-451 Ago2 proteins confirm that Ago2 can 305:1437-1441. is shorter by 17 nucleotides than most successfully process the pre-miR-451 4 Meister G, Landthaler M, Patkaniows- of pre-miRNAs, making this molecule to generate miR-451 and this miRNA ka A, et al. Human Argonaute2 mediates unlikely a Dicer substrate since this is also able to be loaded onto Ago2 to RNA cleavage targeted by miRNAs Cell Research | Vol 20 No 7 | July 2010 npg 737 and siRNAs. Mol Cell 2004; 15:185- 8 Alisch RS, Jin P, Epstein M, Caspary 12 Leuschner PJ, Ameres SL, Kueng S, 197. T, Warren ST. Argonaute2 is essential Martinez J. Cleavage of the siRNA pas- 5 Tam OH, Aravin AA, Stein P, et al. for mammalian gastrulation and prop- senger strand during RISC assembly in Pseudogene-derived small interfer- er mesoderm formation. PLoS Genet human cells. EMBO Rep 2006; 7:314- ing RNAs regulate gene expression in 2007; 3:e227. 320. mouse oocytes. Nature 2008; 453:534- 9 Cheloufi S, Dos Santos CO, Chong 13 Matranga C, Tomari Y, Shin C, Bar- 538. MM, Hannon GJ. A dicer-independent tel DP, Zamore PD. Passenger-strand 6 Babiarz JE, Ruby JG, Wang Y, Bartel miRNA biogenesis pathway that re- cleavage facilitates assembly of siRNA DP, Blelloch R.
Recommended publications
  • EIF2C2 Monoclonal Antibody (M01), Clone 2E12-1C9

    EIF2C2 Monoclonal Antibody (M01), Clone 2E12-1C9

    EIF2C2 monoclonal antibody (M01), clone 2E12-1C9 Catalog # : H00027161-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: EIF2C2. Immunogen: EIF2C2 (AAH07633.1, 483 a.a. ~ 859 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAE VKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLP enlarge QGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATV Western Blot (Transfected RVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQV lysate) LHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIP AGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQI LTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTS GQSNGRDHQALAKAVQVHQDTLRTMYFA Host: Mouse enlarge Reactivity: Human Western Blot (Recombinant Isotype: IgG1 Kappa protein) Quality Control Antibody Reactive Against Recombinant Protein. Immunofluorescence Testing: enlarge Immunohistochemistry (Formalin/PFA-fixed paraffin- embedded sections) Western Blot detection against Immunogen (68.03 KDa) . Storage Buffer: In 1x PBS, pH 7.4 enlarge Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: Sandwich ELISA (Recombinant protein) MSDS: Download Interspecies Mouse (100); Rat (99) Antigen Sequence: enlarge Datasheet: Download ELISA Publication Reference RNAi Knockdown (Antibody validated) 1. TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance
  • Mir-125 in Normal and Malignant Hematopoiesis

    Mir-125 in Normal and Malignant Hematopoiesis

    Leukemia (2012) 26, 2011–2018 & 2012 Macmillan Publishers Limited All rights reserved 0887-6924/12 www.nature.com/leu SPOTLIGHT REVIEW MiR-125 in normal and malignant hematopoiesis L Shaham1,2, V Binder3,4,NGefen1,5, A Borkhardt3 and S Izraeli1,5 MiR-125 is a highly conserved microRNA throughout many different species from nematode to humans. In humans, there are three homologs (hsa-miR-125b-1, hsa-miR-125b-2 and hsa-miR-125a). Here we review a recent research on the role of miR-125 in normal and malignant hematopoietic cells. Its high expression in hematopoietic stem cells (HSCs) enhances self-renewal and survival. Its expression in specific subtypes of myeloid and lymphoid leukemias provides resistance to apoptosis and blocks further differentiation. A direct oncogenic role in the hematopoietic system has recently been demonstrated by several mouse models. Targets of miR-125b include key proteins regulating apoptosis, innate immunity, inflammation and hematopoietic differentiation. Leukemia (2012) 26, 2011–2018; doi:10.1038/leu.2012.90 Keywords: microRNA; hematopoiesis; hematological malignancies; acute myeloid leukemia; acute lymphoblastic leukemia MicroRNAs (miRNAs) are 21–23-nucleotide non-coding RNAs that nucleotides with the seed region of miR-125b (ebv-miR-BART21-5p, have crucial roles in fundamental biological processes by ebv-miR-BART8 and rlcv-miR-rL1-25). In humans, as in most of the regulating the levels of multiple proteins. They are transcribed genomes, there are two paralogs (hsa-miR-125b-1 on chromosome as primary miRNAs and processed in the nucleus by the RNase III 11 and hsa-miR-125b-2 on chromosome 21), coding for the same endonuclease DROSHA to liberate 70-nucleotide stem loops, the mature sequence.
  • EIF2C2 Monoclonal Antibody (M01), Clone 2E12-1C9

    EIF2C2 Monoclonal Antibody (M01), Clone 2E12-1C9

    Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic EIF2C2 monoclonal antibody (M01), clone 2E12-1C9 Catalog # : H00027161-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: EIF2C2. Immunogen: EIF2C2 (AAH07633.1, 1 a.a. ~ 377 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAE VKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLP enlarge QGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATV Western Blot (Transfected RVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQV lysate) LHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIP AGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQI LTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTS GQSNGRDHQALAKAVQVHQDTLRTMYFA Host: Mouse enlarge Reactivity: Human Western Blot (Recombinant Isotype: IgG1 Kappa
  • Relative Contribution of Sequence and Structure Features to the Mrna Binding of Argonaute/ EIF2C–Mirna Complexes and the Degradation of Mirna Targets

    Relative Contribution of Sequence and Structure Features to the Mrna Binding of Argonaute/ EIF2C–Mirna Complexes and the Degradation of Mirna Targets

    Downloaded from genome.cshlp.org on October 2, 2021 - Published by Cold Spring Harbor Laboratory Press Letter Relative contribution of sequence and structure features to the mRNA binding of Argonaute/ EIF2C–miRNA complexes and the degradation of miRNA targets Jean Hausser,1,3 Markus Landthaler,2,3,4 Lukasz Jaskiewicz,1 Dimos Gaidatzis,1,5 and Mihaela Zavolan1,6 1Biozentrum, University of Basel and Swiss Institute of Bioinformatics, CH-4056 Basel, Switzerland; 2Howard Hughes Medical Institute, Laboratory for RNA Biology, The Rockefeller University, New York, New York 10021, USA How miRNAs recognize their target sites is a puzzle that many experimental and computational studies aimed to solve. Several features, such as perfect pairing of the miRNA seed, additional pairing in the 39 region of the miRNA, relative position in the 39 UTR, and the A/Ucontent of the environment of the putative site, have been found to be relevant. Here we have used a large number of previously published data sets to assess the power that various sequence and structure features have in distinguishing between putative sites that do and those that do not appear to be functional. We found that although different data sets give widely different answers when it comes to ranking the relative importance of these features, the sites inferred from most transcriptomics experiments, as well as from comparative genomics, appear similar at this level. This suggests that miRNA target sites have been selected in evolution on their ability to trigger mRNA degradation. To understand at what step in the miRNA-induced response individual features play a role, we transfected human HEK293 cells with miRNAs and analyzed the association of Argonaute/EIF2C–miRNA complexes with target mRNAs and the degradation of these messages.
  • Dysregulated RNA-Induced Silencing Complex (RISC) Assembly Within CNS Corresponds with Abnormal Mirna Expression During Autoimmune Demyelination

    Dysregulated RNA-Induced Silencing Complex (RISC) Assembly Within CNS Corresponds with Abnormal Mirna Expression During Autoimmune Demyelination

    The Journal of Neuroscience, May 13, 2015 • 35(19):7521–7537 • 7521 Neurobiology of Disease Dysregulated RNA-Induced Silencing Complex (RISC) Assembly within CNS Corresponds with Abnormal miRNA Expression during Autoimmune Demyelination Przemysław Lewkowicz, Hanna Cwiklin´ska, Marcin P. Mycko, Maria Cichalewska, Małgorzata Domowicz, Natalia Lewkowicz, Anna Jurewicz, and Krzysztof W. Selmaj Department of Neurology, Laboratory of Neuroimmunology, Medical University of Lodz, 92-213 Lodz, Poland MicroRNAs (miRNAs) associate with Argonaute (Ago), GW182, and FXR1 proteins to form RNA-induced silencing complexes (RISCs). RISCs represent a critical checkpoint in the regulation and bioavailability of miRNAs. Recent studies have revealed dysregulation of miRNAs in multiple sclerosis (MS) and its animal model, experimental autoimmune encephalomyelitis (EAE); however, the function of RISCs in EAE and MS is largely unknown. Here, we examined the expression of Ago, GW182, and FXR1 in CNS tissue, oligodendrocytes (OLs), brain-infiltrating T lymphocytes, and CD3 ϩsplenocytes (SCs) of EAE mic, and found that global RISC protein levels were signifi- cantly dysregulated. Specifically, Ago2 and FXR1 levels were decreased in OLs and brain-infiltrating T cells in EAE mice. Accordingly, assembly of Ago2/GW182/FXR1 complexes in EAE brain tissues was disrupted, as confirmed by immunoprecipitation experiments. In parallel with alterations in RISC complex content in OLs, we found downregulation of miRNAs essential for differentiation and survival of OLs and myelin synthesis. In brain-infiltrating T lymphocytes, aberrant RISC formation contributed to miRNA-dependent proinflam- matory helper T-cell polarization. In CD3 ϩ SCs, we found increased expression of both Ago2 and FXR1 in EAE compared with nonim- munized mice.
  • NIH Public Access Author Manuscript Epigenetics

    NIH Public Access Author Manuscript Epigenetics

    NIH Public Access Author Manuscript Epigenetics. Author manuscript; available in PMC 2009 June 23. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: Epigenetics. 2007 ; 2(2): 126±134. Epigenetics and Neural Developmental Disorders: Washington DC, September 18 and 19, 2006 Xinyu Zhao1,*, ChangHui Pak2, Richard D. Smrt1, and Peng Jin2,* 1 Department of Neuroscience; University of New Mexico School of Medicine; Albuquerque, New Mexico USA 2 Department of Human Genetics; Emory University School of Medicine; Atlanta, Georgia USA Abstract Neural developmental disorders, such as autism, Rett Syndrome, Fragile X syndrome, and Angelman syndrome manifest during early postnatal neural development. Although the genes responsible for some of these disorders have been identified, how the mutations of these genes affect neural development is currently unclear. Emerging evidence suggest that these disorders share common underlying defects in neuronal morphology, synaptic connectivity and brain plasticity. In particular, alterations in dendritic branching and spine morphology play a central role in the pathophysiology of most mental retardation disorders, suggesting that common pathways regulating neuronal function may be affected. Epigenetic modulations, mediated by DNA methylation, RNA-associated silencing, and histone modification, can serve as an intermediate process that imprints dynamic environmental experiences on the “fixed” genome, resulting in stable alterations in phenotypes. Disturbance in epigenetic regulations can lead to inappropriate expression or silencing of genes, causing an array of multi-system disorders and neoplasias. Rett syndrome, the most common form of mental retardation in young girls, is due to l mutation of MECP2, encoding a methylated DNA binding protein that translates DNA methylation into gene repression.
  • T Lymphocytes Mrna, and Protein Expression in Activated Networks

    T Lymphocytes Mrna, and Protein Expression in Activated Networks

    MicroRNA Regulation of Molecular Networks Mapped by Global MicroRNA, mRNA, and Protein Expression in Activated T Lymphocytes This information is current as of September 23, 2021. Yevgeniy A. Grigoryev, Sunil M. Kurian, Traver Hart, Aleksey A. Nakorchevsky, Caifu Chen, Daniel Campbell, Steven R. Head, John R. Yates III and Daniel R. Salomon J Immunol 2011; 187:2233-2243; Prepublished online 25 July 2011; Downloaded from doi: 10.4049/jimmunol.1101233 http://www.jimmunol.org/content/187/5/2233 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2011/07/25/jimmunol.110123 Material 3.DC1 References This article cites 83 articles, 31 of which you can access for free at: http://www.jimmunol.org/content/187/5/2233.full#ref-list-1 Why The JI? Submit online. by guest on September 23, 2021 • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2011 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology MicroRNA Regulation of Molecular Networks Mapped by Global MicroRNA, mRNA, and Protein Expression in Activated T Lymphocytes Yevgeniy A.
  • A Drosophila Fragile X Protein Interacts with Components of Rnai and Ribosomal Proteins

    A Drosophila Fragile X Protein Interacts with Components of Rnai and Ribosomal Proteins

    Downloaded from genesdev.cshlp.org on September 25, 2021 - Published by Cold Spring Harbor Laboratory Press A Drosophila fragile X protein interacts with components of RNAi and ribosomal proteins Akira Ishizuka,1,2,3 Mikiko C. Siomi,1,3 and Haruhiko Siomi1,4 1Institute for Genome Research, 2Graduate School of Nutrition University of Tokushima, Tokushima 770-8503, Japan Fragile X syndrome is a common form of inherited mental retardation caused by the loss of FMR1 expression. The FMR1 gene encodes an RNA-binding protein that associates with translating ribosomes and acts as a negative translational regulator. In Drosophila, the fly homolog of the FMR1 protein (dFMR1) binds to and represses the translation of an mRNA encoding of the microtuble-associated protein Futsch. We have isolated a dFMR1-associated complex that includes two ribosomal proteins, L5 and L11, along with 5S RNA. The dFMR1 complex also contains Argonaute2 (AGO2) and a Drosophila homolog of p68 RNA helicase (Dmp68). AGO2 is an essential component for the RNA-induced silencing complex (RISC), a sequence-specific nuclease complex that mediates RNA interference (RNAi) in Drosophila. We show that Dmp68 is also required for efficient RNAi. We further show that dFMR1 is associated with Dicer, another essential component of the RNAi pathway, and microRNAs (miRNAs) in vivo, suggesting that dFMR1 is part of the RNAi-related apparatus. Our findings suggest a model in which the RNAi and dFMR1-mediated translational control pathways intersect in Drosophila. Our findings also raise the possibility that defects in an RNAi-related machinery may cause human disease. [Keywords: fragile X syndrome; FMR1; RNAi; RNA helicase; miRNA] Received July 9, 2002; revised version accepted August 22, 2002.
  • High-Risk Myeloma Is Associated with Global Elevation of Mirnas and Overexpression of EIF2C2/AGO2

    High-Risk Myeloma Is Associated with Global Elevation of Mirnas and Overexpression of EIF2C2/AGO2

    High-risk myeloma is associated with global elevation of miRNAs and overexpression of EIF2C2/AGO2 Yiming Zhoua,1, Lijuan Chena,b,1, Bart Barlogiea, Owen Stephensa, Xiaosong Wua, David R. Williamsa, Marie-Astrid Cartrona, Frits van Rheea, Bijay Naira, Sarah Waheeda, Mauricio Pineda-Romana, Yazan Alsayeda, Elias Anaissiea, and John D. Shaughnessy, Jr.a,2 aDonna D. and Donald M. Lambert Laboratory for Myeloma Genetics, Myeloma Institute for Research and Therapy, University of Arkansas for Medical Sciences, Little Rock, AR 72205; and bDepartment of Hematology, First Affiliated Hospital of Nanjing Medical University, Jiangsu Province Hospital, Nanjing, 210029,China Edited* by Carlo M. Croce, Ohio State University, Columbus, OH, and approved March 17, 2010 (received for review July 30, 2009) MicroRNAs (miRNAs) are noncoding RNAs that regulate global gene liferation in MM cell lines, and Lionetti et al. (14) identified 16 expression. miRNAs often act synergistically to repress target genes, miRNAs sensitive to DNA copy number. and their dysregulation can contribute to the initiation and pro- To further investigate the potential involvement of miRNA gression of a variety of cancers. The clinical relationship between in MM, we performed integrative analyses of both miRNA global expression of miRNA and mRNA in cancer has not been expression profiles and protein-coding gene expression profiles studied in detail. We used whole-genome microarray analyses of (GEPs) of myeloma cells from newly diagnosed patients. Global CD138-enriched plasma cells from 52 newly diagnosed cases of increases in miRNA expression were seen in cases with high-risk multiple myeloma to correlate miRNA expression profiles with a MM, which sharply contrasts with discriminate expression validated mRNA-based risk stratification score, proliferation index, changes of only selected miRNAs that are seen in other cancers and predefined gene sets.
  • Integrative Modeling and Visualization of Exosomes 7

    Integrative Modeling and Visualization of Exosomes 7

    Integrative Modeling and Visualization of Exosomes 7 Integrative Modeling and Visualization of Exosomes Julia Jiménez, Ludovic Autin, Inmaculada Ibáñez de Cáceres, David S. Goodsell As part of this work, we have used small, well-defined systems to Information from proteomics, microscopy, and structural test and apply new methods. Because the work is highly biology are integrated to create structural models of exosomes, small vesicles released from cells. Three visualization methods integrative, a wide variety of data must be gathered (or are employed and compared: 2D painting of a cross section estimated) in order to generate a convincing model. Early using traditional media, manual creation of a cross section illustrative work focused on well-studied systems such as red using the mesoscale 2.5D digital painting software cellPAINT, blood cells and Escherichia coli (Goodsell 1992). For our 3D and generation of a 3D atomic model using the mesoscale modeling work, we have used simpler systems, including HIV modeling program cellPACK. (Johnson et al. 2014) and mycoplasma bacteria (Goodsell, Autin, et al. 2018). Exosomes provide an excellent test case for current mesoscale modeling methods. Sufficient proteomic, structural, and ultrastructural data are available to define a convincing model, Keywords however, there are still grey areas in this knowledge that may Exosome, integrative structural biology, molecular benefit from mesoscale modeling. Given their growing role in visualization, non-photorealistic rendering, protein structure many disease states, many illustrations of exosomes have been created, ranging from simple schematics to highly rendered editorial and advertising imagery (an internet search of Introduction “exosome” will yield hundreds of examples). However, to our Modeling of the molecular structure of cells is rapidly moving knowledge, no detailed integrative models of exosomes have from an art into a science.
  • The Argonaute Family: Tentacles That Reach Into Rnai, Developmental Control, Stem Cell Maintenance, and Tumorigenesis

    The Argonaute Family: Tentacles That Reach Into Rnai, Developmental Control, Stem Cell Maintenance, and Tumorigenesis

    Downloaded from genesdev.cshlp.org on September 26, 2021 - Published by Cold Spring Harbor Laboratory Press The Argonaute family: tentacles that reach into RNAi, developmental control, stem cell maintenance, and tumorigenesis Michelle A. Carmell,1,2,3 Zhenyu Xuan,1,3 Michael Q. Zhang,1 and Gregory J. Hannon1,4 1Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11724, USA; 2Program in Genetics, State University of New York at Stony Brook, Stony Brook, New York 11794, USA RNA interference (RNAi) is an evolutionarily conserved The Argonaute family process through which double-stranded RNA (dsRNA) Argonaute proteins make up a highly conserved family induces the silencing of cognate genes (for review, see whose members have been implicated in RNAi and re- Bernstein et al. 2001b; Carthew 2001). Sources of dsRNA lated phenomena in several organisms. In addition to silencing triggers include experimentally introduced roles in RNAi-like mechanisms, Argonaute proteins in- dsRNAs, RNA viruses, transposons, and RNAs tran- fluence development, and at least a subset are involved scribed from complex transgene arrays (for review, see in stem cell fate determination. Argonaute proteins are Hammond et al. 2001b). Short hairpin sequences en- ∼100-kD highly basic proteins that contain two common coded in the genome also appear to enter the RNAi path- domains, namely PAZ and PIWI domains (Cerutti et al. way and function to regulate the expression of endog- 2000). The PAZ domain, consisting of 130 amino acids, enous, protein-coding genes (Grishok et al. 2001; has been identified in Argonaute proteins and in Dicer Hutvagner et al. 2001; Ketting et al.
  • Argonaute Proteins at a Glance Christine Ender and Gunter Meister

    Argonaute Proteins at a Glance Christine Ender and Gunter Meister

    Cell Science at a Glance 1819 Argonaute proteins at a RNAs) – ncRNAs that are characteristically Biogenesis of miRNAs and siRNAs ~20-35 nucleotides long – are required for miRNAs glance the regulation of gene expression in many Generally, miRNAs are transcribed by RNA different organisms. Most small RNA species polymerase II or III to form stem-loop-structured Christine Ender1 and Gunter fall into one of the following three classes: primary miRNA transcripts (pri-miRNAs). pri- Meister1,2,* microRNAs (miRNAs), short-interfering RNAs miRNAs are processed in the nucleus by the 1 Center for Integrated Protein Science Munich (siRNAs) and Piwi-interacting RNAs (piRNAs) microprocessor complex, which contains (CIPSM), Laboratory of RNA Biology, Max-Planck- Institute of Biochemistry, Am Klopferspitz 18, 82152 (Carthew and Sontheimer, 2009). Although the RNAse III enzyme Drosha and its DiGeorge Martinsried, Germany different small RNA classes have different syndrome critical region gene 8 (DGCR8) 2University of Regensburg, Universitätsstraße 31, 93053 Regensburg, Germany bio genesis pathways and exert different cofactor. The transcripts are cleaved at the stem *Author for correspondence functions, all of them must associate with a of the hairpin to produce a stem-loop- ([email protected]) member of the Argonaute protein family for structured miRNA precursor (pre-miRNA) of Journal of Cell Science 123, 1819-1823 activity. This article and its accompanying ~70 nucleotides. After this first processing step, © 2010. Published by The Company of Biologists Ltd poster provide an overview of the different pre-miRNAs are exported into the cytoplasm by doi:10.1242/jcs.055210 classes of small RNAs and the manner in which exportin-5, where they are further processed they interact with Argonaute protein family by the RNAse III enzyme Dicer and its TRBP Although a large portion of the human genome members during small-RNA-guided gene (HIV transactivating response RNA-binding is actively transcribed into RNA, less than 2% silencing.