Integrated Lipidomics and Proteomics Reveal Cardiolipin Alterations
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
ELOVL5 Rabbit Polyclonal Antibody – TA338477 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA338477 ELOVL5 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 35 kDa Gene Name: ELOVL fatty acid elongase 5 Database Link: NP_068586 Entrez Gene 60481 Human Q9NYP7 Background: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011 Synonyms: dJ483K16.1; HELO1; SCA38 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, -
Cytogenomic SNP Microarray - Fetal ARUP Test Code 2002366 Maternal Contamination Study Fetal Spec Fetal Cells
Patient Report |FINAL Client: Example Client ABC123 Patient: Patient, Example 123 Test Drive Salt Lake City, UT 84108 DOB 2/13/1987 UNITED STATES Gender: Female Patient Identifiers: 01234567890ABCD, 012345 Physician: Doctor, Example Visit Number (FIN): 01234567890ABCD Collection Date: 00/00/0000 00:00 Cytogenomic SNP Microarray - Fetal ARUP test code 2002366 Maternal Contamination Study Fetal Spec Fetal Cells Single fetal genotype present; no maternal cells present. Fetal and maternal samples were tested using STR markers to rule out maternal cell contamination. This result has been reviewed and approved by Maternal Specimen Yes Cytogenomic SNP Microarray - Fetal Abnormal * (Ref Interval: Normal) Test Performed: Cytogenomic SNP Microarray- Fetal (ARRAY FE) Specimen Type: Direct (uncultured) villi Indication for Testing: Patient with 46,XX,t(4;13)(p16.3;q12) (Quest: EN935475D) ----------------------------------------------------------------- ----- RESULT SUMMARY Abnormal Microarray Result (Male) Unbalanced Translocation Involving Chromosomes 4 and 13 Classification: Pathogenic 4p Terminal Deletion (Wolf-Hirschhorn syndrome) Copy number change: 4p16.3p16.2 loss Size: 5.1 Mb 13q Proximal Region Deletion Copy number change: 13q11q12.12 loss Size: 6.1 Mb ----------------------------------------------------------------- ----- RESULT DESCRIPTION This analysis showed a terminal deletion (1 copy present) involving chromosome 4 within 4p16.3p16.2 and a proximal interstitial deletion (1 copy present) involving chromosome 13 within 13q11q12.12. This -
Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model
Downloaded from http://www.jimmunol.org/ by guest on September 25, 2021 T + is online at: average * The Journal of Immunology , 34 of which you can access for free at: 2016; 197:1477-1488; Prepublished online 1 July from submission to initial decision 4 weeks from acceptance to publication 2016; doi: 10.4049/jimmunol.1600589 http://www.jimmunol.org/content/197/4/1477 Molecular Profile of Tumor-Specific CD8 Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. Waugh, Sonia M. Leach, Brandon L. Moore, Tullia C. Bruno, Jonathan D. Buhrman and Jill E. Slansky J Immunol cites 95 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2016/07/01/jimmunol.160058 9.DCSupplemental This article http://www.jimmunol.org/content/197/4/1477.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 25, 2021. The Journal of Immunology Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. -
Protein Domain-Level Landscape of Cancer-Type-Specific Somatic We Explored the Protein Domain-Level Landscape of Cancer-Type-Specific Somatic Mutations
RESEARCH ARTICLE Protein Domain-Level Landscape of Cancer- Type-Specific Somatic Mutations Fan Yang1,2,3, Evangelia Petsalaki2,3, Thomas Rolland4,5, David E. Hill4, Marc Vidal4, Frederick P. Roth1,2,3,4,6,7* 1 Department of Molecular Genetics, University of Toronto, Toronto, Ontario, Canada, 2 Donnelly Centre, University of Toronto, Toronto, Ontario, Canada, 3 Lunenfeld-Tanenbaum Research Institute, Mt. Sinai Hospital, Toronto, Ontario, Canada, 4 Center for Cancer Systems Biology (CCSB), Dana-Farber Cancer Institute, Boston, Massachusetts, United States of America, 5 Department of Genetics, Harvard Medical School, Boston, Massachusetts, United States of America, 6 Canadian Institute for Advanced Research, Toronto, Ontario, Canada, 7 Department of Computer Science, University of Toronto, Toronto, Ontario, Canada * [email protected] Abstract OPEN ACCESS Identifying driver mutations and their functional consequences is critical to our understand- Citation: Yang F, Petsalaki E, Rolland T, Hill DE, ing of cancer. Towards this goal, and because domains are the functional units of a protein, Vidal M, Roth FP (2015) Protein Domain-Level Landscape of Cancer-Type-Specific Somatic we explored the protein domain-level landscape of cancer-type-specific somatic mutations. Mutations. PLoS Comput Biol 11(3): e1004147. Specifically, we systematically examined tumor genomes from 21 cancer types to identify doi:10.1371/journal.pcbi.1004147 domains with high mutational density in specific tissues, the positions of mutational hotspots Editor: Mona Singh, Princeton University, United within these domains, and the functional and structural context where possible. While hot- States of America spots corresponding to specific gain-of-function mutations are expected for oncoproteins, Received: August 22, 2014 we found that tumor suppressor proteins also exhibit strong biases toward being mutated in Accepted: January 22, 2015 particular domains. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Negative Regulation of Diacylglycerol Kinase &Theta
Cell Death and Differentiation (2010) 17, 1059–1068 & 2010 Macmillan Publishers Limited All rights reserved 1350-9047/10 $32.00 www.nature.com/cdd Negative regulation of diacylglycerol kinase h mediates adenosine-dependent hepatocyte preconditioning G Baldanzi1,5, E Alchera2,5, C Imarisio2, M Gaggianesi1, C Dal Ponte2, M Nitti3, C Domenicotti3, WJ van Blitterswijk4, E Albano2, A Graziani1,5 and R Carini*,2,5 In liver ischemic preconditioning (IP), stimulation of adenosine A2a receptors (A2aR) prevents ischemia/reperfusion injury by promoting diacylglycerol-mediated activation of protein kinase C (PKC). By concerting diacylglycerol to phosphatidic acid, diacylglycerol kinases (DGKs) act as terminator of diacylglycerol signalling. This study investigates the role of DGK in the development of hepatocyte IP. DGK activity and cell viability were evaluated in isolated rat hepatocytes preconditioned by 10 min hypoxia followed by 10 min re-oxygenation or by the treatment with the A2aR agonist, CGS21680, and subsequently exposed to prolonged hypoxia. We observed that after IP or A2aR activation, a decrease in DGK activity was associated with the onset of hepatocyte tolerance to hypoxia. CGS21680-induced stimulation of A2aR specifically inhibited DGK isoform h by activating RhoA–GTPase. Consistently, both siRNA-mediated downregulation of DGK h and hepatocyte pretreatment with the DGK inhibitor R59949 induced cell tolerance to hypoxia. The pharmacological inhibition of DGK was associated with the diacylglycerol- dependent activation of PKC d and e and of their downstream target p38 MAPK. In conclusion, we unveil a novel signalling pathway contributing to the onset of hepatocyte preconditioning, which through RhoA–GTPase, couples A2aR to the downregulation of DGK. -
Downloaded from [266]
Patterns of DNA methylation on the human X chromosome and use in analyzing X-chromosome inactivation by Allison Marie Cotton B.Sc., The University of Guelph, 2005 A THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY in The Faculty of Graduate Studies (Medical Genetics) THE UNIVERSITY OF BRITISH COLUMBIA (Vancouver) January 2012 © Allison Marie Cotton, 2012 Abstract The process of X-chromosome inactivation achieves dosage compensation between mammalian males and females. In females one X chromosome is transcriptionally silenced through a variety of epigenetic modifications including DNA methylation. Most X-linked genes are subject to X-chromosome inactivation and only expressed from the active X chromosome. On the inactive X chromosome, the CpG island promoters of genes subject to X-chromosome inactivation are methylated in their promoter regions, while genes which escape from X- chromosome inactivation have unmethylated CpG island promoters on both the active and inactive X chromosomes. The first objective of this thesis was to determine if the DNA methylation of CpG island promoters could be used to accurately predict X chromosome inactivation status. The second objective was to use DNA methylation to predict X-chromosome inactivation status in a variety of tissues. A comparison of blood, muscle, kidney and neural tissues revealed tissue-specific X-chromosome inactivation, in which 12% of genes escaped from X-chromosome inactivation in some, but not all, tissues. X-linked DNA methylation analysis of placental tissues predicted four times higher escape from X-chromosome inactivation than in any other tissue. Despite the hypomethylation of repetitive elements on both the X chromosome and the autosomes, no changes were detected in the frequency or intensity of placental Cot-1 holes. -
Cardiolipin and Mitochondrial Cristae Organization
Biochimica et Biophysica Acta 1859 (2017) 1156–1163 Contents lists available at ScienceDirect Biochimica et Biophysica Acta journal homepage: www.elsevier.com/locate/bbamem Cardiolipin and mitochondrial cristae organization Nikita Ikon, Robert O. Ryan ⁎ Children's Hospital Oakland Research Institute, 5700 Martin Luther King Jr. Way, Oakland, CA 94609, United States article info abstract Article history: A fundamental question in cell biology, under investigation for over six decades, is the structural organization of Received 23 December 2016 mitochondrial cristae. Long known to harbor electron transport chain proteins, crista membrane integrity is key Received in revised form 3 March 2017 to establishment of the proton gradient that drives oxidative phosphorylation. Visualization of cristae morphol- Accepted 18 March 2017 ogy by electron microscopy/tomography has provided evidence that cristae are tube-like extensions of the mito- Available online 20 March 2017 chondrial inner membrane (IM) that project into the matrix space. Reconciling ultrastructural data with the lipid Keywords: composition of the IM provides support for a continuously curved cylindrical bilayer capped by a dome-shaped Cardiolipin tip. Strain imposed by the degree of curvature is relieved by an asymmetric distribution of phospholipids in Mitochondria monolayer leaflets that comprise cristae membranes. The signature mitochondrial lipid, cardiolipin (~18% of Cristae IM phospholipid mass), and phosphatidylethanolamine (34%) segregate to the negatively curved monolayer leaf- Membrane curvature let facing the crista lumen while the opposing, positively curved, matrix-facing monolayer leaflet contains pre- Non-bilayer lipid dominantly phosphatidylcholine. Associated with cristae are numerous proteins that function in distinctive Electron transport chain ways to establish and/or maintain their lipid repertoire and structural integrity. -
Mapping of Diabetes Susceptibility Loci in a Domestic Cat Breed with an Unusually High Incidence of Diabetes Mellitus
G C A T T A C G G C A T genes Article Mapping of Diabetes Susceptibility Loci in a Domestic Cat Breed with an Unusually High Incidence of Diabetes Mellitus 1,2, 3, 4 5 Lois Balmer y , Caroline Ann O’Leary y, Marilyn Menotti-Raymond , Victor David , Stephen O’Brien 6,7, Belinda Penglis 8, Sher Hendrickson 9, Mia Reeves-Johnson 3, 3 10 3 3,11, Susan Gottlieb , Linda Fleeman , Dianne Vankan , Jacquie Rand z and 1, , Grant Morahan * z 1 Centre for Diabetes Research, Harry Perkins Institute for Medical Research, University of Western Australia, Nedlands 6009, Australia; [email protected] 2 School of Medical and Health Sciences, Edith Cowan University, Joondalup, Perth 6027, Australia 3 School of Veterinary Science, the University of Queensland, Gottan 4343, Australia; [email protected] (C.A.O.); [email protected] (M.R.-J.); [email protected] (S.G.); [email protected] (D.V.); [email protected] (J.R.) 4 Laboratory of Genomic Diversity, Center for Cancer Research (FNLCR), Frederick, MD 21702, USA; [email protected] 5 Laboratory of Basic Research, Center for Cancer Research (FNLCR), National Cancer Institute, Frederick, MD 21702, USA; [email protected] 6 Laboratory of Genomics Diversity, Center for Computer Technologies, ITMO University, 197101 St. Petersburg, Russia; [email protected] 7 Guy Harvey Oceanographic Center, Halmos College of Arts and Sciences, Nova Southeastern University, Ft Lauderdale, FL 33004, USA 8 IDEXX Laboratories, East Brisbane 4169, Australia; [email protected] 9 Department of Biology, Shepherd University, Shepherdstown, WV 25443, USA; [email protected] 10 Animal Diabetes Australia, Melbourne 3155, Australia; l.fl[email protected] 11 American College of Veterinary Internal Medicine, University of Zurich, 8006 Zurich, Switzerland * Correspondence: [email protected] These authors contributed equally to this work. -
Serum from Pediatric Dilated Cardiomyopathy Patients Causes Dysregulation of Cardiolipin Biosynthesis and Mitochondrial Function Julie Pires Da Silva, Anastacia M
Serum From Pediatric Dilated Cardiomyopathy Patients Causes Dysregulation of Cardiolipin Biosynthesis and Mitochondrial Function Julie Pires Da Silva, Anastacia M. Garcia, Carissa A. Miyano, Genevieve C. Sparagna, Raleigh Jonscher, Hanan Elajaili, and Carmen C. Sucharov. University of Colorado Anschutz Medical Campus, Aurora, CO Dilated Cardiomyopathy (DCM) Hypothesis - Dilated cardiomyopathy (DCM) is defined as a disorder characterized by Using a novel in vitro model of DCM-related cardiomyocyte remodeling that dilation and impaired contraction of the left ventricle or both ventricles. reproduces the molecular characteristics of pediatric DCM, we hypothesized that the alteration of mitochondrial function in NRVM treated - DCM is the most common form of cardiomyopathy and cause of heart with DCM pediatric sera is associate with changes in cardiolipin content and failure in children older than 1 year of age with an annual incidence of 0.57 mitochondrial β-oxidation pathway. per 100,000 children. - The causes of heart failure (HF) in children differ substantially from those Results found in the adult population and children do not respond well to adult HF therapies. Cardiolipin (CL) - Cardiolipin is a mitochondrial dimeric phospholipid normally located in the inner mitochondrial membrane Figure 5. DCM serum induces significant changes in metabolite levels involved in fatty acid oxidation pathway in NRVMs. A. Heatmap of 41 - CL represent 12-15% of phospholipid mass in heart. In the metabolites differentially expressed in NF and DCM serum-treated NRVMs. n = 4 NF, n= 4 DCM samples, p<0.05. B. Pathway enrichment map analysis heart, 70-80% is (18:2)4CL. of differential metabolites between NF and DCM groups using Figure 3. -
Association of Gene Ontology Categories with Decay Rate for Hepg2 Experiments These Tables Show Details for All Gene Ontology Categories
Supplementary Table 1: Association of Gene Ontology Categories with Decay Rate for HepG2 Experiments These tables show details for all Gene Ontology categories. Inferences for manual classification scheme shown at the bottom. Those categories used in Figure 1A are highlighted in bold. Standard Deviations are shown in parentheses. P-values less than 1E-20 are indicated with a "0". Rate r (hour^-1) Half-life < 2hr. Decay % GO Number Category Name Probe Sets Group Non-Group Distribution p-value In-Group Non-Group Representation p-value GO:0006350 transcription 1523 0.221 (0.009) 0.127 (0.002) FASTER 0 13.1 (0.4) 4.5 (0.1) OVER 0 GO:0006351 transcription, DNA-dependent 1498 0.220 (0.009) 0.127 (0.002) FASTER 0 13.0 (0.4) 4.5 (0.1) OVER 0 GO:0006355 regulation of transcription, DNA-dependent 1163 0.230 (0.011) 0.128 (0.002) FASTER 5.00E-21 14.2 (0.5) 4.6 (0.1) OVER 0 GO:0006366 transcription from Pol II promoter 845 0.225 (0.012) 0.130 (0.002) FASTER 1.88E-14 13.0 (0.5) 4.8 (0.1) OVER 0 GO:0006139 nucleobase, nucleoside, nucleotide and nucleic acid metabolism3004 0.173 (0.006) 0.127 (0.002) FASTER 1.28E-12 8.4 (0.2) 4.5 (0.1) OVER 0 GO:0006357 regulation of transcription from Pol II promoter 487 0.231 (0.016) 0.132 (0.002) FASTER 6.05E-10 13.5 (0.6) 4.9 (0.1) OVER 0 GO:0008283 cell proliferation 625 0.189 (0.014) 0.132 (0.002) FASTER 1.95E-05 10.1 (0.6) 5.0 (0.1) OVER 1.50E-20 GO:0006513 monoubiquitination 36 0.305 (0.049) 0.134 (0.002) FASTER 2.69E-04 25.4 (4.4) 5.1 (0.1) OVER 2.04E-06 GO:0007050 cell cycle arrest 57 0.311 (0.054) 0.133 (0.002) -
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase