The university of Winnipeg student weekly NOV 02, 2006 vol. 61 Issue 08 e-mail » [email protected] on the web » uniter.ca 10 16 02 21 apathy towardsool sp schorts teamstakes toll Wesmen lea and strivesforsmethingselfish K-OS journeysbeyondthes uperficial information vsknwledgeinthenlineencyclpediadebate What's inawiki? Rash ofbreak-inslea Round uptheornBandits! ve studentgroupsvulnerable,disgsted ve studentscold 1 Sports Listings 21 Arts&Culture 18 Features 13 Diversions 10 Comments 09 News 07 02 inside 2006/11/020 SSUE I VO ♼ L U 8 ME 61 November 2, 2006 The Uniter contact: [email protected] 0 NEWS

UNITER STAFF News Editor: Richard Liebrecht Senior Reporter: Derek Leschasin News Editor: Whitney Light E-mail: [email protected] E-mail: [email protected] E-mail: [email protected] Managing Editor News Jo Snyder » [email protected]

Business Manager James D. Patterson » [email protected] Porno bandits raid student services NEWS ASSIGNMENT EDITOR Richard Liebrecht » [email protected]

News Production Editor Ksenia Prints Whitney Light » [email protected] Beat Reporter

COMMENTS EDITOR Brad Hartle » [email protected] ecent break-ins in the Bulman Diversions EDITOR Centre during the last three Matt Cohen » [email protected] Rweeks reveal more than just a theft problem on campus. The intruders ARTS & CULTURE EDITOR broke in not to steal, but rather to surf Mike Lewis » [email protected] pornographic websites. Targets included the offices of EcoMafia, Peer Support LISTINGS Coordinator and the Womyn’s Centre. This demon- Nick Weigeldt » [email protected] stration of the university’s vulnerability SPORTS EDITOR raises questions about students’ secu- Mike Pyl » [email protected] rity on campus. “It’s against school policy. You’re not COPY & STYLE EDITOR allowed to use pornographic websites PHOTO: NATASHA PETERSON Brendan Johns » [email protected] on university,” says a source at EcoMafia who prefers to go by the pseudonym L- Student groups experience saucy break-ins. PHOTO EDITOR Man. He believes that the only reason Natasha Peterson » [email protected] student groups were targeted is because SENIOR REPORTER their computers lack protection. Derek Leschasin » [email protected] EcoMafia was broken into twice, on The Womyn’s Centre has had three think it is violent, but it doesn’t scare me. Oct. 14 and 17. Responses were mixed documented break-ins within the last No one’s gotten hurt, so I don’t want stu- STAFF Reporter among members. “I wouldn’t even con- three weeks, but Ross believes many dents to be afraid in the Bulman centre Kenton Smith » [email protected] sider it a real crime, but certain mem- more might have happened. “Usually, or any other [place] on campus.” they happen over the weekends. But they Nonetheless, Vivian Belik, the Beat Reporter don’t steal anything, so sometimes they UWSA’s Vice President of student ser- Ksenia Prints [email protected] » might be there and I don’t even know.” vices, believes the break-ins are part of Usually, (the break-ins) In one instance at the Womyn’s the bigger issue of public safety. “This Beat Reporter Michelle Dobrovolny » [email protected] Centre, the intruders left an unwanted university should make it a priority to happen over the weekends. gift. A bottle filled with a white fluid of secure these areas. But students should PRODUCTION MANAGER & GRAPHICS EDITOR unknown origins was next to the com- also be aware. When they walk around at Sarah Sangster » [email protected] But they don’t steal anything, puter. “They left something for us to see, night they should pay attention to their to assert their presence and [show] it’s surroundings.” so sometimes they might be hilarious,” says Ross. Closing the university down to out- t h i s w e e k ’ s contributors The criminal’s identity has not been siders is not the solution, says Belik. there and I don’t even know.” released to the public as he is still de- “The university is a public space, and Jonathan Oliveros Villaverde, Josh Boulding, tained by police. He has been charged you want to keep it open to the public. Scott Christiansen, Kalen Qually, Dan Verville, –Kelly Ross, with a criminal offence of an undis- But it should be designed so there are no Michael Banias, Stephen Spence, Dan Hugyhebaert, Womyn’s Centre closed nature. Caught carrying break- dead-end hallways in the basement.” Ben MacPhee-Sigurdson, Erin McIntyre, Brooke Dmytriw, Kristy Rydz, Denis Vrignon-Tessier and-enter tools and pepper spray, he Ross and Belik believe increasing provided sufficient incriminating evi- security patrols in the Bulman Centre is dence. crucial. “A lot of them sort of forget about The Uniter is the official student newspaper of the University of Winnipeg and is published by Mouseland Press Inc. bers of our group are really offended David Mauro, Director of Security the Bulman centre, and until last week I Mouseland Press Inc. is a membership based organization in which students and community members are invited by it,” says L-Man. “It’s just a horny kid and Community Ambassador Services, never saw security walking through this to participate. For more information on how to become a wanting some porn. He didn’t even take sees no cause for alarm on campus. area,” Belik says. member go to www.uniter.ca, or call the office at 786-9790. The Uniter is a member of the Canadian University Press and anything.” “We’ve had entries, and some haven’t Following these events their traf- Campus Plus Media Services. During his last stunt at EcoMafia, even been defined as breaches of the fic in the area has been noticeably in- SUBMISSION OF ARTICLES, LETTERS, GRAPHICS AND PHOTOS ARE WELCOME. Articles must be submitted in the culprit was caught in the act by law, as there was no forced entry.” He creased. “We have limited resources, text (.rtf) or Microsoft Word (.doc) format to [email protected], Kelly Ross, coordinator of the Womyn’s adds that he has “no reason to suspect and it’s a big campus,” says Mauro. He or the relevant section editor. Deadline for submissions is 6:00 p.m. Thursday, one week before publication. Centre. She believes there are others. “I there is a threat to the students.” explains that the Bulman Centre’s prob- Deadline for advertisements is noon Friday, six days prior to publication. The Uniter reserves the right to refuse to print think it’s a group of friends that are all Ross agrees, and views these as un- lematic design and security’s lack of submitted material. The Uniter will not print submissions letting each other in on the free porn.” pleasant, but isolated occurrences. “I manpower have made the situation dif- that are homophobic, misogynistic, racist, or libellous. We also reserve the right to edit for length and/or style. ficult to fix. Deadbolts seem to be the best, CONTACT US » but most expensive, option. According General Inquiries: 204.786.9790 to Belik, the enormous sums needed Advertising: 204.786.9779 Editors: 204.786.9497 to secure all student groups will come Fax: 204.783.7080 out of “the student’s pocket.” She be- Email: [email protected] lieves, however, that most would be in LOCATION » favour of the effort, as safety seems to Room ORM14 be everyone’s main concern. University of Winnipeg 515 Portage Avenue Mauro says, “The locking system Winnipeg, Manitoba R3B 2E9 in the Bulman Centre was designed for convenience, which always compro- mises integrity.” As for the price, “The Cover Image reality is that the cost [of a deadbolt] is pretty minimal,” he says. “There’s no free lunch…If you want more secu- Defying Gravity rity and somebody wants to pay for it, by Rhian Brynjolson I’ll do that too.” On Oct. 25 Mauro sat down with Showing at the GrafittiG allery the Belik and student groups’ repre- sentatives to discuss and, hopefully, choose a solution. For now, all eyes should keep a lookout for additional porno bandits. contact: [email protected] The Uniter November 2, 2006 NEWS 0

their male counterparts. They receive differ- ent questions based on image and gender,” Sexism in the House? says Grace, who has researched community- based group advocacy and women’s political MacKay’s ‘dog’ comment sparks broader debate activism. While some would call MacKay’s com- ment an isolated and personal outburst, Kristy Rydz The comment came during a debate According to University of Winnipeg others might easily draw links between it over the Conservative government’s envi- Canadian politics professor Joan Grace, and the Conservative government’s recent ronmental policy, where background heck- women are actively discouraged from the removal of the word ‘equality’ from the mis- oreign Affairs Minister Peter MacKay ling led to a question about the effects of federal field by situations cultivated within sion statement of Status of Women Canada is facing allegations of referring to policies on MacKay’s much publicized dog. and the pulling of $5 million from its fund- FBelinda Stronach, his ex-girlfriend In response, MacKay allegedly pointed to ing. and former Conservative, as a ‘dog’ in the Stronach’s empty seat and said, “You al- “Many government members have ar- House of Commons during debate on Oct. ready have her.” The two had been romanti- It’s well documented that ticulated that women are viewed as a special 19. While the firestorm of press and backlash cally linked in the Conservative Party before interest group. As part of their social conser- has quieted to a mild rumble, the impact of Stronach crossed the floor to become a women do confront different vative agenda, they are attempting to push the derogatory remark on women’s status Liberal in May 2005. women back to their ‘social domain’ as care- and future in politics has been significant. Since the alleged comment was made, political realities than their givers and homemakers and push them out Women with political aspirations or MP’s have called MacKay’s language and ac- of the political arena,” says Grace. even those currently involved in the field may tions unparliamentarily and Stronach her- male counterparts.” After being hammered with accusa- be highly discouraged. “Anything that hap- self has asked for an apology to the House. tions during question period, MacKay has pens to a woman in politics is highly publi- Jack Layton, NDP party leader, and numer- –Joan Grace, denied the slur, saying, “I made no such ges- cized. Women don’t necessarily want their ous female Liberal MPs have called for him U of W ture. I made no derogatory or discriminatory dirty laundry aired in public,” says Natalie to resign his cabinet post. professor of politics remarks toward any member of the House. ” Duhamel, President of the Manitoba wing of Initially, Speaker of the House Peter This, however, was not MacKay’s first ques- the National Women’s Liberal Commission Milliken ruled that because the comment was tionable comment. Last January he told of Canada and daughter of the late-MP Ron not overtly audible and thus not recorded by the current political climate. “The House of Alexa McDonough to “stick to her knitting” Duhamel. “Comments like these in general Hansard, he could not make a ruling. Later Commons is an unwelcoming site of politics when she inquired about a constituency certainly impact women’s decisions to enter in the week however, the Speaker agreed to for women. It’s well documented that women race in Nova Scotia. politics.” review his ruling. do confront different political realities than

enter Parliament with honourable intentions”). port, which is a very common issue today.” In 2002, the BBC featured him on their list of Fawkes sends an empowering message of Guy Fawkes Canada? 100 Greatest Britons, and he inspired Alan action, but “not necessarily by violent means.” infamous political anti-hero has his day Moore’s famous revolutionary graphic novel, V for Vendetta, which later turned into a block- buster movie. Wesley Stevens, a professor in European Ksenia Prints People put on costumes, politics and history, recognizes the holi- Beat Reporter day’s morphing. “Historically, it changed,” run around the streets, set he says. “Just like All Saints Day, which is now Halloween, it is now a time of celebration.” ay the words ‘government overthrow’ and fires, and don’t blow up The question is, should an attempted ter- many people think ‘French Revolution.’ rorist act, even a failed one, be glorified? In SSay ‘terrorism’ and most think ‘9/11.’ But any buildings.” the 21st century, this is a great debate. V for consider this: the story of Guy Fawkes (the his- Vendetta’s release was delayed for its sensitive torical account, not V for Vendetta) combines –Wesley Stevens, material following the 2005 subway bombings both acts. Recently, like all things British, this U of W professor of history in London. Surprisingly, the Brits themselves legend and its autumn celebration has been went out and celebrated the day’s 400th anni- seeping through the ice into Canada. versary with much festivity that year. This year in Winnipeg, Fawkes night is attack on the stronghold of British democratic Stevens thinks there is no reason to coming to the Collective Cabaret’s “FAWKES power, the Parliament. The group was to strike fuss about the day, as it is all in harmless fun. With Your Head” party. Jaymez, a performing on the eve of Nov. 5, when both houses and “People put on costumes, run around the artist and a member of the Winnipeg Wrath King James I would be present. Unfortunately streets, set fires, and don’t blow up any build- Network, the party’s organizer, explained that for the group, news of the conspiracy reached ings,” he says. the theme was accidentally stumbled on. “We authorities. On the morning of Nov. 5 Guy Guy Fawkes night has also been long cel- usually do a Halloween show, but there’s always Fawkes was caught and arrested with 36 bar- ebrated in Newfoundland, but lately it has so much going on,” he explains. When Franny, a rels of explosives in a cellar under the House of spread across Canada. For several years a group Scottish artist, suggested his native Guy Fawkes Lords. After several days of torture, Fawkes and in Calgary has made an annual bonfire, inviting night, it seemed like a great idea. others were executed in a gruesome display of all to burn images of public and private figures. According to Jaymez, the Fawkes story hanging, drawing and quartering in front of The humorous coating of the event should suf- also had appeal: “It’s an interesting holiday Parliament. Bonfires were lit all over London in fice to calm objectors, but it does not with interesting political undertones.” He says celebration. answer why the event has been im- it can be seen as very relevant “with the state Since then, Nov. 5 became a wildly popu- ported to Alberta. The Lexicom group of politics at the moment.” But he admits it is lar fireworks and bonfire celebration in the UK that hosts the bonfires could not be too extreme. and former British colonies. What was origi- reached for comment. Guy Fawkes was a Christian religious ex- nally meant to symbolize Fawkes’ failed plan Jaymez thinks Fawkes can be tremist who wanted to return England back has now turned into a confusing idolization seen as a positive role model. “I don’t under the rule of the Roman Catholic Church ritual. Children dress up as Fawkes, sing him think of it as an act of terrorism, but in the early 1600s. To do so, he joined a group of praise songs, and even coin sayings in his name as acting out for what you believe in, zealots, and together they planned an elaborate (Fawkes is said to be “the only man to ever against a government you don’t sup-

Think you’re friggin’ funny, eh funny (non-gender You know who the hottest non-mainstream band specific) guy? in Canada is?

Come on out to our Diversions meetings every Friday Come on out to our Arts & Culture meetings every afternoon at 1:30 p.m. in The Uniter office, room Wednesday afternoon at 12:30 p.m. in The Uniter Volunteer for The Uniter ORM14 on the mezzanine in the Bulman Centre. office, roomOR M14 on the mezzanine in the Bulman Centre. Tired of having other people write the news? Like sports but don’t totally feel like playing them?

Come on out to our News Storyboard meetings every Come on out to our Sports meetings every Monday Monday at 12:30 p.m. in The Uniter office, room afternoon at 12:30 p.m. in The Uniter office, room ORM14 on the mezzanine in the Bulman Centre. ORM14 on the mezzanine in the Bulman Centre. November 2, 2006 The Uniter contact: [email protected] News Editor: Whitney Light E-mail: [email protected] Phone: 786-9497 0 NEWS Fax: 783-7080 Canadian Hungarian expats observe 50th anniversary of 1956 uprising Michelle Dobrovolny & World Beat Reporter

News BriefS ungarian expatriates are commem- orating the 50th anniversary of a Compiled by Brooke Dmytriw Hbloody revolution that marked a turning point in Soviet-era Communism. But the effects of the 1956 Hungarian Uprising PANAMA CITY—A national referendum de- were felt far beyond the Iron Curtain as an cided that the Panama Canal would be enlarged, adding exodus of 200,000 Hungarians spread across a third set of locks to the passage. The Panamanian the globe. The Hungarian community in government will begin the $5.25 billion construction Winnipeg, numbering just over 6,300, is project in 2007. When complete, it will double the largely made up of refugees from this period. Canal’s capacity. The expansion is considered neces- “Lots of Hungarians came during sary; the new set of locks will allow vessels larger than the Second World War, but most of the the 108-foot-wide sections of the inland waterway to Hungarians in Winnipeg arrived after 1956,” pass. It will be the largest undertaking in the Panama says Aniko Bernatsky, one of the organizers of Canal’s 92-year history and will take up to eight years a commemorative ceremony held Oct. 23, the to complete. The Asssociated Press reported that day the Uprising began. “Out of the 200,000 President Marin Torrijos was quite pleased with the ref- who left after the revolution, 38,000 came erendum’s outcome. The project is intended to create to Canada. We are actually very grateful to approximately 40,000 jobs. Currently the Canal em- Canada for taking us in.” ploys 8000. Construction will be paid for by increasing Bernatsky was a 13 year-old girl when

tolls. The Panama Canal Authority is the independent Red Army troops laid siege to Budapest to Soviet tank rides through Budapest during the 1956 Hungarian Uprising. FILE PHOTO government agency that controls the waterway and it silence the thousands of Hungarian protes- will oversee the expansion project. The Canal was built tors calling for democracy. Half a century by the U.S. and it administered the canal’s usage until it later, her voice still resonates passionately handed over control to Panama on Jan. 1, 2000. as she recalls the mayhem that took over her The most important Olga Borbely, the owner of Olga Fashions SANTIAGO­—Former Chilean President city. Though Bernatsky was kept sheltered in on Corydon Avenue, arrived in Winnipeg in Augusto Pinochet is suspected of stashing nine tons the family apartment through the most vi- thing was that, even for those 1958. She was a young adult of 25 at the time of gold with HSBC in Hong Kong. This new informa- olent times of the 12-day Uprising, hunger of the Uprising, and remembers the brief vic- tion comes as no great surprise to the Chilean govern- forced her to venture outside into Budapest’s few days, people felt free tory achieved by the Hungarian resistance as ment which is already prosecuting Pinochet for embez- District 8, one of the most tumultuous areas. a significant moment. zlement and tax evasion. Pinochet came to power in While making her way through the riotous because they were fighting “The most important thing was that, 1973 after a political coup deposed Salvador Allende. street, she saw Soviet tanks approaching, even for those few days, people felt free be- During his 17-year rule, Pinochet authorized numerous and quickly took refuge in a nearby apart- the oppression of the Russian cause they were fighting the oppression of human rights violations including torture, abduction, ment. From the doorway, she watched as an the Russian occupation.” and unlawful imprisonment, in addition to the deaths old man, who had been walking in front of occupation.” Cold War historians call the 1956 of an estimated 300 to 5000 Chileans. The government her just moments before, was taken by sur- Hungarian Uprising a watershed event, has approached a special prosecutor to investigate the prise and left unable to protect himself in the –Olga Borbely, marking the first attempt to overthrow a accusation. According to Reuters, the foreign minis- middle of the road. The tank shot him down. witness of the Hungarian Uprising Communist government in Eastern Europe. try received the allegation and forwarded it to the State “Just a few more steps and it could have The Soviet Union continued to rule Hungary Defence Council which is prosecuting Pinochet. The been me. I wouldn’t be here today.” until the collapse of the Eastern Bloc retired dictator has been charged with other economic She spent the next two months hiding in Communist regimes in 1989. crimes including the evasion of taxes on $27 mil- the apartment building’s coal cellar, afraid to recalls nine “beautiful days” when protestors Bernatsky says the implications of the lion supposedly scattered in over 100 bank accounts risk the walk home. had successfully reinstated Hungarian Prime Uprising should not be overlooked. around the world. Pinochet’s lawyers have claimed the Though Soviet troops eventually quelled Minister Imre Nagy, who had been forced out “It’s important not just for Hungarians, 90-year-old is unfit to stand trial for mental and physi- the resistance and installed puppet Prime of leadership the year before for his liberal but for all of Europe. It changed the picture of cal health reasons. Minister Janos Kadar, the Uprising saw a brief policies. the whole of Europe,” she says. “The Russians VANCO­UVER—City mail carriers walked victory before 2,800 Hungarians were killed “We were going outside and everybody saw that they couldn’t handle things in such a out briefly Oct. 26 for refusing to carry anti-gay ad in the Soviet attack launched Nov. 4 that de- was hugging each other, regardless of faith hard way, so they began to loosen up. That’s mail. Letter carriers from Station F in Vancouver were finitively put an end to the fighting. Bernatsky and everything,” she says. why it’s an important date for everyone.” told they had to deliver the pamphlet The Prophetic Word or face disciplinary action from Canada Post. The letter carriers union viewed the pamphlet as homo- phobic and offensive and, therefore, called it hate mail. What could be done to The ad mail contained an article titled “The Plague of improve school spirit at U of W? this 21st Century: The Consequences of the Sin of Homosexuality (AIDS).” Canada Post spokeswoman, Colleen Frick, said the mail did not violate the Canada Post Act and was deliverable. The Canadian Press re- Sandy Klowak – Well, I do see postings Adam Rothenberger – I don’t see a ported that Frick also said the letter carriers do not for different events happening on campus. lot of advertisements for events on campus. Maybe I’m just looking in the wrong places. have the right to refuse delivery, as the contract be- But we don’t have a bar, like U of M does. I think having a bar on campus could con- As for Wesmen games, when I listen to tween the Corporation and union obliges them to de- tribute to a lot more activity and excitement CKUW I don’t hear much about them or when liver mail that the Canada Post designates acceptable. here. We need a place that would encourage they are happening. More banners, like the The pamphlet was considered unaddressed ad mail students to stay and hang out a while. ones near the escalators, would help. Also, and had already been distributed to other parts of the the schedules for Wesmen games should be posted in a conspicuous spot. country without protestation from those letter carriers. The Canadian gov- NIAGARA-O­N-THE-LAKE— John Forrest – We need more events like Ann Perez – We need to get the word out ernment voiced its displeasure over an American the rock climb. That event brings people about events. I see flyers and advertisements, election advertisement by the Bush administration. together. Maybe if we had a campus bar but there are not enough organized activities. U.S. Ambassador David Wilkens responded to the there would be more camaraderie. I think the We shouldn’t have just one-time events, like UWSA is in its own little bubble. They could socials near holiday time. The activities need complaint by saying Canadians were culpable of at- provide more leisure activities for students, to be broader and constantly happening. A tacking the U.S. as well. The advertisement in question like instituting a TV room for example. survey of students would be useful for gen- is a commercial for a Tennessee senator that insinuates erating ideas. Myself, I would be interested Canada lacks aggressiveness in its foreign policy. The in seeing movies. For example, I went to see ad states, “Canada can take care of North Korea. They’re some films that the Filipino Students As- Lisa Morwick – I never know what’s going on! But I like the big banners sociation hosted because they weren’t films I not busy,” reported the Canadian Press. The ambassa- near the escalators; those help. We need more events that would encourage would normally have the chance to see. dor followed up by saying that the ads were baseless, students getting to know one another. The DIY workshops are good for that. but that Canadian politicians were just as contempt- I saw the clothing alteration workshop ads, and I would go to something ible with their advertising campaigns during the federal like that. That sort of thing helps students to meet more people and get involved on campus. What I really find helpful, though, is when speakers election. The commercials have since been pulled. It make presentations about campus activities during class time. was Canadian Ambassador Michael Wilson who con- tacted the administration about the ad. contact: [email protected] The Uniter November 2, 2006 NEWS 0 Protest calls for peace in Afghanistan

ments that fueled the march. Two women car- Stephen Spence ried an effigy of George W. Bush with a stuffed monkey on his shoulder while two protestors towards the rear played guitar and banjo, sing- t 1 p.m. on Oct. 28, to mark the fifth ing songs of opposition. anniversary of the invasion and occu- Counter-protesting the march were A pation of Afghanistan, protestors in 34 two people dressed in clothing they claimed cities across Canada staged demonstrations was from Afghanistan. Richard Gordon wore calling for Canada to bring troops home and a chitrali hat, typically worn by the Afghan claimed solidarity with the Afghan people. Northern Alliance, and Nathalie Gordon wore Organized by the Canadian Peace a full length burqa. Both also claimed to be Association and participated in by members of standing in solidarity with Afghan’s, stat- Prostesters meet with anti-protesters at Saturday's rally. PHOTO: NATASHA PETERSON many local and national activist groups—Food ing that Hamid Karzai is the democratically Not Bombs, The Canadian Labour Congress, elected leader of the Afghan people and that the Manitoba-Cuba Solidarity Movement, income has risen 50 per cent in the past five for Research and Globalization. Professor The title of the lecture, “War Games in and others—the Winnipeg response consti- years. Holding up their dyed-blue fingers to Chossudovsky argued that the Afghanistan the Middle-East,” referred to war games being tuted a march from Central Park, at the corner signify the vote, they contended that “not a invasion was a pre-planned war—justi- conducted by Iran and its unofficial allies, of Ellice and Edmonton, to the University of single Afghani or Afghani organization sup- fied fallaciously by the events of Sept. 11, including Russia, China and former Soviet Winnipeg Bulman Centre where a forum and ported the march” and that the protestors 2001—in order to establish a monopoliza- Republics, in response to a current nuclear seminars were held until 5 p.m. were “the enemies of the Afghan people” be- tion of middle-eastern oil. He said that the threat by the US and allied European coun- In total about two hundred people cause of their opposition to the presence of restructuring of military organizations such tries. In Chossudovsky’s opinion, this escala- marched down Portage Avenue, gathering Canadian troops. Though they did follow the as NORAD and NORTHCOM permit for tion is the “most serious crisis in modern his- steam as newcomers joined and cars honked in march, receiving coverage from other media the mobilization of American forces on tory, following its own logic.” The solution support. Protestors included people of all ages groups like Global Television, they did not par- Canadian soil and that technological is to “disarm a military agenda by revealing waving banners reading “9/11 was an inside ticipate in the Bulman Centre forum. advancements, combined with intended the falsehoods behind the military invasion job,” “Peace is Patriotic,” “Support Our Troops, The focus of the forum was a lecture political legislation, have broken the of Afghanistan, beginning with 9/11” and to Bring Them Home,” and “Hail Harper,” giving by Professor Michael Chossudovsky of the boundary between conventional and “target the legitimacy of the political actors” a sense of the source and direction of senti- University of Ottawa, Director of the Centre nuclear weapons. who are perpetuating current military trends.

Province to Rehabilitate FIRST Ever General Meeting Abandoned Mines of Mouseland Press INC.!

Derek Leschasin “The idea that always hits the headlines Senior Reporter is of mines as some kind of ‘lethal legacy’,” said Younger, identifying the three types of November 16, 2006 at 12:30 p.m. pollution mines generate: air and soil, which Location: ORM06 UWSA Board Room (in the Bulman Centre) n the quest to extract resources from are “generally highly localised,” and water. the earth, some of the scars humans “Water is by far the most common re- Since Spring 2006, Mouseland Press has brought you the official student newspaper Ileave last longer than others. One of the ceptor and vector of mine pollution,” of the University of Winnipeg, The Uniter. The new organization gives student and most visible and long-lasting is the legacy of said Younger. “This can have effects that community members an opportunity to directly shape the future of The Uniter. Don't mining. In Manitoba alone, there are over extend hundreds of kilometers down a river miss the chance to have a say in how your paper is run. 200 abandoned or ‘orphaned’ mines, which system.” the Province is currently in the process of The main form of water pollution from For more information on becoming a member of Mouseland Press call 786-9790. surveying and evaluating for environmental mines is known as Acid Mine Drainage, which and safety reasons. occurs when water flows through an -aban doned mine and interacts with the rocks con- The agenda of the meeting will be as follows: taining sulfur-bearing materials. When this water escapes from a mine, the high acidity 1. Openings The idea that always hits of the water can kill aquatic life and contam- 2. Elect a Chair for the meeting. inate drinking water. Chemicals and heavy the headlines is of mines as metals can also escape in this way. Older 3. Elect a Secretary for the meeting. mines took few precautions towards this 4. Approval of Mouseland Press By-Law No. 1 some kind of ‘lethal legacy.’” possibility. 5. Approval of Mouseland Policy (code of conduct, hiring, etc.) In addition to pollution, abandoned 6. Elections: –Professor Paul Younger, mines can present safety issues, especially a) Presentation of candidates Newcastle University water-filled shafts that may be partially hidden. This is a particular problem in some b) Voting northern Manitoba mines, according to Caius c) Results Priscu of AMEC Earth & Environmental, 7. Members' business Abandoned mines are not just a pro- which in 2005 was contracted by the Province 8. Adjournment vincial, but a national and global problem. to conduct a survey of Manitoba mines, and The term refers to disused mines for which ranked them on a hazard level. the owner cannot be found, or is unwilling or Many mines were started in the early For information on nominations for board positions, items for discussion at the meet- unable to carry out rehabilitation. 20th century in remote wilderness areas ing, or any other inquiries regarding the new organization, call The Uniter at 786-9790 or the Mouseland Press Chair Vivian Belik at 786-9781. Presented with a common problem, and are long-abandoned, virtually forgot- about 100 delegates met at the Viscount ten. However, many of these areas still have Gort last week for a workshop, hosted by significance for aboriginals, and present a See you there! the National Orphaned/Abandoned Mines hazard. Initiative, to discuss best practice for reha- “We are looking at between ten and fif- bilitating orphaned mines. Perspectives and teen high hazard sites,” said Priscu. experiences from across the country were In September, the Provincial govern- presented, and keynote speaker Professor ment committed $70 million to rehabili- Paul Younger, from Newcastle University, ex- tate abandoned mine sites. This year, $4 mil- plained the lessons learned in Britain’s ef- lion will be spent on projects at Lynn Lake, forts to clean up its legacy of mining. Ruttan, Sherridon and Snow Lake. November 2, 2006 The Uniter contact: [email protected] News Editor: Whitney Light E-mail: [email protected] Phone: 786-9497 0 NEWS Fax: 783-7080 The most important thing is the freedom to choose Exiled Zimbabwean journalist tells his story

Amanda Stutt demands. But Inter-Africa, which had a large in criticism." dare think about in Zimbabwe,” he said. “Here The Ubyssey (University of British Columbia) foreign readership and was only partially de- The government has also banned the BBC you can criticize and be criticized. As long as you pendent on the government, chose not to follow and other foreign news agencies, he added. have the facts to back you up, you can write all suit for the most part. In Zimbabwe, officers of the country’s you want about Stephen Harper, the Governor VANCOUVER (CUP) -- Imagine living in “We stuck to our guns and we wanted to Central Intelligence Organization routinely im- General . . . about anybody in political offices. a country where the civil liberties we take for be professional. We wanted to be able to criti- plement a form of questioning that is threaten- But in Zimbabwe, even phones are monitored.” granted are not a reality, human rights are not cize government and criticize the opposition,” ing and intimidating against journalists who Madawo believes democracy is good for protected, everyday life is under the control of he said. don’t co-operate, and police brutality against all Africa. “For everybody, no matter where you are government and police forces are notorious According to Madawo, reactions to that forms of political protest are well documented. . . . the most important thing is the freedom to for quashing dissent with harassment and vio- stance “didn’t go down very well.” As a resident of Toronto, Madawo has choose.” lence. “[The government] really cracked down on found part-time employment freelancing as a He believes that democracy is a controver- Repression and brutality are the unfortu- us,” he said, adding that the editor-in-chief for columnist for the both the Toronto Star and the sial subject for Africans, because “democracy nate reality for many journalists who have dared Inter-Africa was forced out and the other editors Catholic Register. in Africa is understood differently than in the to defy their governments. Some, such as 36- were frequently threatened and intimidated. He also operates a blog site, which he uses Western world . . . Here, democracy is freedom year-old Innocent Madawo of Zimbabwe, have “Some gave in,” he explained. “I’m one of to voice his opinions on political matters both of speech, freedom of association.” sought asylum in Canada. those who said no.” back in Zimbabwe and here in Canada. He said But in Africa, he said, he feels the imple- Many exiled journalists in Canada have Madawo recounted that other journalists he feels privileged for these opportunities, but mentation of democracy can’t reconcile the joined the Canadian Journalists for Free were being jailed, tortured and even murdered also said that many journalists in his same posi- deeply ingrained tradition of respected elders. Expression, a Toronto based non-governmen- for criticizing the government. He feared a sim- tion have had difficulty finding work in Canada, He explained that according to traditional tal organization that supports the rights to free- ilar fate. even though they’ve been here for years longer social mores, “You may not speak out against dom of expression. “I was either going to give in, or I was going than him. elders . . . There is a rigidity . . . a family dicta- Madawo came to Canada a year ago after to keep doing what I was doing and get into a Madawo said there exists a perception in torship, and this has spread to areas of gover- being driven into exile for steadfastly maintain- situation where I [could be] tortured or killed.” Canada that foreign journalists lack “Canadian nance. ing a critical stance against his government. He In 2001, he decided to leave Zimbabwe experience.” “Dictators like Mugabe take advantage worked for the Zimbabwe Inter-Africa News with his wife, also a journalist working for a pri- “If someone denies me a job because I of that tradition of respecting elders,” he said, Agency, and had risen through the ranks to vate newspaper critical of the government. don’t have and then I get Canadian experience and “they abuse that traditional norm and become deputy news editor. He wrote political After a brief stay in Texas, Madawo and his and five years down the line, if I still don’t have a then extend it further . . . into violating human and business features for print, television and wife came to Canada as political refugees. He job, then it becomes to me, discrimination.” rights.” radio. said he is currently awaiting residency status. Madawo said he feels the industry should Zimbabwe is home, he said, and although In 2000, elections brought Robert Mugabe Madawo explained that he didn’t want give foreign journalists “the chance to prove he has plans to go back eventually, that is not a into power. The Mugabe government began re- to leave Zimbabwe, which he still considers ourselves.” possibility now. vamping journalism in Zimbabwe, explained his home, and had hoped that things would He also said he believes being a journal- “I have said too much,” he said, explain- Madawo, turning the press into a “propaganda change. ist in Canada affords him much greater liberty ing that he doesn’t believe he would even be tool.” “But they didn’t change,” said Madawo. in terms of the rights to freedom of expression, allowed to get off a plane in Zimbabwe. “If Madawo explained that most news organi- “They got worse. The Mugabe government and the ability to speak out in criticism of gov- things change, if democracy is re-established in zations in Zimbabwe were purely government- is still in power and is still harassing and ernments, and broader societal topics. Zimbabwe, then I would go back”. funded and quickly caved to any government jailing journalists who speak out against them “The things that I write about, I wouldn’t

Protesters hold funeral for the future on Parliament Hill Ottawa youth demonstrate against Clean Air Act

Amy Kishek chemistry at the University of Ottawa, have condemned the new act since its Canada’s North. The Fulcrum (University of Ottawa) did not have confidence in the govern- release, saying that it does not address Once on the Hill, the group grew in ment’s plans to address environmental the problem of greenhouse emissions size to approximately 60 participants, issues. quickly enough. and protesters began their mock fu- OTTAWA (CUP) – Youth from “It is designed to fail in its very The bill, which aims to cut emis- neral. The ceremony involved a Grim across Ottawa gathered on Parliament purpose. It is a perfect example of sions in half by the year 2050, does not Reaper placing inside the coffin ob- Hill on Oct. 18 to protest the Conservative stalling tactics. All the act meet the demands of the Kyoto Protocol, jects the protestors felt would be of no Conservative federal government’s en- does is continue to legislate and reduce which calls for the wealthiest nations to use in the future due to climate change. vironmental agenda in anticipation what is covered under the Canadian reduce their emissions to five per cent Items included hockey skates, a toy of the tabling of the Clean Air Act the Environmental Act, which could have below 1990 levels. polar bear, skis, and the Declaration of next day. simply been amended,” Cunningham All three opposition parties have Human Rights. Even before the act was presented said. indicated that they will vote against After half an hour of protesting, the in Parliament on Oct. 19, Graeme The Clean Air Act has also received the Clean Air Act, meaning the minor- event concluded, though it did not mark Cunningham, a graduate student in bio- criticism from opposition MPs, who ity Conservative government will not the end of CYCC’s efforts. be able to pass the act, and it will not “The CYCC will not stop until the become Canadian law. Kyoto commitment is met, regardless Cunningham, president of the of which political party is in govern- University of Ottawa Greens, orga- ment,” said Powless before encouraging nized the protest with Ben Powless of protesters to participate in the Nov. 4 Carleton University. The event was one International Day of Action on Climate of many held across the country under Change. the banner of a new organization, the Jill Thursby, a first-year interna- Canadian Youth Climate Coalition tional development and globaliza- (CYCC), which seeks to have the gov- tion student at the U of O, was stopped ernment address the issue of climate by Parliament Hill security for plac- change, as well as renewed commit- ing CYCC flyers on the windshields of ment to the Kyoto Protocol. Senators’ cars. She explained her mo- The protest began with a “funeral tives for attending the protest. procession” from the Ontario Public “If everyone knew the extent of Interest Research Group’s office on the damage we do to the environment every U of O campus up to Parliament Hill. day, more people would be taking the Students dressed in black marched streets in protest . . . Having targets set downtown carrying a large black coffin, for the year 2050 is absolutely ridicu- chanting and following the lead of an- lous,” she said. “At the rate this govern- other event organizer sporting a polar ment is going, my life will be over before bear costume to illustrate the harm any environmental gains are made.” being done to the environment of contact: [email protected] The Uniter November 2, 2006 EDITORIALS 0

Managing Editor: Jo Snyder Comments Editor: Brad Hartle Editorials E-mail: [email protected] E-mail: [email protected]

Dear Mr. Katz and ladies and gentlemen of the new Winnipeg City Council

Nick Weigeldt outs anywhere approaching 50 per cent. bating in front of students, relates directly aesthetic steps forward, and then return Listings Co-ordinator In the meantime, the numbers of stu- to this: How are you going to keep the to Winnipeg only to find more roads ser- dents and young people voting was much, young, educated and creative population vicing more developments, a repeatedly much less than that, a reflection of not only in Winnipeg for the long haul? So while it shelved rapid transit plan, and an empty, ongratulations are in order – the apathy, but a lack of trust and optimism was actually being discussed, the answers often scary, downtown? people who have spoken did, for they have in Winnipeg’s future. As my col- nonetheless failed to inspire many of those So, to the current city council, I say the C most of you anyway, overwhelm- league Mike Pyl wrote in the Oct. 19th issue exact same young people. Just like the city world, or at least this city, is your oyster; go ingly, giving council a fairly strong man- of The Uniter, “cities can be bold, exciting, has in many ways. above and beyond those election promises date to govern the city for the next four and vibrant. They can inspire passion, pro- Young people are naturally curious you made and surprise the many cynics years. If there’s going to be a time when voke creativity, and drastically enhance about the world, and will travel and live out there who don’t hold high hopes for confidence amongst you as a group would one’s quality of life.” Add to that a good elsewhere no matter what, because it’s the the next four years. Winnipeg is at a cross- be at a record high, it is likely going to job in our particular fields, and for many easiest time to take a break from the “real roads; with so many cities across the coun- be now. There’s a lot that could be done. of us in the early-to-mid twenties age de- lives” of school and settling down. Ideally, try (and, in an ever-localized era, around After a rather uneventful campaign filled mographic, the most mobile sector of the these people will come back, armed with the world) taking huge strides to better- with uninspired promises by both long- country’s population, that’s what we are a knowledge of the wider world around position themselves within their regions, time councillors and legitimate challeng- looking for. them, having seen what has and hasn’t countries or continents for an uncertain ers that failed to captivate anyone, maybe To be sure, Winnipeg has provoked worked elsewhere, and fully capable of future, Winnipeg has some catching up to we shouldn’t expect that much – but that untold amounts of creativity. Our arts and bringing about positive change to their do, especially to provide the opportunities would mean that the door is wide open for culture scene is flourishing on and off the hometowns. for its young people that other cities are us as a citizenry to be blown away. mainstream track, and the city has offered But that often isn’t the case here. In able to do. To be honest, there’s a lot you as a city a high quality of life at a relative bargain Toronto, many are calling for the tear- I personally will probably leave council will have to do to inspire the city to hundreds of thousands of citizens over ing down of the Gardiner Expressway that anyway, as young people with a sense of as a whole, and its young population in the years, but that has been, in many re- cuts through the city along the lakefront, adventure who desire personal journeys particular. If you hadn’t noticed, although gards, in spite of the local political cli- making it an election issue. In Ottawa, are apt to do. But I’ll constantly have an margins of victory were quite large by most mate, not because of it. Feeling like those the city is nearing closer to replacing their eye looking in on Winnipeg to be in tune of you, the actual numbers of voters show- chosen to lead the city don’t fully grasp that aging bus rapid transit system with light with the city and know what’s going on ing up to the polls – only 38.4 per cent of there’s more to civic governance than basic rail. And in burgeoning Calgary, for all of back home. After all, Winnipeg will always the city’s registered voting population – upkeep can be stifling, leading people to its sprawl-induced faults, its downtown is be home to me, a place I’ll want to be given were near record lows. Only in the wards chose to take their businesses, and their booming and its rapid transit system, the that it can offer me what I need and want where actual races emerged between in- lives, elsewhere. C-Train, runs entirely on wind power. Can to live a productive, happy life. It’s not an cumbents and upstart challengers – St. One of the issues raised several times you blame people who decide this isn’t issue of keeping me here, but bringing me Boniface, River Heights-Fort Garry in this election, mostly when the candi- the place they want to be after experienc- back. I wish you luck, new council. For all and North Kildonan – were turn- dates were actually dealing with or de- ing major cultural, environmental and of our sakes.

Letter to the Editor Afghans: No Democracy for You, Eh?

My wife Natalie, invisible and stum- The Islamic Republic of Afghanistan is racy. They had almost defined a modern, Canada’s choice is to sustain that hope bling under her burqa, and I in my Afghan named such because its population is Muslim society for themselves by the or abandon them and the next generation Chitrali hat, deliberately spooked the Peace 98 per cent Muslim (cf the neighboring 1970s, which slipped away into devasta- of Afghans. Alliance Winnipeg (www.peacealliance- Islamic Republics of Iran and Pakistan). In tion. It’s a long haul getting back and going One protestor remarked how nice it winnipeg.ca) crowd marching to demand the transition between tradition and mo- forward. Canadian Forces are providing is that we live in a democracy where he “End Canada’s War On Afghanistan!” Note dernity, its courts need to wend their way security from the remaining Taliban who and I can disagree. He forgets how many “On,” as in Canada is the enemy. Waving towards consistency of Islamic law with burn schools, from the suicide murder Canadians died defending freedom in our purple colored fingertips recalling the modern human rights. It’s not easy, and raids from Pakistan by madrassa students Western countries, and thereby protected 80 per cent turnout in democratic elections loopholes are sometimes used to avoid in- funded by Saudi Arabia, from the remain- our own freedom. Don’t Muslims deserve in Afghanistan, we were told “Democracy justices, rather than trying to rewrite the ing warlords and the criminal drug and the same? is not for everyone.” Our Afghan friends Koran and Hadith. All major religions have human traders. A whole Afghan genera- in Canada and Afghanistan need to hear codes of conduct and face these problems. tion grew up without education, but did Richard Gordon this message, whose success would be It was therefore ironic to hear protes- not lose hope. [email protected] the second abandonment of them by the tor argue against Islamic law for Afghans October 28, 2006 West. One Herat University student put it while the three Muslim men amongst the this way, in imperfect English: “Those who 200 marchers expounded on the delights Denis Vrignon-Tessier talk for the people of Afghanistan, without of life under the Taliban. Of course they consulting them, have difficulty imagining now live in Canada, where a woman can what everything would be like here when choose to wear a burqa or not and is al- Karzai is gone and the Taliban put their lowed to work, musicians don’t get their boots on the necks. It may even be diffi- hands chopped off, girls can go to school, cult for them to imagine there are people and kids of all ages can delight in flying here who, the same as they themselves, kites. These Muslims also refused to see the dream for a future and can feel the pains movie Osama, produced in Afghanistan by as deeply as anyone else.” Afghans, portraying the life of a 12 year We work as volunteers for Afghanistan old girl who disguised herself as a boy through Canadian Women for Women in to be able to go to school, and what the Afghanistan (www.w4wafghan.ca), which Taliban did to her. They won’t read books pays teachers’ salaries and houses and by Canadian reporters Sally Armstrong educates orphans there, for Books with and Kathy Gannon on Afghanistan saying, Wings (bookswithwings.ca), which sends “It’s all lies.” whole libraries of books to Afghan univer- Oppression anywhere diminishes all sities, and professionally on Stop Afghan of us. Afghans are hungry for education, AIDS, an attempt to stop their nascent sick and tired of 30 years of war, civil war, HIV/AIDS epidemic before it explodes. and lack of human rights and democ- November 2, 2006 The Uniter contact: [email protected] 0 COMMENTS

Managing Editor: Jo Snyder Comments Editor: Brad Hartle Comments E-mail: [email protected] E-mail: [email protected] Tuning Out is the Wrong Solution

Derek Leschasin access to more information than gen- beyond their understanding - events take especially online. There are, I think, con- Senior Reporter erations that came before us could ever place and it seems there’s no accounting flicting forces in journalism have imagined. Through the internet, for them. The explanations for the forces Recently, it was revealed that Jon it wouldn’t be too difficult for me to im- that shape our world are buried in the Stewart has become among the most veryone knows it’s a problem, but merse myself in the local politics of which- past - and strict, up to the minute news trusted news sources among young no one seems to know how to ever city in the world I choose, language has little room for context. As a result, the people. On one level, there’s nothing really E handle it. barriers notwithstanding. In theory, we BBC research has found, young people wrong with this. People like Stewart are “I don’t watch the news (or read the have the tools to cut through the crap and are tuning out. exceedingly good at pointing out bullshit. newspaper, or whatever) because I don’t make the world as we wish. But instead, Presented with this information, the But to stop there, to laugh at Stewart’s cri- understand it,” is increasingly becoming a alienation or materialistic hedonism oc- panel of BBC media professionals seemed tiques of the media and not apply them to common sentiment among younger gen- cupies much of the youth zeitgeist. stymied for the first and only time that the real world as a tool for change, breeds erations. Earlier this month, while in London, day. They pointed to things like “in-depth” cynicism and detachment, rather than This sense of alienation and confu- England, I had the opportunity to attend backgrounders to some news stories on furthering the interaction between youth sion is easy to sympathize with. The world the BBC’s “Audience Festival” - a two-day the BBC website (a feature that CBC has and progressive journalism that needs to is a very complex place, and the history our presentation to the BBC’s staff on the atti- also adopted), but beyond that offered happen. Media is not monolithic - espe- curriculums don’t cover is forever tapping tudes and opinions of the typical English few answers. cially now, there is the possibility for more us on the shoulder. The cut-throat, up-to- BBC audience member. I was able to sit It is tempting to place heavy blame independent voices than ever before. the-minute, profit-driven model of the in on a panel discussion on an interesting for this state of affairs on the way the Unfortunately, in a time when it is media has a tendency to distort issues as and pressing issue: who decides what is media operates. The news can be super- finally possible to harness the power of often as it illuminates them. Not to men- news? The question is multifaceted: what ficial, and events tend to be presented as the media to foster true public engage- tion the pressure from employers to work influence should bloggers have on the occurring in a vacuum. The common re- ment with the running of society, it’s a harder, faster and longer. Sure sounds to media, should the news be more interac- sponse of media professionals to these battle simply to maintain people’s atten- me like a good excuse to get blitzed on the tive, and should the media provide cover- concerns is that: “it’s not our job to edu- tion. Meanwhile, the decisions of those weekend and forget it all. age the public demands, or cover issues cate people” - it’s simply to inform. That in power do not have any less affect upon Except... there’s a contradiction here. the public should be interested in? is a dubious assertion, but it’s generally those who tune out and give in to cyni- At the beginning of the 21st century, west- Young (read: teens and 20-some- taken as dogma in the media world. That cism or apathy. ern youth are likely better-educated than things) audience members are becom- said, “in-depth” examinations of stories they’ve ever been before. We also have ing lost. They feel that the news has gone are becoming more and more common, Solving the smile, killing the intrigue

Kenton Smith are like me and find the Mona Lisa’s tisement as anything – the painting has have used the smile to symbolize the Reporter smile to be genuinely haunting, do you been reproduced on everything from enigmatic. really want to know its secret – espe- mugs to postcards to t-shirts. The indel- In sum, there has clearly been cially if it be so distinctly unremark- ible impression left on the public con- something about the painting that has as the 500-year-old riddle of able? sciousness is that this is a Great Work of inspired such a range and degree of the Mona Lisa’s smile finally In placing the painting under the Art. At the same time, the Louvre regu- fevered speculation. If anything, the Hbeen solved? microscope like never before, some fas- larly reports that disappointment is ex- Mona Lisa exemplifies the timeless- That’s what recent media spin cinating details have been uncovered pressed by many visitors upon seeing ness that great works of art can possess, would have you believe about the here- that give us a tantalizing glimpse at the genuine article, especially regard- and that a puzzle is at its most interest- tofore most extensive research done Leonardo’s methods. We now know that ing its relatively small size. Consider ing when unsolved. Once we know the on what is perhaps the world’s most the painting at one point had a very dif- also the Mona Lisa was largely ignored riddle of the sphinx, what remains? famous painting. Commissioned by ferent composition, with the sitter rig- until the nineteenth century. Even if the media spin is mis- the Louvre, the recent study on the idly gripping her chair instead of hold- On the other hand, it was not until placed, one wonders if this latest inter- Mona Lisa was initiated in 2004 by the ing her hands together in calm repose. the same period that Vermeer was re- pretation has been irreversibly embed- Centre de Reserche et de restauration It’s quite something to ponder what discovered, and this does nothing to ded in the public consciousness. E. H. des musees de France (C2RMF) and the a markedly different effect Leonardo diminish the brilliance of his work. To Gombrich lamented how people can be National Research Council of Canada achieved simply on account of a single give the Mona Lisa some benefit of the prone to seek easily digestible explana- (NRC), the latter of which created a change in detail. doubt, it’s clear that it has for many tions of art – that they are all too con- colour laser scanner to produce a high Perhaps most importantly for held some more profound level of mys- tent to sidle up to a great masterpiece, resolution 3D model of the painting. scholars, the scan has facilitated a tery; the very word sfumato possesses nod “Ah, yes, sfumato,” and move on. What that scan has revealed is greater understanding of Leonardo’s connotations of the mysterious and Not that the Louvre authorities give the that, invisible to the naked eye beneath famous technique of sfumato. Simply elusive. Aspects of the painting have general public much time or opportu- glaze and centuries of accumulated put, sfumato is the delicate, smoky, im- been at the centre of much historical nity to savour the details of the Mona dirt, is a translucent veil called a guar- perceptible gradation of shading which debate, in particular the question of Lisa to begin with, but now matters can nelo, worn by both pregnant women Leonardo seemingly achieved by ap- just who the Mona Lisa was, with expla- only be made worse. and new mothers in 16th-century Italy. plying several translucent layers of nations ranging from various members If so, one wonders if it might not “We can now say that this painting by colour to create the illusion of depth. of the Italian aristocracy to a Florentine have been better had the research not Leonardo da Vinci was painted to com- Researchers still cannot ascertain just courtesan to Leonardo’s own mother to been done at all. While great works of memorate the birth of the second son how Leonardo rendered the details of Leonardo himself, dressed in drag and art can possess inimitable qualities of the Mona Lisa,” says Bruno Mottin, the painting, as there is, bafflingly, not using mirrors to capture his own like- that can extend beyond their particu- a curator with the C2RMF. And accord- a single visible brushstroke. ness. lar socio-historical origins, perhaps the ing to the BBC, the CBC, and the Globe Looking inside the drum to see what More than anything, however, primary purpose of art history is to aug- and Mail, among others, this discov- makes its sound is always fascinating in what seems to have fascinated people ment enjoyment of them by providing ery finally provides the key to the Mona and of itself, and the recent research is more than anything is that damn smile. a greater context. If, however, histori- Lisa’s expression – why, it was that of a certainly of tremendous benefit for art Historians have wrangled over this cal research destroys the very qualities beaming new mother! history. But is it good for art? point as well. Were performers em- that make any given work of art special At least a few female critics have Ironically, the mystery of Leonardo’s ployed to amuse Leonardo’s subject? to begin with, then it goes a long way amusedly noted that their own child- technical approach is what will proba- Did she suffer from facial paralysis, or towards rendering itself and its subject bearing experiences give them reason bly least stimulate the public imagina- maybe the loss of her front teeth? Freud irrelevant. By looking inside Leonardo’s to be skeptical about this supposed rev- tion. It is probably true that the prestige interpreted the smile as Leonardo’s ex- drum, researchers may have succeeded elation. But let’s say for a moment that the Mona Lisa has enjoyed in our time pression of erotic attraction to his own in thwarting its ability to make music. this new interpretation is correct. If you has almost as much to do with adver- mother. Music, literature, and film alike contact: [email protected] The Uniter November 2, 2006 DIVERSIONS 0

Diversions Editor : Matt Cohen Comments E-mail: [email protected]

The Only One STUDENTS HELPING STUDENTS

UofW Peer Support

How can I stop gambling? I’ve spent Is gambling an adrenaline rush when you all my money and can barely pay my bills. are down or depressed? Are you gambling Why do I keep doing this? My life is a mess to get more money when you don’t have and I am really sick of how I keep doing this much? Taking a look at your life and fig- to myself. uring out why you’re not happy is a step There are thousands of Manitobans in the right direction. Counselling can battling this addiction. The first thing help to get yourself back on track and you need to do is talk to someone and lead the life you want to lead. You have get help. It is really hard for most people to decide why you want to change this to stop cold turkey and do it alone. The for yourself and be ready to help your- Addictions Foundation of Manitoba self. It can be done, and you can do it! can help. Call the Gambling Helpline Take care, and remember...you are not (24hours) at 1-800-463-1554. It is free the only one! and can start you in the right direction. You have to do some soul searching and Email your questions to figure out why this is a problem for you. [email protected]

Wine On A Dime BEAR WARLOCK

Michael Banias

Barefoot Chardonnay hen talking about wine, ($10.99 - private shops) the name Savanna WSamson seems out of - This American place. The famous adult film star Chardonnay is awesome and celebrity has become quite for the price. It’s on the famous in the wine world; she’s lighter side, with a become a winemaker. The star of touch of crisp oak. such films as Just Do Me! (2006) It has a great green and Wet Nurse (2004) is releasing apple and lemon the wine “Sogno Uno” or “Dream nose. It’s very clean One” in February. The wine is al- and fresh with a ready causing a stir in restaurants smidge of vanilla. and wine shops who are putting orders in for shipments based on good reviews. Al Muvedre Samson was actually in- ($11.49 - private volved in the making of the shops) wine. She sampled over 80 wines, and her pref- - This Spanish red erence was the ob- by Telmo Rodriguez scure Italian grape is very popular, and Cesanese. With some one of my favou- help, she settled rites. It is made with on the final blend the Monastrell grape, which is 70 per cent so it has a light body. Cesanese, 20 per However, it has a cent Sangiovese, healthy dose of tannin, and 10 per cent and plenty of earthy and Montepulciano. wood notes. It also has Unfortunately, a nice helping of plum, in the initial re- cherry, and herbs. It’s great lease, Canada all on its own. will not be one of the wine’s destinations. Savanna told Decanter maga- zine that “it’s not a wine for the masses” and the bottle Questions or comments? will retail for about $40 USD. She Email [email protected] also has plans for a white and a sparkling wine, but those are still up in the air. Here are a few wines that are, as Savanna puts it, for the masses:

November 2, 2006 The Uniter contact: [email protected] 10 FEATURES Features The Wiki-ed web revolution How Wikipedia is changing the meaning of knowledge

Bryan Zandberg who placed 12th in the fifth season of tinue to expand it without limit. . . . We’re “Not only would lots of informa- CUP Features Bureau Chief American Idol, for example – it makes you not trying to give people all the information tion fail to make us smarter; it would wonder if free is already paying too much. in the world or cover every subject anyone actually make us dumber by overwhelm- could think of.” ing us,” warned Britannica’s editor-in-chief VANCOUVER (CUP) – Skeptics have Orlowski, a San Francisco-based jour- Dale Hoiberg in the Wall Street Journal last been slagging Wikipedia ever since it nalist who has entertained the blogosphere He likens Wikipedia’s size fetish with summer. launched in 2001 and to this day the free with theatrical critiques of Wikipedia, argues a short story by the Argentine writer Jorge online encyclopedia’s wild popularity re- the majority of the encyclopedia’s content is Luis Borges, in which cocky cartographers mains unscathed. “junk food,” and that the project is run by of a greedy ancient empire continually draw Super-hyper-ultra-fast people who “willfully create . . . confusion the map of their territory larger and larger. Despite having been portrayed as un- between information and knowledge.” Eventually, the map becomes as big as the reliable, mean-spirited, biased and prone to empire itself, at which point it becomes But the real genius behind Wikipedia scary problems like “trolls” and “flaming,” “Information isn’t knowledge,” he says. completely useless. isn’t its speed and span alone, it’s the wiki people still swarm to use it. Stephen Colbert “There’s a very important distinction. We’re software working away behind the scenes. has satirized its “everybody’s-an-editor” ap- awash with information “The moral is an im- proach, calling on viewers to protect en- today, and much of portant one,” writes This software allows visitors to add, dangered elephants by simply re-editing it is unreliable Panelas via e- remove, edit and change content on its web- how many surviving specimens were left – and of low mail from site, making it both fast and flexible because problem solved! But watchful Wikipedians qual- large numbers of people from around the quickly corrected his comic act of “vandal- ity. world can create articles and update them ism,” and as ever, the site’s celebrity status as quickly as new developments become has kept on climbing. known.

For e-addicts, Wikipedia is like the It should be mentioned that wikis Paris Hilton of Internet media: it’s ev- are transforming academia for the erywhere they look. Google anything – same reason: they are an amazing “hot pants,” “Santorum,’” or “la vida tool for scholars to hyperlink their loca” – and the search engine places research together, check on each Wikipedia articles at the top of the others’ work and learn what ad- pile for almost any person, place vances are being made in their re- or thing you can think of. Which spective fields and disciplines. means that unless you happen to be some kind of academic mas- This format, which has ul- ochist, you too are probably re- timately been the formula for lying more and more on this fast, Wikipedia’s success, has its pros free research resource. and cons. It could be considered a benefit because, to a certain If it’s obvious that Wikipedia’s extent, building knowledge is an here to stay, what isn’t clear is what ongoing process. role, if any, it ought to play when it comes to top-notch academic pursuits. “When is human knowledge ever And it turns out the answer’s one of the [complete]?” posits Wales. “Nothing is few things out there Wikipedia can’t sum ever done, knowledge is always growing.” up at the touch of a mouse-click. On the other hand, when you learn that the Wikipedia entry for “Wikipedia” itself Poor kids + free Wiki = love It’s has been edited 17,919 times between 2001 debat- and last June, the “process” argument starts able whether Chicago. to border on ridiculous. The Atlantic, which Wikipedia is freely licensed, which our actual knowl- “Like maps, en- ran the above figure, reported that the entry means it can be copied, changed, posted to edge has increased qual- cyclopedias are repre- for George W. Bush had been edited 30,393 your blog, made into digital art or treated itatively or quantitively.” sentations of something else, pro- times within the same time period. These any way you like since there are no copy- duced on a smaller scale so real people can racing revisions often stem from endless right laws to break (as long as updated ver- Jimmy Wales, founder and owner of assimilate the information they contain. “edit-wars” – the Wikipedian equivalent of sions grant the same freedoms to others Wikipedia, disagrees: “There is no such The urge to shovel every fact in the world pissing contests – between rival editors. and acknowledges sources.) thing as too much information,” he wrote at people – an impulse that governs much from Florida by e-mail. “If we are drawing of the web – risks ignoring the real practical Wikipedia isn’t the only one to In the dazzling digital revolution, a distinction between knowledge and in- needs of people who want to learn.” benefit from new technology: even its clos- Wikipedia is like a techno logical Robin formation, then Wikpedia helps the spread est competition, Encyclopedia Britannica, Hood, stealing knowledge from rich license of knowledge because of the very nature of Wikipedia dwarfs Britannica com- has also made speedy strides forward holders and putting it in the hands of the the work: Wikipedia is an encyclopedia at- pletely – compared with the latter’s 65,000 thanks to its web-based format. The latter poor. It’s the democratization of informa- tempting to be the sum of all human knowl- articles, Wikipedia has more than 1,430,032 obviously doesn’t use wikis on its on- tion, brothers and sisters. edge, not a data dump.” in English alone, and over five million in all line database (where only experts are al- languages combined. lowed to write and modify articles), but the And again, it’s free. A 34-volume print But Tom Panelas, director of com- web has made them much more cutting- set of Encyclopedia Britannica, on the other munications for Encyclopedia Britannica, Presented with this challenge, the folks edge than they could possibly be in their hand, sells for a cool US$1,600. counters that there comes a point when in- at Britannica are fond of citing American print edition. formation just isn’t useful anymore. historian Lewis Mumford, who predicted Critics like Andrew Orlowski, however, – just before the arrival of the web – that “When Pluto was downgraded say we’re getting exactly what we pay for. “When we moved from print to the the explosion of information in the world from a planet to a ‘dwarf planet,’” writes And when you read some of the stuff that web,” he explains, “we used the additional would “bring about a state of intellectual Britannica’s Panelas, “we immediately Tom, Dick and Harry considered worthy of capacity we gained and expanded the size enervation and depletion hardly to be dis- revised our articles on Pluto and the an entry – the biography on Melissa McGee, of the encyclopedia. But we don’t con- tinguished from massive ignorance.” solar system, and those revisions appeared contact: [email protected] The Uniter November 2, 2006 FEATURES 11

on-line the day the announcement came When the question was posed as to The growing trend, however, is to rely from Prague.” what incentive a modern academic would on Wikipedia. It’s one of the 20 most visited A recent article from The Atlantic spec- have to write for Wikipedia – without rec- sites on the web. Which is fine, bearing in ulated that “[Wikipedia] has the potential to Panelas draws a sharp distinction be- ognition or the assurance that an amateur mind that there really are fuller-bodied and be the greatest effort in collaborative knowl- tween the down-to-the-second response or dilettante would vandalize his or her more robust resources at our fingertips. edge gathering the world has ever known.” time wikis create for researchers and stu- work – Wales snapped back with: “I don’t dents, and the need for split-second revi- understand the question at all. Asking why “To students, I’d say enjoy great infor- But as our whirlwind Wiki romance con- sions in a carefully compiled reference like academics and specialists contribute to mation while you can,” counsels Orlowski. tinues, it’s never a good idea to go head over an encyclopedia. Wikipedia is like asking why athletes play heels. Nature magazine summed it up well, sports. There are a lot of reasons people are But even after you’ve graduated, web- after conducting a much-disputed study of “Just because you can publish and into intellectual activity,” he answers flatly. sites of institutions like the CBC are handy Wikipedia and Britannica that found them revise every few minutes . . . doesn’t mean and accurate resources that shouldn’t be roughly the same in terms of quality. you should,” he argues. “We publish sound, “I reject the notion that academics have overlooked. reliable articles and revisit them when nec- such fragile egos that they live in fear of in- Researchers should read Wikipedia essary, but since we’re not a news organ and teracting with the general public. I reject the cautiously, they say, “and amend it enthu- would serve our readers poorly if we tried to notion that people who are not academics Wiki: the never-ending story siastically.” be one, we don’t keep revising endlessly.” are ‘dilettantes.’”

But Wales doesn’t explain how So is Wikipedia useful as a learning Quality versus ‘openness’ disputes between editors of any given tool, or is it just a cultural curio? article could be resolved by the most qualified person. The structure of “When you see an incredibly detailed “Wikipedia has always had the choice Wikipedia prevents this from ever be- Wikipedia entry on Klingon language it’s of putting quality first, or putting openness coming a possibility, because if it ever hard not to laugh and roll your eyes,” says first,” writes Orlowski. “It was never going to closed access to certain people it would Brian Lam, manager of emerging technol- be able to achieve both.” no longer be an “open” encyclopedia. ogies and digital content at UBC’s Office of Learning Technology. “But such cultural A blogger by the name of Nicholas Carr In the academic world, experts, ten- quirks should not obscure the genuine prag- frames the same criticism in a slightly dif- ured professors and peer review are the matic value of the resource.” ferent way: authority, and reputation is everything. Wikipedians are anonymous. The German Despite its flaws, Lam thinks Wikipedia “At this point, it seems fair to ask ex- version of Wikipedia, however, is experi- is “a remarkably useful reference tool” and a actly when the intelligence in ‘collective in- menting with limiting access in the inter- great place to start. telligence’ will begin to manifest itself,” he est of creating higher-quality information. writes on his blog, Roughtype. “When will Critics say that undermines the openness In the context of a cynical, postmodern the great Wikipedia get good? Or is ‘good’ an principle. society, Wikipedia’s army of 65,000 volun- old-fashioned concept that doesn’t apply to teers is pretty flooring. emergent phenomena like communal on- line encyclopedias?” Diversify your info diet “Not only are Wikipedia editors willing to contribute their efforts for free,” observes Here Orlowski and Carr hit a weak spot Lam, “they do not expect tenure, glory, good in Wikipedia’s armour: how will it ever be re- So Wikipedia is faster, bigger and it’s grades or even attribution in return.” liable if anyone can edit it? free. But what if you’re actually willing to get some bang for a few bucks? Institutions like the U.S. Patent and Trademark Office, for example, recently Encyclopedia Britannica has been on- ruled that citations of Wikipedia would not line since 1994 and you can get access for be allowed in patent cases because its con- $70 a year. But that’s not even how most tents are so volatile. The Stephen Colbert people tune into the self-proclaimed “most sketch on “wikiality” explains why: in definitive source of knowledge.” Wikipedia, truth is whatever the last editor says it is. The U.S. Supreme Court, on the There are 100 million people in the other hand, does allow facts cited from world who use Encyclopedia Britannica, ac- Britannica. cording to Panelas, who says most of those people get it through their institutions – What does Wikipedia’s “quality versus schools, libraries, universities – and don’t openness” mean for students? There is no pay for access. set answer – it really depends on what you’re after. If you’re in pharmacy, would you trust In Vancouver, however, neither the an anonymous writer named “FlamO-666” Vancouver Public Library (VPL) nor the to give you reliable information about the University of British Columbia, how- side-effects of tetracycline? Probably not. ever, have licensing agreements with Encyclopedia Britannica. Representatives at If you were looking for pop culture cri- both libraries said they cost far too much. teria for identifying vampires in the grave, however, or needed a filmography for Atom Orlowski thinks there’s something Egoyan, Wikipedia’s probably one of your very wrong with this. He’s written about best bets for starting out. Britannica pales why societies should extend public access in comparison to Wikipedia on this front. to expensive information collections – like Encyclopedia Britannica, which has been When it comes to current events, Wales struggling to compete in the last decade has the following reason why Wikipedia partly because of the glut of information on might be just as good as CNN: “We have a the Internet – and thinks it should be a pri- strong neutrality policy which is firmly en- ority because it would “head off the major forced, and [we] input from a huge number trend of today, which is the division into a of people [with] many different viewpoints,” two-class society, with one class enjoying he says. “If you want partisan information access to reliable, quality information, the or propaganda, just turn on the television.” other condemned to use free junk.” By junk, of course, he means Wikipedia. In many cases, however, background from ol’ Encyclopedia Britannica would For students at most Canadian univer- seem a little safer: they have more than 4,000 sities, there are exceptional resources that experts and scholars from around the world a lot of students don’t take advantage of – writing, editing and fact-checking their en- things such as e-journals, magazine and tries, and past contributors include Albert periodical databases and access to on-line Einstein, Sigmund Freud, Marie Curie, and versions of traditional encyclopedias writ- George Bernard Shaw – you know, that kind ten by experts. Though neither VPL nor UBC of crowd. have Britannica, they do provide access to World Book and Funk & Wagnalls. November 2, 2006 The Uniter contact: [email protected] 12 ARTS & CULTURE

Arts & Culture: Mike Lewis Staff Reporter: Kenton Smith Arts & Culture E-mail: [email protected] E-mail: [email protected] Obscured by Clouds

Whitney Light Every time I install a piece I will dis- News Production Editor cover new things about it. For example, with Mammatus, I could see it now being installed in a space that wasn’t against a wall. It could A cloud has risen inside the Winnipeg Art hang quite low in the middle of the room and viewers could walk under it. Maybe the next Gallery. Canadian artist Max Streicher’s location I go I’ll find a way to do that. installation Mammatus is a giant The name, Mammatus, is scientific. Why did you make that association? inflatable cloud made of nylon. Though There’s a kind of admiration for the size it’s certain no storm will erupt, the and scale of clouds in my cloud series (this is the third one I’ve done). In a way I’m trying cloud, embedded with dreamlike to demonstrate their architecture. Clouds animals and figures, creates an ominous are form without substance—when you try Mammatus, by Max Streicher PHOTO: WHITNEY LIGHT to touch it, it just disappears; it’s steam. But atmosphere. Streicher’s first inflatable the way its crystals catch the light in the sky sculpture in 1989 was a giant ram’s horn makes a cloud look very solid. That admiration be a scholar. I’m not very scholarly. I never had inflatable moving and filling with air I think for form shows in my work, in trying to make role models in the arts when I was growing up. they relate to their body. Maybe not liter- called Breathe. Since then he’s created the cloud into a structure, to build it and con- It wasn’t until I went away from rural Alberta ally, but intuitively, people are thinking ‘It’s many sculptures of animals, people, and tain it. that I encountered people actually working breathing, I’m breathing.’ Often people act The title actually came about with discus- in the arts and I saw that art was possible. It very un-art-museum-like around my work. clown faces that have been inflated sions with (curator) Mary Reid. ‘Mammatus,’ wasn’t just a hobby, art could be a living. I real- They’re not usually allowed to touch art, but in galleries internationally. Streicher, the word, comes from ‘memory.’ It’s a type of ized theology was the wrong path, and art was with my work they want to go crazy, run into who resides in Toronto, was in Winnipeg cloud that has many pouch-like shapes and the right path all along. But I didn’t come to it, bang it. That’s all part of the spiritual mes- indicates that a tornado is forming. I’ve also understanding how to do that until I was 30 sage. The idea of spirituality and the mysti- to oversee the installation of taken some inspiration from Renaissance years old. cal is in the present as far as I’m concerned. Mammatus. I met with him to get painting. There’s a long history of clouds in Does your theological background It’s not in abstract ideas or the future. But it’s art. They were used as a device—a rather rudi- inform your art? open-ended in the sense that people are al- a tighter grasp on the ethereal mass. mentary one—in medieval painting to portray I think the work constantly contains spir- lowed to have their own experience. religious themes. The Renaissance found that itual references. This work is very biblical. So would you say your work brings silly and single point perspective took over. What I learned in theology was some irrever- out the inner-child in all of us? How do you create an inflatable? But Correggio, a couple hundred years before ence. You never really know what hit you when The child is always there. Adults accu- I’ve been making them for about 16 the Baroque, already was using clouds to make you get into seminary, because all the things mulate the experiences of childhood but gain years. The process has really evolved and now visual sense. He’d take 3D single-point per- you’ve been taught in your life are questioned. more wisdom and knowledge of complex they’ve become very detailed. I use forms that spective and put it on the ceiling, using clouds And it becomes complex. So I think I learned issues. I think the work does return people to are plaster or wax to make the pattern from. to give his figures something to sit or stand on. some irreverence in the course of that study a more innocent experience. A lot of art de- Then I take the pattern to a drafting com- That way, his figures were grounded or at least which still comes up in the work. It’s a kind of mands that one enter at an intellectual level. I pany and they blow up the pattern as large as in an in-between world. So clouds can be both irreverent use of materials, and the idea that think my work hits people on a more physical I need. I cut the pattern out in Tyvek, nylon, concealing and revealing, as they are in my this is sculpture and inflatable is a bit irrever- level, and the intellectual might come later. or vinyl and sew it together with an industrial work, with the figures hiding in it. ent. And the themes are often poking fun at se- And kids will have very similar reactions to or domestic sewing machine depending on You attended theology school before rious issues. adults. They will also see it as scary and some- the weight of the fabric. I attach fans to inflate becoming an artist. Why did you change Are you expressing a specific spiritual how disturbing. It takes them a bit beyond it. The very first one I made used a vacuum paths? message or is it open-ended? their experience of happy, bouncy castles. cleaner fan. Theology was very interesting, but it It’s specific in the sense that I want people Each gallery is very different in the wasn’t a career path. There are two directions to respond in the now. The use of air, for exam- Mammatus is on display at the way it can accommodate your sculpture. Do you can go with it: you can become clergy and ple, is like yoga, when you use breath to bring Winnipeg Art Gallery from Oct. 28 to you see that as a positive or negative? go into a parish, or go into it academically and yourself into the present. When people see the March 25.

The Retreat from Moscow MTC Warehouse

By William Nicholson an excellent outset for the Warehouse that brought the au- Reviewed by Stephen Spence dience to its feet on opening night. A compelling dramatic story it nevertheless delivers several side-splitting mo- ments, such as when Alice, whose recovery includes volun- ominated for three Tony awards in 2004, includ- teering for an AIDS hotline, discovers that homosexuals are ing best play, The Retreat from Moscow tells the really the nicest people in the world. Nstory of three people caught in the breakdown of a Directed by Robb Paterson, Associate Artistic 33-year old marriage. Director for the MTC and one of the city’s more experi- Alice (Susan Clark) is a matronly and frumpish wife enced men of the theatre, the play has the honor of intro- who spends her time collecting poems about lost love for ducing Susan Clark—perhaps somewhat infamous for her an anthology she is putting together. Her husband Edward role as Cherry Forever in the 1981 cult-classic Porky’s— (Andrew Gillies) hides from her oppressive incursions, de- to a Winnipeg stage for the first time in her career. Porky’s manding that he be real with her, in the crosswords or in notwithstanding, Clark’s breakout film was the 1975 bio- Officer accounts of Napoleon’s retreat from Moscow, eerily pic Babe, about the life of Olympic gold medalist and pro- fascinated by tales of the wounded being jostled off the carts golfer Babe Didrikson Zaharias, for which she received an and left behind. The play is set in motion by the weekend visit Emmy for best actress. She has also achieved notoriety as a of their bachelor son Jamie (Gordon Tanner) and Edward’s peace activist, having founded Americans for a Safe Future, timely decision to reveal he has found another woman. The an organization devoted to the study and prevention of low- play traces Edward’s retreat into the territory of a new life as level nuclear dump licensing. his wife follows behind betrayed and abandoned, but also The play and its cast deliver an event that is well- intent on re-conquering what was hers. worth the price of admission. Performed upon a simple but effective three-tiered stage that is used to represent the family home, Edward’s The Retreat From Moscow runs until Nov.11 at the new home and their son’s bachelor apartment; consisting of MTC Warehouse. Tickets are $11 - $39 a performance that is both gripping and flawless, TRFM is contact: [email protected] The Uniter November 2, 2006 ARTS & CULTURE 13 Look Closer – Christopher Pratt

Kenton Smith one another. Nor, again, do we see our own Staff Reporter image reflected. Similarly, The Americans: Off-Base Housing (1999) shows us a trailer park in which shuttered and darkened win- arker currents churn just be- dows offer no glimpses inside, nor any neath the placid surface of the trace of human presence. Indeed, those commonplace in the work of works featuring a human subject are the D iconic Canadian painter Christopher exceptions, such as Girl in the Spare Room Pratt. (1984). Once again, however, we are kept Take the ambiguous The Visitor (1977), at arm’s length by Pratt’s distancing mech- one of 50 large-scale oil paintings by Pratt anisms – in this case the use of the frame currently on exhibit at the Winnipeg Art to cut off the subject’s face just below eye Gallery. A sinister narrative seems to lie level. behind the image, suggesting something Appearing at the exhibition’s open- else afoot, leaving the viewer wondering: ing on Oct. 4, Pratt told audience members What does the title refer to? that, although he works from memory, it is A clue may lie in a conspicuous detail: a malleable thing which he re-imagines, re- a pair of women’s panties draped over the works, and transmutes. Take Big Boat (1986- heating register. The insinuation is that the 1987), for example, in which the open door intimate space of the bedroom has been of a boat shed shows us the massive length violated – and that the POV the viewer is of a sailboat, suspended from the ceiling forced to share may be that of an intruder. like a whale carcass. The suggestion is of Coinciding with the artist’s 70th birth- a tantalizing, dangerous glimpse of some- day, the WAG is presenting a retrospective thing not meant for us to see. “I dreamt I of Pratt’s last twenty years, organized by was still working on the base, and some the National Gallery of Canada, until Jan. hanger doors rolled back, revealing, acci- 7, 2007. Although Pratt is usually identified dentally, a huge atomic submarine, a secret as a realist painter, it may be more accurate project,” reads an accompanying statement to say his precise, mathematically ordered, by Pratt, who in this and other works builds highly polished images achieve a height- upon his idiosyncratic impulses. Consider ened or hyper reality, approaching graphic Whaling Station (1983), based on a visit to art in their clarity and sharpness of detail. an actual such location in Hawke Harbour, They also reflect a remarkably distinct and Labrador. While he also worked from ex- consistent style, in which rigidly controlled tensive photographic references, the final technique is applied, again and again, to result is a product of Pratt’s own darker produce variations on recurring themes of associations: the former whalers’ empty menace, desolation, and loneliness. bunks made him think of Holocaust con- As in The Visitor, it is often in unassum- centration camps. Winter at Whiteway ing domestic interiors that Pratt situates With any given subject, what mat- latent danger. Another piece that burrows ters to Pratt in the end is, does it work as beneath the skin is Pink Sink (1984). The a painting? Every new work by Pratt begins of Historical Art at the WAG, adding that key to the painting’s eerie effect is a visual with a consideration of its formal quali- we tend not to “work as hard” – we simply The Christopher Pratt exhibit is on contradiction: the perspective is such that ties; a demonstration of this approach can stop at the surface level of mundane ap- display at the Winnipeg Art Gallery until the viewer should see his (or the artist’s) be seen in displayed studies for Driving to pearances. Those who strain to look closer, Jan. 7. reflection…yet there is none. This motif is Venus, or in the extreme and even intimi- however, will discover that what sticks to also present in Dresser and Dark Window dating perspective of a dry-docked boat in them are the shadows. (1984). Here, the tightly centered, geomet- Big Cigarette (1993) – a picture that is un- rical composition draws the eye towards a mistakably conceived and designed. Pratt’s window reflected in a dresser mirror, where time-consuming, studied, exhaustive ap- there is but a dark void in place of where proach directs everything – composition, either the viewer (or painter) should be. colour scheme – towards a calculated aes- The unsettling effect is that of displace- thetic end. ment – but also a sense of disconnection At the same time, Pratt says that he from the self. also simply enjoys the “visual play” of treat- Related themes of isolation, alien- ing the painting as a painting, toying as he ation, and the short-circuiting of human does with what art historians call trompe interaction are constants in Pratt’s work, l’oeil, or “trick of the eye.” Take the afore- conveyed by the device of visual barriers. mentioned March Night, in which a pro- The most pure and literal example of this nouncedly two-dimensional subject, ren- is March Night (1976), in which the impla- dered upon a two-dimensional surface, is cability and immovability of a sealed metal made to appear as three-dimensional as storm shutter thwarts any possible connec- possible. Or consider the picture-within-a- tion between inside and out, essentially picture that is Half Moon and Bright Stars: leaving the viewer out in the cold. My Bedroom in September (2001), where A more subtle approach is taken in Pratt’s own window acts as a frame that Subdivision (1973), in which the pane opens out upon an ethereal nocturnal tab- through which we see out is reflected back leau. upon us, from the tinted surface of the That which is most intriguing in Pratt’s neighbouring window directly opposite. work, however, is always located in the We do not see any neighbours, though, and substrata. “We dismiss a lot about realist it is impossible for any neighbours to see painting,” says Mary Jo Hughes, Curator

The Americans: Off-Base Housing November 2, 2006 The Uniter contact: [email protected] Arts & Culture Editor: Mike Lewis E-mail: [email protected] Phone: 786-9497 14 ARTS & CULTURE Fax: 783-7080 Global Justice Film Festival

Dan Hugyhebaert

bout 5 years ago, Don and Donna Winstone attended a film festival in A British Columbia put on by the World Community Development Education Society. They were so inspired by what they saw they formed a relationship with the WCDE and or- ganized the first Global Justice Film Festival in Winnipeg four years ago. Held here at the University of Winnipeg The Sound of Being Second Hand Campus Nov. 3 and 4, the non-profit festival features some outstanding films, discussion, there when the palace was stormed and Chavez live music, and a keynote address on the his- was forcibly removed from office. They were tory of racism in Canada by speaker Dr. Rick also there when he returned to power two days out the $22.99 at their local retailer MIKE LEWIS Hesch, a teacher, activist and specialist in anti- later amidst a hero’s cheer from aides. (which, if you’re in Canada, means HMV). ARTS & CULTURE Editor racism education. The festival also takes a look at Canadian While Operator’s Manual is sort of Accompanying Dr. Hesch’s address on issues with the National Film Board short Two the same thing, it does contain 26 songs Nov. 3 is In the Shadow of Gold Mountain, a Worlds Colliding, which looks into Saskatoon’s by the Buzzcocks, who are arguably the This week: documentary about the Chinese Head Tax and “freezing deaths” where an Aboriginal man was world’s greatest punk band (that’s right Exclusion Act, a law that singled out Chinese dumped in -20C weather outside city limits, you sniveling Sex Pistols fans, I said it). The Canadians during a time in which the country and the investigation that ensues. And a good thing that makes the Buzzcocks so great is welcomed immigration from Europe. Global Justice Film Festival would not be right that they were rebellious but catchy. Instead There are over 20 other films in this year’s without Brave New Films’ Wal-Mart : The High of rolling around in their own filth and fury festival, ranging in origin from Latin America to Cost of Low Price. and swearing on daytime television shows, Africa and include the Oscar nominated docu- You should register as soon as possible, the Buzzcocks actually learned how to play mentary Darwin’s Nightmare, a film about the since spaces are limited, but walk-up registra- their instruments. Shelley could actually introduction of the Nile perch to Lake Victoria tion is also accepted. sing, and his lyrics were thought-provoking in Eastern Africa, and the ecological disas- The Global Justice Film Festival takes place long before anyone looked to punk for any ter that ensued. Although the perch is a major at the University of Winnipeg on Nov. 3 at 6:30 sort of intellect. Shelley, openly bisexual, export to Europe, the local people live in pov- p.m. and Nov. 4 from 8:30 a.m. to 4:30 p.m. tackled the issue of sexuality before anyone erty while arms are brought back for import. in the punk scene had the balls to do it. Another important film playing at this For registration info and admission prices Even though the songs on this album year’s festival is 2003’s The Revolution Will please go to www.globaljusticefilmfestival.ca hail from 1977-1980, each one still Not Be Televised. While in Hugo Chavez’s The Buzzcocks – resonates today. The track “I Believe” from presidential palace, two filmmakers were Operator’s Manual (1991) 1980’s A Different Kind of Tension spoke to a Generation X that wasn’t marketable Pete Shelley – vocals/guitar by Pepsi, and speaks still to a generation Steve Diggle – guitar wandering aimlessly today. The song is Steve Garvey – bass Shelley listing off all things he believes in, Art Created in a Moment John Maher – drums with a chorus of “There is no love in this world anymore.” Clocking in at just over 7 Normally ‘best of...’ compilations suck. minutes, the song is an anthem for anyone Ksenia Prints thing I create bears from me straight, like They’re nothing more than a handful of disaffected and insecure. Other songs like Beat Reporter a bottle of 100 per cent orange juice...I try radio hits that have already been played “Orgasm Addict”, “Everybody’s Happy to respect what’s already there and respond to death. The record companies try to Nowadays” and “Harmony in my Head” to it.” justify the compilation’s existence by are instant classics. hen entering that’sneighbour, The insanity of his last-minute work- tacking on an ultra-obscure Japanese While all three albums from the pre- the visitor is expected to be ing process makes the final result almost like b-side (import only) hoping that the breakup era (1977-1980) are a real trip, W caught in the moment. The in- an intricate abstract puzzle, combined from curiosity of the record-buying public Operator’s Manual is a good place to start stallation piece at this exhibition appears random parts without a picture to go on. He will override their good-sense and fork your education on the Buzzcocks. at first to be comprised of various unrelated admits it’s a challenge, and failure is not an objects, haphazardly strewn together. Upon option. “I try to force myself into making second glance, it nevertheless gains another something that I like, even from materials dimension and becomes a complete work that I don’t like at all. When I reach the point that artfully combines space, form and tex- where I want to be, I really feel good.” ture. Quite elaborate for something that is Surprisingly enough, he had never only supposed to last a moment. delved into art until arriving in Canada. He Sitting in a red homemade sweater believes the country’s individualist culture, Kazu’s, whose real name is Kazuteru combined with the distance from the de- Miyauchi, excitement is almost contagious. manding parents, is what allowed his tal- 95.9 FM CKUW Campus/Community A true artist, his hair is buzz-cut at the front, ents to blossom. “Canada gave me so much and there are splashes of paint all over his influence…People here have time for them- Radio Top 10 CD – Albums clothes. At the time of the interview he is at selves. Here, you love yourself. In Japan, it’s October 23 - 29, 2006 the process of assembling the upcoming ex- about how others love you.” ! = Local content * = Canadian Content RE=Re Entry NE = New Entry hibition, a task to which he only leaves three Despite all the heavy meaning behind days. What seems rushed is only natural to his work, which he might have only admit- Kazu, who works intuitively, arranging mate- ted to given sufficient probing, Kazu also has LW TW artist recording label rials into forms that would compliment and a playful side. His exhibition’s strange title, set a mood at the gallery’s entire space. that’sneighbour, started from a complaint “I don’t really have an idea,” he explains. letter from his neighbour. Now, he just likes 2 1 *Junior Boys So This is Goodbye domino “You see things, and that’s what it is. There’s how it sounds. “It feels nice when you say it, 1 2 *Kinnie Star anything Violet Inch/Maple Music no concept behind it, nothing whatsoever. and I like the fact it has no relationship to my 4 3 *Subhumans new Dark Age Parade g7 Just form and object.” work,” he explains. 3 4 !Blunderspublik You're the Best Ever Sfeericle This fluidness is evident from his work. Kazu explains that that’sneighbour, in Kazu explains it as the journey of life, from true dada form, is meant to be “pointless, 7 5 *the Sadies in concert outside Records the birth of an idea to the show’s completion crazy and stupid.” So to all those who wish 5 6 Yo La Tengo i Am Not Afraid of You… Matador in death. Therefore, he does not build sep- to be puzzled, confused and intrigued, do 6 7 !Romi Mayes Sweet Something Steady Independent arate pieces, but the entire show at once. “I yourself a favour and go see it. Warning: you 8 8 !D. Rangers the Paw-Paw Patch dollartone like spontaneous happenings,” he says, “but might get lost in the moment. I don’t believe in accidents.” 15 9 *Chad Van Gallen Skelliconnection Flemish Eye This seemingly opposite approach is that’sneighbour runs at the Semai gal- 9 10 Kaki King until We Felt Red velour Music what leads him to choose and recycle random lery, basement corridor of 264 McDermot materials from his home. “Absolutely any- Avenue, from Nov. 2 to Nov. 21. Arts & Culture Editor: Mike Lewis contact: [email protected] The Uniter November 2, 2006 E-mail: [email protected] Phone: 786-9497 Fax: 783-7080 ARTS & CULTURE 15 cd REviews book REview

Kasabian Patrick Watson Captain Empire Close to Paradise This is Hazelville On Thin Ice 2006 Sony BMG Music Entertainment 2006 Secret City Records 2006 EMI Records Ltd. By Jamie Bastedo Red Deer Press (341 pages)

Empire is the third Patrick Watson is a The four boys and album this British multi-talented mu- one girl who make Reviewed By Jo Snyder quartet has released sician from Hudson, up this band are all MANAGING EDITOR in the last couple of Quebec who has young musicians from years. It is undeniably managed to round Cambridge in the UK. Ashley Anowiak is a cool, with elements of up a fantastic group This is Hazelville is string music, Brit-pop of musicians and their first album, and restless teen in an arctic rock, house/dance, and disco. The songs are catchy, vocalists for his debut full-length album Close to it is fairly impressive considering. String instruments town. Haunted by reoccur- with lots of hand clapping and atmospheric back- Paradise. The album is thoughtful and downright and piano coupled with melodic vocals and obvious ground noise. The vocals are somewhat eerie, and pretty! There is beautiful piano playing, beautiful ‘80s music influences create a sound that almost ring dreams, Ashley draws the band even manages to throw in some old arcade vocals, and a childlike playfulness and wonder that completely defies categorization. This album can furiously to sort out her game sounds without any cheesiness. Overall, the is as inspiring as it is enjoyable. There is a strange only be described as sweet and romantic, taking ele- album is reminiscent of other British bands such as mix of sounds that can be traced to Pink Floyd, Tom ments from bands like the Sugarcubes and the Arcade inner torments. But the only Blur, Oasis and Radiohead, but there is also a little Waits (minus the gravely voice) and Thom Yorke, Fire and twisting them into the band’s own. This overt things that come out of her pencil are polar bears. something that’s almost Bob Dylan-like. On the tracks and all of this combined makes for perfect music sweetness, however, gets a little sickening, and much “Stuntman” and “Apnoea” one cannot help but draw for sleeping or relaxing to. While the album defi- of the album can be skipped over. Despite the boring In a house on a hill, Ashley lives with her French comparisons to early nineties house acts like the nitely has a different sound, Watson doesn’t play sappiness, there are a few tracks that stand out: mother, Inuit father, his mother and uncle, two broth- Chemical Brothers. Kasabian manage to do a lot with enough with genre, and the songs become a little “Glorious,” “Broke,” “East, West, North, South,” “Wax,” this album and it’s guaranteed to please any alterna- tedious by the end. Stand-out tracks include: and “This Heart Keeps Beating for Me.” Consume ers and a chatty bird called Wiggins. The town always tive music lover. Stand-out tracks include: “Empire,” “Close to Paradise,” “Weight of the World,” and at own risk. feels too small for her, and right from the beginning “Shoot the Runner,” “Me Plus One,” “By My Side,” “The Storm.” “British Legion,” and “The Doberman”. www.captaintheband.com author Bastedo gives the reader a sense that what- www.patrickwatson.net www.emimusic.ca ever is going on inside Ashley is going to eventually www.kasabian.co.uk www.secretcityrecords.com www.rcarecords.com -Melody Rogan boil over. Everyone in the family seems tapped into -Melody Rogan Ashley’s gifts, which slowly reveal themselves as the -Melody Rogan story goes along. Her crazy great uncle Jonah is tor- mented by fits that only her grandmother understands are somehow deeply connect to Ashley’s prophetic

dreams and polar bear drawings. What ties this book together, and makes it unique, TEDIOUS MINUTIAE is the way it is written from three perspectives. The first Or: Ineffectively Detailing One’s Cultural Consumption for the Uncaring Installment 2.8 is Ashley’s, which tells the outright story. The second is a journal she keeps of her dreams, which tells the The ‘90s indie rock reunion installment latent story of the novel. And the third perspective is that of a polar bear who roams near the town search- ing for food and trying to cope with a changing envi- By Ben MacPhee-Sigurdson Billy Corgan. the dreamy Stephen Malkmus on stage with [email protected] -Chavez, underground heroes, are back his former comrades would be nothing short ronment. The combination of these perspectives illus- together for some shows following Matador’s of life-changing. trates the deep connection between the Inuit and polar Bands from the ‘90s are getting back re-release of their two excellent ‘90s records -Jawbreaker. This will probably never bears in a personalized way that shows that some- together, and I love it. LOVE IT! Of course, this in one package, Better Days Will Haunt You. happen, as Blake Schwarzenbach is ru- thing can be hunted and dangerous, while at the same admission dates me fairly succinctly, but I -Blind Melon have also reunited, albeit moured to either be living in Nova Scotia or time honoured and respected. It also comments not- without lead singer Shannon Hoon. The band teaching at a college in New York City, and don’t care. I’m 30. Take that! so-subtly on the impact that climate change can have In terms of the recently-reunited, so far tried to convince him to join, but he reminded the rest of the dudes from this band live in on Inuit culture. we have: them he was DEAD, so, uh, he couldn’t make California, methinks. As the bears in Ashley’s dreams begin to show -The Lemonheads, albeit with only front- it. Sadly, they have already recruited some -Fugazi…how did I not go to see them man Evan Dando from the original line-up (it new guy – if they really wanted to make this when they played here? They’re likely just on up in her waking life, she begins to realize that she is should be noted, however, that he managed reunion work they should have followed in the hiatus, albeit indefinite, but their last record hunting Nanurluk, a giant polar bear, also known as a to nail down Descendents’ Bill Stevenson and footsteps of Aussie rockers INXS and made it (The Argument) was their absolute best. spirit bear, that lives in Inuit legends and artwork. This Karl Alvarez for the new record, which is very into a low-end gong show of a TV program -Sleater-Kinney should immediately revelation of purpose ties her closer to her family, as good). (RockStar: INXS). This reunion clearly should reform. I know they only broke up about ten she realizes that Nanurluk is also hunting them. not happen. minutes ago, but it’s time. -Sebadoh, although singer/principal Though Bastedo’s novel is a work of fiction, he songwriter Lou Barlow is pretty busy with Because I know you care SO much, here has based the events in the story on actual events. Dinosaur Jr., another ‘90s band recently are the bands I am hoping will reunite so I ***** What makes his story different than a “based on a true reunited (in which he plays bass). can bring my future kid to see them (inci- How lame was it that there was no live -The Pixies have been back for a while, dentally, said future kid has already gone to civic election coverage on TV? Don’t worry, story” movie or novel, is that all of the events he has touring endlessly, and word on the street is Death Cab For Cutie, Wilco, and the VERY loud for the US mid-term election and Liberal chosen are to a point: freak blizzards, flash floods, that they’ll try and write new material for a but excellent Junior Boys). So here’s who I leadership convention I’ll be all over it like melting ice caps, and of course, a rapidly dying spe- studio album. Given singer Frank Black’s hope will be next to reunite from the ‘90s: stink on a monkey, offering real-time blog- cies. Bastedo writes with a conscience, not only re- ability to put out three records a year, this -Pavement, ‘90s indie rockers nearest ging at the address below. specting the cultural values and myths of the Inuit, but and dearest to my heart, are reissuing and shouldn’t be a problem. also weaving together real scientific problems that -Smashing Pumpkins are also back, expanding all their albums (Wowee Zowee Dear You: [email protected] face the North, namely climate change and how it will although the only confirmed members comes out next week), and have insinuated New Plastic Ideas: likely cause the demise of the polar bear. are drummer Jimmy Chamberlin and a reunion isn’t ‘if’, but rather ‘when’. To see tediousminutiae.blogspot.com November 2, 2006 The Uniter contact: [email protected] Arts & Culture Editor: Mike Lewis E-mail: [email protected] Phone: 786-9790 16 ARTS & CULTURE Fax: 783-7080 Knowledge of Self Canadian Rapper K-os comes to town

Erin McIntyre This new level of depth, not only going beyond the superficial to find and reveal truth, but to speak about it “unspecifically “To love myself unconditionally is my so it’s more mystical” is one of k-os’ truly de- quest,” k-os confides while he rides his tour fining qualities as an artist. As k-os summa- bus to T-dot, “[with musical expression] you rizes “everything doesn’t have to be so up- can’t worry about if people get with it, that’s front,” and maybe it’s more intelligent if it’s the weird part.” Kheaven Brereton aka k- not so obvious. And while k-os has clear mu- os (standing for either “knowledge of self” sical ideas and direction of his own, a little or “Kheaven’s original sound”) is currently recognition doesn’t hurt either. touring across Canada as he goes “under- “I’m more confident [in my role as an ground” with his latest cd release Atlantis: artist] because people are paying atten- Hymns for Disco. Atlantis is the much an- tion,” since Joyful Rebellion’s release k-os ticipated follow-up to the wildly successful has raked in two MuchMusic Video Awards, Joyful Rebellion which cemented k-os’ place three Junos, and has been nominated for on the Canadian music scene. A self-titled a Grammy. Not bad for a boy from Whitby, “expressionist”, k-os feels Atlantis is a deeply Ontario. personal album, much more so than Joyful While k-os speaks often in interviews Rebellion or Exit. about the passion he has for the hip-hop of “I couldn’t tell you a year ago that those the ‘90s and how influential that’s been in songs could come out of me...[Atlantis his musical development, he also finds the is] my own sunken city and lost feelings.” new wave of “uncategorized” music, music Asked how the title Atlantis was signifi- fused with “rockelectrosoul or hiphop funk” cant for this album, k-os responded “its a is an interesting and important evolution. K-os brings the knowledge of self to Winnipeg Nov.5th FILE PHOTO resurfacing...[and an examination of] pla- “It used to be you’d get a group of people cebo, something existing just to make us together and say ‘we are a rock group,’ its not first and the people (judging the music) Knowledge Of Self.” think we’re greater.” like that anymore...people are more honest after.” In a different interview k-os elabo- K-os is no rookie to the cd release about expression.” rated on this idea “We shouldn’t allow our- K-os will be performing at the game. Atlantis is his third album, and as k- It is this idea of individual expression selves to get flooded by other’s opinions of Ramada Center on Nov. 5. You can os has grown and changed, so have his mu- that dominates k-os’ personal and profes- us, but instead look within ourself for foun- check out k-os’ website at sical ideologies sional philosophy. dation...I don’t want to walk around thinking www.k-osmusic.com. “When I was growing up hip-hop was “I call myself a selfish-altruist, I make I am here to change people or the world. I about a message, I though that was all music myself happy, if others benefit then so be it.” am not. I can only change myself. Cities can was for...then I hung around Indie bands The most important thing, K-os asserted, sink, but I believe that people can survive where no one talked about what it meant.” was to “worry about the creative moment if they follow a map or a compass marked

Growing up crazy ain’t all that bad New novel-to-film flick 'Running with Scissors' a faithful adaptation

ing doctor" refers to psychoanalysis and the tion of the struggling poet on Valium propels use of an electrotherapy machine. the drama and allows Augusten to find clo- Murphy admits that he was able to relate sure at the end. to Burroughs's childhood, to an extent. "What struck me was how much Annette "I was shocked by how similar my child- reminded me of my mother, and it really hood was, even though my mother didn't made it kind of difficult to watch," admits drop me off at the home of her wack-a-doo Burroughs. "And you can't really ask for that shrink. Our references were the same; our in a movie. I'm not famous. These people obsessions were the same. I had never met aren't famous. We're not playing queens and anybody else who had polished their allow- Truman Capote, so the actors didn't neces- ance. I just got what it was about,” he says. sarily have to be exactly like the real people, "I got what it was like to grow up with but in many cases, they really do capture the a mother who really wanted to be cele- personalities very well." brated and famous and who struggled with Among the other strong actors in the that," admits Murphy. "I thought it would be film is Cross, who makes his breakout per- a great way to make a movie about my life formance acting as Burroughs' 14-year-old www.RottentomatoEs.com without it being about my life." self. His portrayal of the unusual character Although one may assume that is surprisingly mature and unabashedly vul- Zalina Alvi "I always felt that Ryan deeply cared Burroughs has exaggerated the events of his nerable. Excalibur (York University) not only about making a great movie, but childhood, the author insists that after pub- In fact, all the actors in “Running with making a movie that I, in the end, would feel lishing his memoir, he often had people share Scissors” seem to use the unstructured was an honest reflection of my experience," their own similar experiences with him. nature of Burroughs's life story to act re- TORONTO (CUP) – Putting your life says Burroughs. "Sometimes, people do have trouble be- freshingly uninhibited. Together, the per- down on paper is a sketchy business. And The personal memoir and movie are lieving it [but] I've also come across people formances cause the film to come across as letting someone turn your autobiography both about Burroughs' childhood grow- who have come up to me and shared their brutally honest, darkly humorous and emo- into a movie is even riskier. What guarantee ing up in the ’70s. His father (played by Alec own childhoods, which have been very, very tionally mesmerizing. do you have that the truth will survive two Baldwin) is an alcoholic math professor, his similar," says Burroughs. The fact remains that it's impossi- degrees of separation? Or rather, what re- mother (Annette Bening) is an unstable poet "And the people with very similar child- ble to know if everything in “Running with sponsibility do your adapters have to remain with delusions of becoming famous and hoods, I've noticed, have been my age. I Scissors” is true, but ultimately, it doesn't faithful to your story at all? Augusten (Joseph Cross) is an unusual child think that that probably has something to do really matter. The film should come off as a with aspirations of becoming a hairdresser. with the period of time in the ’70s and the story about broken people and a dysfunc- Augusten Burroughs, author of After his parents' divorce, Augusten is early ’80s being a real period of change with tional childhood that easily transcends time “Running with Scissors”, doesn't feel that given away to live with his mother's shrink psychotherapy and with women's rights. periods. And it's also about a sense of sur- the film adaptation of his personal memoir (Brian Cox) in his "nuclear-family-gone- Women were stopping the role of the home- vival and evolution. has at all been unfaithful to his unusual life wrong" house, where his timid wife (Jill maker and coming into their own selves." "There are millions and millions of story. Clayburgh) eats dog kibble and where the Bening's portrayal of Deidre Burroughs people around the world who experienced "I've never felt like somebody has taken Christmas tree has been up for two years is central to Augusten's emotional journey in adversity and overcame it themselves. I'm my life and run away with it." running. the film. She plays a woman who has spent just glad there's a movie that accurately Burroughs insists that Ryan Murphy, Meanwhile, one of his daughters her life feeling oppressed by her husband portrays the complexity and the dark- writer, director and producer of “Running (Gywenth Paltrow) consults the Bible to and society and who finally realizes that she ness and the lightness and the humour of with Scissors” the movie, took great care to decide what's for dinner and his other wants to be her own person. Her often fanat- childhood." remain true to his memoir. daughter (Evan Rachel Wood) thinks "play- ical and emotionally unstable characteriza- contact: [email protected] The Uniter November 2, 2006 ARTS & CULTURE 17 LNovemberistings Coordi 2, 2006nator: NickThe W eigeUniterldt contact: [email protected] Want to submit your listing to Uniter Listings? Email your listings to [email protected] Listings Coordinator: Nick Weigeldt E-mail: [email protected] E-mail: [email protected] Deadline for submissions is Wednesday, eight days before the issue you’d like your Phone: 786-9497 Phone: 786-9497 @ listing to first appear in. The Uniter publishes on Thursdays, 25 times a year. 18 LISTINGS uniter.ca Fax: 783-7080

COMMUNITY ECONOMIC COUNSELLING AND to avoid inaccuracies in retyping VIRTUOSI CONCERTS presents NOVEMBER 2 ONWARDS DEVELOPMENT IN RURAL text for the journal. Submissions FILM “INTENSITY & REFLECTION” with PHILIPPINES with guest speaker CAREER SERVICES should be emailed to writerscollec- Steven Dann, viola & Rena Sharon, [email protected] with “Collective Community Economic Developer CINEMATHEQUE 100 Arthur St. piano. Saturday, Nov. 4, 8 p.m. The University of Winnipeg Career Consciousness submission” in the Lourdes Binuya. Wednesday, Nov. Nov. 3-9 (except Nov. 4), 7 p.m.: Eckhardt-Gramatté Hall, University ON CAMPUS Services is offering a series of Free subject line. By mail: mark as Col- 8 from 12:30 – 1:20 p.m. in room Tales of the Rat Fink, Mann. Nov. 4, of Winnipeg. Tickets: $29 adults / Career Workshops, open to all stu- lective Consciousness submissions, 3M65. Presented by the U of W 7 p.m.: Overnight by Montana and $27 seniors / $17 students. Call dents at the University of Winnipeg and sent to: The Writers’ Collective, Filipino Students Association. Smith. Nov. 4, 1 p.m.: Cinemental 786-9000 or visit www.virtuosi. and the Collegiate.The workshops will 4th Floor Library, University of Festival of French Cinema Short Film mb.ca. Free Parking available in the be held in the Career Resource Cen- Winnipeg, 515 Portage Avenue, Win- ONGOING HOMO HOP 13 An evening of Competition. Free admission. Nov. CBC Lot, accessed via Young Street. tre (0GM09). To sign up, stop by the nipeg, MB R3B 2E9. pure wickedness. With silent auction 3-9, 9 p.m.: The Science of Sleep, Co-Presented by The University of Counselling Services office(0GM06), Winnipeg & CBC Radio Two. and drag show. Nov. 10, Bulman email [email protected], Gondry. ENGLISH LANGUAGE PART- Centre. Tickets $14 only in advance or phone 786-9231. ART HISTORY STUDENTS’ NERS needed in the Language at the UWSA InfoBooth. All ages, 18+ ASSOCIATION All students are ELLICE CAFÉ & THEATRE 585 VIRTUOSI CONCERTS presents Partner Program, U of W Continuing require ID. welcome at our meetings, Thursdays Ellice St 975-0800 Neighbourhood Virtuosi Internationale with the Vogler Education Campus, 294 William Nov. 8: Resume Writing, at 12 p.m. Meet in the History Com- theatre and restaurant. Free movie String Quartet and Ian Parker, piano. Avenue. Language partners are 12:30-1:30 p.m. WORKSHOP: ANAK Beginner mon, Room 3rd Floor Ashdown. If nights Monday – Wednesday. Nov. 11, 8 p.m. in Eckhardt-Gram- native (or fluent) English speaking Nov. 13: S.I.I. Interpretation, Conversational Tagalog Workshop. you want to discuss arts & culture atté Hall, University of Winnipeg. volunteers who give ESL (English 12:30- 2 p.m. Classes are suitable for those who and meet new friends, check us out! Tickets: $39 adults / $37 seniors / as a Second Language) students Nov. 16: Interviewing Skills, PARK THEATRE 698 Osborne St do not have any Tagalog background It’s also a great opportunity to get $27 students. Call 786-9000 or visit an opportunity to practise speaking 12:30-1:30 p.m. 478-7275 Neighbourhood theatre or those who would like to practice involved in student projects, from www.virtuosi.mb.ca. Free Parking English outside of the classroom and and venue. Monday nights: Monday some of their vocabulary. Nov. arts writing to campus socials. available in the CBC Lot, accessed to learn more about the Canadian Night Football. 14, 6 p.m.- 9 p.m. in room 3M61. via Young Street. Co-Presented by way of life. The day and time partners Theme: Autobiography, learn com- WINNIPEG FREE PRESS AND The University of Winnipeg & CBC meet is flexible. The time commit- INTERNATIONAL mon phrases, how to introduce WRITERS’ COLLECTIVE AN- CINEMENTAL MANITOBA’S Radio Two. ment is 1-2 hrs./week. Contact Rina yourself, describe yourself and your STUDENTS’ NUAL NON-FICTION CONTEST FRENCH-LANGUAGE FILM Monchka, 982-1151; r.monchka@ interests. $20 workshop fee (includes INFORMATION The challenge this year is to write FESTIVAL is celebrating its 15th WINNIPEG CLASSICAL GUI- uwinnipeg.ca. materials). Email the University of SESSIONS a non-fiction story on the theme “I edition from Nov. 1 – 5 at Portage TAR SOCIETY International Con- Winnipeg Filipino Students’ Asso- won!” What did you win? The lottery? Place’s Globe Cinema. Nine of 14 cert Series Margarita Escarpa solo movies – including Bon Cop, Bad UNIVERSITY OF WINNIPEG ciation at [email protected] for more Nov. 8: Health in Canada: 12:30- The match? The day? A reprieve? recital. Nov. 4, 8 p.m. at the Manitoba Cop, Cheech, A Sunday in Kigali, TOASTMASTERS Meetings are information. 1:20pm Room 1L04. This session His heart? Or how did you win? By Museum Planetarium Auditorium. and Congorama – are subtitled in held regularly on Friday mornings provides you with information about persevering? By leading a good Call 667-5250 or 775-0809 for tick- English. A full program will be an- at 7:15 a.m. with the first meeting of “SENSITIVITY AND UNCER- your health plan coverage and ways to life? By taking a chance? By means ets or info. the year to take place Friday, Sept. nounced at www.cinemental.com. TAINTY ANALYSES for a SARS stay healthy while you’re in Canada. that made you proud or ashamed? 8 in Room 2M70. Students, faculty, Model with Time-Varying Inputs Find out how health and wellness are Prizes are $500 for first place, $300 THE WINNIPEG SINGERS Call and members of the community are and Outputs” - A Seminar Lecture by important to your academic success. for second and $100 for third. Fee is GLOBAL JUSTICE FILM FES- 989-6030ext1 or visit www.winni- welcome. It’s an opportunity to im- Dr. R. McLeod presented by the UW $5 for Writers’ Collective members, TIVAL Nov. 3 & 4 at the University pegsingers.com. Next concert is Nov. prove confidence in public speaking Math/Stats Students’ Association. $10 for non-members. The deadline of Winnipeg. Featuring films from the 7 at Westminster United Church. and writing, share your creativity, Wednesday, Nov. 15, 2006, 12:30- DIVISION OF is Nov. 1, 2006. All entries MUST be Travelling World Community Film meet a diverse group of people, and sent with an entry form, available by Festival, discussions, entertainment 1:20 p.m. in room 1L13. WINNIPEG SYMPHONY OR- become a leader. Come and be our CONTINUING calling (204) 786-9468, or emailing and displays. Tickets $20/$10 for Concerts almost weekly guest! For more info call 284-5081. EDUCATION [email protected]. both days. To register online visit CHESTRA during the fall. Call 949-3999 or visit WHAT RAP HAS TO SAY: Black www.globaljusticefilmfestival.ca/. Youth, Discourses of Crime and Title: Ethics in the Work- the WSO box office at 555 Main Street. Cosmopolitanism. Nov. 15, 12:30 place LITERARY EVENTS – 2 p.m. in room 2M70. The Centre for Research in Young People’s AROUND TOWN THEATRE, DANCE & McNALLY ROBINSON GRANT Texts and Cultures (CRYTC) and the Instructor: Bill Cessford Date: Nov. 18 MUSICAL PERFORMANCE PARK Nov. 2, 7 p.m.: Rod Lehmann DIY WORKSHOPS Yoga at Department of English welcome visit- signing copies of Surviving the Calls Lunch, Wednesdays from Nov. 1 – 22 ing scholar Dr. Rinaldo Walcott. Dr. Time: 1 Saturday, 9:00 a.m. - 5:00 p.m. of Nature, humourous tales of the at 12:30 p.m. in the Bulman Centre. Walcott is Associate Professor in the CONCERTS outdoors. Nov. 2, 8 p.m.: Anthony Self Defence Nov. 14 at 5:30 p.m. in Department of Sociology and Equity Cost: $175.00 THE GRIND First Thursday of the Location: 294 William Ave month at Ellice Café & Theatre (585 Bidulka reading and signing the lat- the Bulman Centre. Contact Vivian Studies in Education at the Ontario est Russell Quant mystery, The Stain Belik at [email protected]. Institute for Studies in Education Registration or Information: Ellice Ave) The Grind, a venue to en- 982-6633 FRANK BLACK & THE CATHO- courage and develop performers and of the Berry. Nov. 6, 7 p.m.: Brad of the University of Toronto, where LICS W/ KENTUCKY PROPHET Gushue signing copies of Golden he also holds the Canada Research their ideas through the presentation WESMEN TAILGATER PARTY Nov. 5 Pantages Playhouse Theatre, of scenes, sketches, monologues, Gushue. Nov. 6, 8 p.m.: Arthur Slade Come out and show your school Chair in Social Justice and Cultural 7 p.m. Tickets $30 at Ticketmaster. reading and signing Megiddo’s Shad- Studies. spoken word, short film, stand-up pride while your Wesmen play against ANNOUNCEMENTS and music in front of a live audience. ow. Nov. 7, 7 p.m.: Giller Light Bash, the U of M Bisons on Nov. 2. Preparty K-Os Nov. 5 Garrick Centre at the 7p.m. $4 per person. Next event: Oct. a fund-raiser for Frontier College. begins @ 4:30 p.m. second floor of FIRST EVER ANNUAL GENER- Marlborough, 7 p.m. Tickets $27.50 4. Tickets $25 and available at Prairie Duckworth Centre! Games begin at AL MEETING OF MOUSELAND DO YOU LIKE WORKING WITH at Ticketmaster. Ink Restaurant. Nov. 8, 7:30 p.m.: 6:15 p.m.! All students in attendance PRESS Nov. 16, 12:30 p.m. in room NEWCOMER CHILDREN? Do Rosemary Sullivan discussin Villa get free tickets to the afterparty at ORM06, Bulman Centre. Mouseland you believe you can change our com- CERCLE MOLIÈRE 340 Air-Bel. Nov. 9, 7:30 p.m.: Margaret Alive nightclube in the Exchange! All Press is a new, non-profit student/ munity? If so, consider volunteering JULIE DOIRON W/ SHOTGUN Provencher Blvd.Tickets available at MacMillan presents Nixon in China: people in attendance can enter to win community corporatiom established with some of our programs. The & JAYBIRD, THE WOOLY 233-8053 or visit www.cerclemoliere. The Week That Changed The World two Grey Cup Tickets. to publish The Uniter, the official stu- Citizenship Council of Manitoba LEAVES Nov. 5 Collective Cabaret, com. Nov. 17 – Dec. 9: La Boutique at the Hotel Fort Garry, $7. Nov. 9, 8 dent paper of the University of Win- Inc. International Centre is looking 8:30 p.m. Tickets $8 at Music Trader, au coin de la rue. p.m.: K.I. Press reading and signing Into the Music. JEAN KILBOURNE “The Naked nipeg. Whether you’re a student at the for student volunteers to help new Types of Canadian Women…”. Truth” public lecture. Nov. 2, 7:30 U o f W or a person who lives, works arrivals to Canada learn English and TARA PLAYERS IRISH THE- – 9:45 p.m. Eckhardt- Gramatté or volunteers in the area, we, the feel welcome in our country. Oppor- SERENA POSTEL CD RE- ATRE COMPANY 654 Erin St. MCNALLY ROBINSON POR- Hall. Internationally recognized for interim board of Mouseland Press, tunities exist for volunteers to give LEASE Nov. 10 Gas Station Theatre, Tickets available at 772-9830. Nov. TAGE PLACE Nov. 2, 7 p.m.: Ken her pioneering work on alcohol and would like to see you support your their time and support to the Centre’s 8 p.m. Tickets $10 ($5 for Gas Station 16 – 18, 23 – 25: The Last of the Last Black launching Telling It Like It Was. tobacco advertising and the image media by taking out a membership Immigrant Children and Youth Pro- members) at The Gas Station, Into the of the Mohicans. Nov. 9, 7 p.m.: Mel Atkey performs of women in advertising, Jean Kil- and coming to the first ever Annual grams including Sports Activities for Music, Music Trader. and launches Broadway North at bourne was named by The New York General Meeting. Memberships are Newcomer Kids, Empowerment for MANITOBA THEATRE CENTRE 7 p.m. Nov 12: Russ Gourluck Times Magazine as one of the three $2 for students and $12 for com- Newcomer Youth, Newcomer Buddy MANITOBA BLUES SOCIETY’S 174 Market Ave. Tickets available launches Going Downtown: A His- most popular speakers on college munity members. Contact The Uniter Welcome Program and our After ANNUAL BIRTHDAY BASH at 942-6537. Nov. 23 – Dec. 16: tory of Winnipeg’s Portage Avenue campuses today. This presentation office for more details at 786-9790. Class Education Program. If you’d featuring Big Deal Band, Scotty Hills Orpheus Descending. at 2 p.m. Nov 23: Gail Sidonie Sobat is relevant for students, teachers, like to help out, contact Si-il Park at Band, with The M.B.S Jammers. Nov. signs and reads from The Book of 943-9158 ext 285 or 688-1941. guidance counselors, social workers, VIRTUOSI CONCERTS presents 10 The Windsor Hotel, 8 p.m. Tickets MANITOBA THEATRE CEN- Mary at 7 p.m. dietitians, nurses, doctors, psycholo- ARTiculate: Building Musical Bridges $5 for members, $10 for non-mem- TRE WAREHOUSE Third floor, gists, occupational or recreational “A Taste of Montreal” with original KAPATID IN-SCHOOL MEN- bers available at the door. Portage Place. 140 Rupert St. Tickets PRAIRIE FIRE presents Fall Word therapists, and others interested in pictures featuring poet Robyn Sarah TORSHIP PROGRAM Partnering available at 942-6537. Until Nov. 11: Fest 2007 with visiting writer Bill disordered eating. & Eli Herscovitch Dueo. Monday, university students with Filipino REEL BIG FISH Nov. 12 Garrick The Retreat from Moscow. Gaston and local writers Jan Horner Nov. 17, 12:30 – 1:20 p.m. in Eck- new comer high school students as Centre at the Marlborough, 8 p.m. and Maurice Mierau. Readings take LYNN RICHARDSON’S ‘IN- hardt-Gramatté Hall, University of in-school mentors. Weekly Mondays With Streetlight Manifesto, Suburban place Saturday, Nov. 18, 2006 at 7:00 Winnipeg. Free admission. to Thursdays from 4:00 p.m. to 5:00 PRAIRIE THEATRE EX- TER-GLACIAL FREE TRADE Legends and Westbound Train. Tick- CHANGE Call 942-5483 or visit PM at McNally Robinson Booksellers AGENCY.CA’ Opening Reception p.m. Learn how to become eligible ets $19.50 through Ticketmaster. - Grant Park (travel alcove). For more for the UWFSA Bursary. To volunteer www.pte.mb.ca. Nov. 16 – Dec. 3: for the Winnipeg artist’s new sculp- THE UNIVERSITY OF WINNI- Mom’s the Word 2: Unhinged. information contact us at 943-9066. tural installation in Gallery 1C03 on PEG DOWNTOWN JAZZ BAND email the University of Winnipeg Admission is free. Filipino Students’ Association at THE DEARS W/ THE BLOOD- Nov. 2, 4 – 6 p.m. Artist’s Talk on “Come out and sample some jazz... LINES Nov. 21 Garrick Centre, 8 Nov. 9 at 12:30 p.m. from swing to latin... and even a [email protected] for more informa- THEATRE PROJECTS MANI- tion. p.m. Tickets $20/23 through TIcket- TOBA Begins its season with the SPEAKING CROW OPEN-MIC little somethin’ for the kids.” Nov. 27, master, at Into the Music. POETRY First Tuesday of the month 12:30 – 1:20 p.m. in Eckhardt-Gram- Winnipeg premiere of RM Vaughan’s VIRTUOSI CONCERTS presents The Monster Trilogy from Nov. 2 to at Academy Bar & Eatery. “INTENSITY & REFLECTION” with atté Hall, University of Winnipeg. WII CHIIWAAKANAK LEARN- Free admission. ING CENTRE VOLUNTEER XAVIER RUDD W/ NDIDI 12. WCD Studio, 211 Bannatyne at Steven Dann, viola & Rena Sharon, Main Street. Call 989-2400 or visit 89 Princess St OPPORTUNITIES Do you need ONUKWULU Nov. 24 Burton AQUA BOOKS piano. Saturday, Nov. 4, 8 p.m. www.theatreprojectsmanitoba.ca. The Stone Soup Storytellers’ Circle, volunteer hours on your resume? Cummings Theatre, 8 p.m. Tickets Eckhardt-Gramatté Hall, University veteran Winnipeg storytellers, meets Do you need volunteer hours for a $30/25.50 through Ticketmaster. of Winnipeg. Tickets: $29 adults / for storytelling once a month on WORKSHOPS AND class? Come and volunteer in the MANITOBA CHAMBER OR- $27 seniors / $17 students. Call Saturdays at 7:30 p.m. Next get Wii Chiiwaakanak Learning Centre. CHESTRA Call MCO at 783-7377 786-9000 or visit www.virtuosi. SEMINARS together is on Nov. 11. All are wel- The Community Learning Com- or pick up tickets at McNally Rob- mb.ca. Free Parking available in the COMEDY come. ideaExchange: Aqua Books, in mons is located at 509-511 Ellice inson or Ticketmaster. All concerts CBC Lot, accessed via Young Street. conjunction with St. Benedict’s Table, Ave. Please submit your resume to: begin at 7:30 p.m. at Westminster Co-Presented by The University of is pleased to present our award-win- MATH / STATS Christine Boyes, RBC Community United Church. Next concert is on Winnipeg & CBC Radio Two. TOAD IN THE HOLE / THE ning monthly conversation series Learning Commons Coordinator, Wii Nov. 22. STUDENTS’ CAVERN 112 Osborne St – Com- dealing with issues of faith, life, Chiiwaakanak Learning Centre, The UW MATH / STATS STU- ASSOCIATION edy at the Cavern. Third Wednesday theology and pop culture. Nov. 25: University of Winnipeg. Phone: 789- DENTS’ ASSOCIATION General of the month. Nov. 8: Host John B. MOZART’S ‘GREAT MASS’ Jaylene Johnson, “Christian Music: 1431; Fax: 786-7803; Email: clcc@ Meeting, Wednesday, Nov. 8 12:30 Duff. premiering in Manitoba with a first- What’s the Point?” MATH PROBLEM-SOLVING uwinnipeg.ca. – 1:20 p.m. in TBA. Visit www.geoci- WORKSHOPS by Dr. J. Currie. ever collaboration of The Winnipeg Singers, the Winnipeg Philharmonic ties.com/uwmssa/. Every Monday, 1:30-2:20 p.m. in THE KING’S HEAD PUB 120 is an open mic op- THE WRITERS’ COLLECTIVE Choir and the Manitoba Chamber Or- OUT LOUD room 3C29. For students planning King St – King’s Head Happy Hour portunity for you to give your words is always looking for contributions chestra. Nov. 7 & 8 at 7:30 p.m. both PHILOSOPHY COLLOQUIUM to try either of the upcoming math Weekly Comedy Night, Tuesdays at voice. Every two weeks a special for our bimonthly journal, The Col- nights at Wesminster United Church, SERIES Nov. 8, 12:30 – 1:30 p.m. competitions or for students simply 9 p.m. Nov. 7: Original Comedy of guest will kick off the evening after lective Consciousness. We publish 745 Westminster at Maryland. Tick- in room 1L12. Peter Ives (Politics, interested in learning some tech- the King’s Head – Stand-Up with host which the mic is open for your words poetry, short fiction, short non-fic- ets $24/$22/$7 students plus GST UWinnipeg), “Rethinking Coercion niques for solving interesting math Darcy Taves. Winnipeg: Cage Match of any genre in five minutes or less. tion, screenplays, plays, articles, at McNally Robinson Booksellers or & Consent”. This lecture is open to problems. – Improv with host Ryan McMahon. Third Thursday of the month. Sign up interviews, book reviews, and more. Ticketmaster. anyone interested in the topic. Please is at 7 p.m. Open mic at 7:50 p.m. All submissions should include a join us, and feel free to bring your Free. brief (roughly 3 lines) personal biog- lunch! raphy. We prefer email submissions Listings Coordinator: Nick Weigeldt Want to submit your listing to Uniter Listings? Email your listings to [email protected] contact: [email protected] The Uniter November 2, 2006 E-mail: [email protected] Deadline for submissions is Wednesday, eight days before the issue you’d like your Phone: 786-9497 listing to first appear in. The Uniter publishes on Thursdays, 25 times a year. @ Fax: 783-7080 LISTINGS uniter.ca 19

AD LIB is an evening of improve- KEN SEGAL GALLERY 4-433 WAYNE ARTHUR GALLERY 4: Groovy Moustache. Nov. 9: Dale and classical to contemporary. Free the Late Lunch Show, a series of style word games. Every night is River Ave 477-4527 Tues-Fri 10-6, 186 Provencher Blvd 477-5249. Willis, Aaron Gardner, Eddie Caser. admission, Carol Shields Audito- 9 fabulous workshops designed guaranteed to be different and full of Sat 10-5. Showcase of original Gallery for Manitoba-based artists. Nov. 10: Steeple Chaser. Nov. 11: rium, 2nd Floor Millenium Library specifically for the self-employed. laughs. From round stories to fridge contemporary art. Until Nov. 25: ‘The UOpening Nov. 3: ‘In the Begin- Guy Abraham Band. downtown, 12:10-12:50 p.m. With topics ranging from Healing magnet poetry, from opening lines to Treaty 3 Suite (Outside Promises)’ by ning…’ Quilted art wall hangings by Through the Arts to Financial Man- creating new endings, there’s no limit Tim Schouten. Judith Panson. MONDRAGON BOOKSTORE MANITO AHBEE: A Festival for agement, each hour-long session to the places these games – or your AND COFFEEHOUSE 91 Albert All Nations consists of five main provides an opportunity to connect writing – can go. First Thursday of LA GALERIE at the CENTRE WINNIPEG ART GALLERY 300 St. Political bookstore and vegan components – International Competi- with professionals, network with the month at 7:30 p.m. Free. CULTUREL FRANCO-MANI- Memorial Blvd 786-6641. On now: restaurant hosting readings, speakers tion Pow Wow, Education Day, Music other independent artists/producers, TOBAIN 340 Provencher Blvd Masters of Inuit Sculpture. Until Dec. and concerts. Wednesdays: Wobbly Festival, Indigenous Marketplace and gain valuable knowledge about 233-8972 Mon-Fri 8am-10 p.m. Sat- 3: Masterworks of Inuit Sculpture. Wednesdays. Nov. 5: Commu- and Trade Show, and the Aboriginal the cultural industry. Registration GALLERIES & Sun 12 p.m. - 10 p.m. Until Nov. 12: Until Jan. 1: Exhibition of Sculptures nity Harvest Dinner. See Community People’s Choice Music Awards. Nov. is $5.00 and includes a delicious ‘Gilles Carles un cinéaste de premier by Auguste Rodin. Until Jan. 7: Ex- Events. 2 – 5, with most events taking place lunch, so call 927-2787 to reserves EXHIBITIONS plan’ and ‘15 ans inoubliables’, cel- hibition of the works of Christopher at the MTS Centre. For more informa- your spot today. ebrating 15 years of Cinémental. Pratt. Until March 25: Mammatus OSBORNE FREEHOUSE 437 tion, visit www.manitoahbee.com. – An Installation by Max Streicher. Osborne St. Mondays: The Cool ARE YOU INTERESTED IN A Winnipeg Studio IN PLAIN VIEW LA MAISON DES ARTISTES Monday Night Hang, 8 p.m. First set MONDRAGON’S COMMUNITY HAR- CAREER IN FILM? Manitoba¹s Tour 2006 A group of Winnipeg 219 Provencher 237-5964 Mon-Fri WOODLANDS GALLERY 535 followed by a jam session. Acoustic VEST DINNER Nov. 5 at Mondragon, growing film industry is looking for artists have organized two weekend 9-5. Until Nov. 7: ‘Confidences’ by Academy Rd 947-0700. Until Nov. 4: Night every Tuesday and Thursday 91 Albert Street. Featuring delicious people who are hard working, self- self-guided studio and gallery tours Diane Lavoie. ‘Bigboys’ by Tanya Klimp. evening beginning at 8 p.m. Nov. 2: heart-warming food from our com- motivated, and have strong commu- to take place on the weekends of Nov. Floor 13. Nov. 4: 3rd Anniversary. munity farmers. With live entertain- nication skills to become members 4 & 5 and Dec. 2 & 3 from 12 noon ment. Reservations may be made at of Manitoba¹s film crew. To learn to 6 p.m. on these days. Visit www. LABEL GALLERY 510 Portage more about working in Manitoba¹s Ave 772-5165 Tues-Sat 12-5. Vol- THE PARK THEATRE 698 Os- Mondragon. Tickets $35 or $5 for an inplainviewwinnipeg.com for info. BARS, CAFES & VENUES accompanied child under ten. expanding film industry, attend a unteer artist-run non-profit art centre borne St. Mondays: Monday Night free Monthly Information Session showcasing works of community Football on the big-screen, free ad- ACE ART INC. 290 McDermot St the first Wednesday of every month artists. ACADEMY BAR & EATERY mission. Nov. 2: Pretty Train Crash, FROM OUTRAGE TO ACTION from 5:30-6:30 p.m. at Film Training 944-9763 Tues-Sat 12-5. Until Nov. The Nods, Domenica, Broken Halo. A Human Rights Workshop Series. 18: Shelley Low, ‘Self-Serve at La 414 Academy Rd. Nov. 2: Greg Milka Manitoba, 100-62 Albert Street. For MANITOBA CRAFTS COUN- Crowe. Nov. 3: Doug Edmond. Nov. Nov. 12: Dylan Cash CD Release. Free admission, space is limited so more information call 989.9669 or Pagode Royale’. Until December 9: register early by contacting Louise ‘Crumpled Darkness’ Haraldur Jóns- CIL EXHIBITION GALLERY 214 4: Todd Hunter Band. Nov. 8: Katie visit www.filmtraining.mb.ca. McDermot Ave 487-6114 Tues-Fri Murphy. Nov. 9: Once Just. Nov. 10: PYRAMID CABARET 176 Fort at [email protected]. Nov. 6, 7 – 9 son and Steingrímur Eyfjörð. Curated p.m.: Human Rights Activism 101. / Organised by Hannes Larusen and 11-5, Sat 11-4. Contemporary arts Manitoba Songwriters’ Circle. Nov. St. Thursdays: The Mod Club. Nov. 2006 PRAIRIE FIRE PRESS - and crafts. 11: Brenda Neiles and Bill Dowling. 4: X-Status, Derek Miller and guests An introduction to human rights Birna Bjarnadóttir. activism and Amnesty International. MCNALLY ROBINSON WRIT- for the Manitoba Aboriginal festival. ING CONTESTS (Bliss Carman Nov. 11: Moses Mayes CD Release. Room 113 Menno Simons College, ADELAIDE MCDERMOT MARTHA STREET STUDIO THE CAVERN / TOAD IN THE 520 Portage Ave. Poetry Award - Judge: Lorna Crozier, GALLERY 318 McDermot Ave 11 Martha St 772-6253 Mon-Fri HOLE 108 Osborne St. Third Short Fiction - Judge: Sandra Bird- 10-5. Showcasing the fine art of Wednesday of the month: Comedy REGAL BEAGLE 331 Smith St. sell, Creative Non-Fiction - Judge: 987-3514. THE COLD WAR AND THE printmaking. Until Nov. 8: Prints by at the Cavern. Sundays: Debra Lyn Tuesdays: Hatfield McCoy. Wednes- Stan Dragland). $5,250 in prizes. A Global Lisa Tagnon. Neufeld and Gord Kidder. days: Open Mic Nite. Weekends: NEW IMPERIALISM: Deadline: Nov. 30, 2006. For infor- THE ANNEX GALLERY 594 History, 1945-2005” by Henry Heller Blues. mation contact: Prairie Fire Press, Main St 284-0673 Tues-Sat 12-5. book launch. Nov. 9, 7 p.m. at Mon- 423-100 Arthur Street, Winnipeg, Contemporary art. MEDEA GALLERY 132 Osborne CENTRE CULTUREL FRANCO- dragon Bookstore & Café, 91 Albert Manitoba R3B 1H3. Phone: (204) St 453-1115 Mon-Sat 10:30-5, Sun MANITOBAIN 340 Provencher ROYAL ALBERT ARMS 48 Albert Street. Free admission. 1-4. Nov. 5 – 18: ‘Manitoba Light’, Blvd. Tuesdays: Le Mârdi Jazz. Cana- St. Oct. 27: Pretty Girls Make Graves. 943-9066, E-mail: [email protected], 4-62 ARTBEAT STUDIO INC. photos by Jack Gantzel. dian Jazz Concert featuring Murley, Nov. 3: Savannah, Methodological www.prairiefire.ca. Albert St 943-5194. Community- Braid Quartet and Tara Davidson. Breed. Nov. 4: Mahogany Frog. Nov. ANNUAL SING FOR PEACE based contemporary art. Project Peacemakers fundraiser at Tickets $22/$15 students at www. 7: Anonymous. Nov. 8: One-900, Do- WITH ART, a community-based MAWA - MENTORING ART- Crescent Fort Rouge United Church. ISTS FOR WOMEN’S ART jazzwinnipeg.com. menica, Floor 13. Nov. 10: Damascus program for collaborative art projects ART CITY 616 Broadway Ave Nov. 12, Tickets $10, children 12 and 611 Main St 949-9490. Supporting CD Release. between community groups and 775-9856 Mon 5-8 ,Tues-Fri 4-8, Sat under are free. For tickets and more women artists at their new home on COLLECTIVE CABARET / DIE artists in Winnipeg. The program is 12-4. Featuring high quality artistic information call 775-8178 or email Main Street. MASCHINE CABARET 108 SALSA BAR & GRILL 500 based on the belief that WITH ART programming for kids and adults. [email protected]. Osborne St. Thursdays: Good Form, Portage Ave. Thursdays: Urban Hip communities can explore issues, ex- press identity and create dialogue by OUTWORKS GALLERY 3rd Indie Club Night, $3. Hosted by DJ Hop. Fridays: Salsa/Top 40. Satur- THE EDGE ARTIST VILLAGE K’ASHO GO’TINE GOVER- working with professional artists on a Floor 290 McDermot Ave 949-0274. Font Crimes and Rob Vilar. Fridays: days: Salsa. Sundays: Reggae and 611 Main St. Fea- NANCE & THE MACKENZIE shared goal. Artists will be matched AND GALLERY Artist-run studio and exhibition Punk/Hardcore Night w/ Fat Mat & Calypso. turing exhibits by Winnipeg artists Scott Wade. Saturdays: Goth/Indus- GAS PROJECT This presentation with community groups to create space in the Exchange. Until Nov. will provide an overview of the a project plan with an emphasis on Christian Worthington and Kelvin trial Night. Nov. 4: Venetian Snares, SHANNON’S IRISH PUB 175 18: ‘Shattered Pieces’ by friend and proposed Mackenzie Gas Project in the art-making process. WITH ART Adair Free. Fanny, Cakebuilder. Nov. 5: Julie Carlton St. Nov. 2: 80s Night. Nov. member artists. relation to the Dene/Metis communi- is interested in artists working in all Doiron, Shotgun, Jaybird, Wooly 3: The Stars, The Perms. Nov. 4: Pat ties in its path. The presentation will art forms such as visual, performing FLEET GALLERIES 62 Albert Leaves. Nov. 10 The Bicycles. Nov. Alexandre. Nov. 5: Nate Bryski. Nov. OSEREDOK GALLERY 184 be based on research conducted last and literary arts. Deadline for receipt St 942-8026 Mon-Thur 8:30-5:30, 11: Raising the Fawn. 6: Jeremy Williamez. Alexander Ave E. 942-0218. Until spring and summer in the community of expressions of interest is Dec. 15, Fri 8:30-5, Sat 9:30-4:30. On now: Nov. 25: ‘Convergence’ art exhibit of Fort Good Hope, which last winter 2006. Criteria, requirements and ‘Women Reflect’ by Leona Brown, and sale. ELEPHANT & CASTLE PUB TIMES CHANGE(D) HIGH AND rejected a proposed impact and selection process available at www. Huguette Snodgrass, Brenda Warner, 350 St Mary Ave. Thursdays at LONESOME CLUB Main St @ St. benefits agreement offered by Impe- winnipegarts.ca or call 943-7668. Mary Anne Rudy. 8p.m.: PubStumpers. Sundays: PLATFORM (CENTRE FOR Mary Ave. Sundays: Blues Jam with rial Oil. The presentation will focus Student night with live entertainment. Big Dave McLean. No cover charge. PHOTOGRAPHIC AND DIGI- on the manner in which settlement PLAN YOUR WINNIPEG: GALLERY 1C03 Centennial Hall, Nov. 5: J.D. Edwards Band. Nov. 12: Nov. 3: Twilight Hotel, Stahr, Roldo. TAL ARTS) 121-100 Arthur St of their land claim, the Sahtu treaty, Get together with your class, your University of Winnipeg 515 Portage Athavale. Nov. 9: Campfire Night. Nov. 10: 942-8183 Tues-Sat 12-5. Photo- has ‘prepared’ them for this develop- friends or on your own, and come Ave 786-9253 Mon-Fri 12-4, Sat 1- Hot Karl and the Steamers and The based media. Until Dec. 8: ‘Pripyat ment. Nov. 15, 12:30 – 1:20 p.m., up with the next best concept that 4. The Gallery provides the campus Jakebrakes. Nov. 11: Nathan, After Floors’ by David McMillan. ELLICE CAFÉ & THEATRE 587 307 Tier Building, U of Manitoba. All will forever change the city. If your community and general public with Alll These Years. Ellice Ave. Neighbourhood café and welcome, free admission. idea is selected, we’ll help you final- opportunities to learn about visual theatre showing films and showcas- ize it with all the bells and whistles art, thereby reinforcing and empha- PLUG-IN ICA 286 McDermot Ave ing local talent. Nov. 8: Supernova WEST END CULTURAL CEN- ‘NAME YOUR PRICE’ ANNUAL including blueprints and those cool sizing the educational mandate of 942-1043. Until Nov. 18: ‘Unlearn’ Band showcase. TRE Ellice Ave @ Sherbrook St. ART AUCTION at the Forum Art scale models if needed! The winner the University. Until Dec. 2: Lynn – international range of emerging See Concerts for details. Nov. 2: Institute, 120 Eugenie Street & Tache of each category will get $1000, with Richardson’s ‘Inter-Glacial Free Trade and established artists, curated by FINN’S PUB 210-25 Forks Market Broadcast Radio with Ash Dubois, Ave., 235-1069. Friday, Dec. 1 from $500 for second place. The deadline Agreement.ca’. Steven Matijcio. Rd, Johnson Terminal. Tuesdays: Ego 8 p.m. Nov. 4: The Details. Nov. 5: 2 – 8 p.m., Saturday & Sunday, Dec. for initial submissions is December Spank, 10:30 p.m. Wednesdays: Guy Chaos Forge w/ Seventeen 69, $5. 2 & 3 from 10 – 4 p.m. Many fine 16. Visit http://plan-your-winnipeg. GALLERY 803 - 803 Erin St 489- SEMAI GALLERY Basement Abraham Band. Nov. 8: International Guitar Night, artists have created original works in uwinnipeg.ca. 0872 Local artists featured. Until Corridor, 264 McDermot Ave 943- 8 p.m. Nov. 10: Menopause w/ The acrylics, watercolours & sculpture Nov. 4: ‘Sexy Body’ Felson Nest and 2446. Until Oct. 29: ‘Scouting’ FOLK EXCHANGE 211 Bannatyne Volts, 8 p.m. in a variety of styles & sizes for you Nestor Finch Inc. by Dominique Rey by Noam Gonick. Until Nov. 21: MANITOBA WRITERS’ GUILD Ave. Traditional Singers’ Circle to choose from. Your home or office and Cyrus Smith, with William Eakin. ‘that’sneighbour’ by local artist Kazu, INC. Celebrating the 25th Anniver- (third Monday of each month, $2 at WINDSOR HOTEL 187 Garry St. will be complete with art or it would Nov. 16 – Jan. 4: Recent works by originally from Japan. sary of the MWG, ‘Friends: A Contest the door). Drumming Circle (fourth Tuesdays: Jam with Ragdoll Blues. make a great gift. Ask us about the Winnipeggers Craig Love and Cliff for Writers’ Tell us what it means to Monday of each month, $2 at the Wednesdays: Jam with Big Dave gift of art classes. Free – all welcome Eyland. you to be a friend. Your original, THE UNIVERSITY OF WINNI- door. Folk Club (first Monday of each McLean. Nov. 2: Digging Roots and - browsing encouraged, door prizes, unpublished writing should dem- PEG’S ARCHIVES AND HAM- month, $4.99 at the door). Tickets South Thunderbird. Nov. 3: South free parking and wheelchair access. onstrate the importance of friends. GALLERY LACOSSE 169 Lilac St ILTON GALLERIA 4th and 5th for all Folk Exchange concerts are Thunderbird. Nov. 4: Intellifunk, Dig- Visit us at www.forumartinstitute.ca. Fiction and non-fiction: max 5000 284-0726 Tues-Fri 10-6, Sat 10-5. Floors, Centennial Hall, University available at the Festival Music Store gind Roots, South Thunderbird. words. Poetry: max 25 lines. Sub- Small neighbourhood gallery. Nov. 9 of Winnipeg. Until Nov. 20: Photog- (231-1377), or at the door. mission forms may be downloaded, rapher Tyrrell Mendis captures the – 29: ‘The Newest & Latest’, Marim WOODBINE HOTEL 466 Main St. and more information obtained, from Daien Zipursky and Jayne Nixon. history of places of worship in his ANNOUNCEMENTS & GIO’S 155 Smith St. Wednesdays: Historic downtown hotel bar. www.mbwriter.mb.ca. $15 entry fee; solo exhibit ‘Testaments of Faith: OPPORTUNITIES Deadline: Dec. 31, 2006. Mail entries Manitoba’s Pioneer Churches’. Karaoke. Thursdays: Bump n’ Grynd. GALLERY ONE ONE ONE Main Fridays: DJ daNNo dance party. First THE ZOO / OSBORNE VILLAGE to 206-100 Arthur St, Winnipeg, MB, R3B 1H3. Floor Fitzgerald Building, School of Saturday of the month: Womyn’s INN 160 Osborne St. Thursdays: Art U of Manitoba 474-9322. Show- URBAN SHAMAN 203-290 night. Q-Pages Book Club, 5 p.m. DO YOU LIKE WORKING WITH New Band Showcase – No Cover. NEWCOMER CHILDREN? Do ing and collecting contemporary and McDermot Ave 942-2674. Contem- THE HEART AND STROKE you believe you can change our historical art at the U of M. Until Jan. porary Aboriginal art. Until Dec. 1: FOUNDATION OF MANITOBA HEMP ROCK CAFÉ 302 Notre community? If you said yes, con- 5: Exhibition featuring works by local Nadia Myre: ‘The Want Ads & Other needs 6,300 volunteers for its annual Dame Ave. Local and touring acous- sider volunteering with some of our artists Eleanor Bond, Aganetha Dyck, Scars’. Until Dec. 1: Dana Claxton’s door-to-door campaign during Heart tic and punk shows. programs. The Citizenship Council of Wanda Koop and Diana Thorney- ‘The Patient Storm’. COMMUNITY Month in February, 2007. HSFM Manitoba Inc. International Centre is croft. hopes to raise almost $800,000 and HOOLIGAN’S NEIGHBOUR- looking for student volunteers to help VIDEO POOL MEDIA ARTS warm hearts all over Manitoba during HOOD PUB 61 Sherbrook St. new arrivals to Canada learn English GRAFFITI GALLERY 109 Hig- CENTRE 300-100 Arthur St 949- the month-long event. Much of the Mondays, Tuesdays, Fridays: Kara- and feel welcome in our country. Op- gins Ave 667-9960. A not-for-profit 9134. Contemporary media art. funding HSFM receives comes from oke. Wednesdays: The Perpetrators. EVENTS portunities exist for volunteers to give community youth art center, using Nov. 10 – Dec. 8: Reasonable and volunteer-based events like Door- Thursdays: Andrew Neville and the their time and support to the Centre’s art as a tool for community, social, Senseless: The Technical Disaster to-Door. Ninety percent of funds Poor Choices. Sundays: Blues Jam Immigrant Children and Youth Pro- economic and individual growth. by Donna Szoke. On display in Jazz (see also On-Campus Events) raised stay in Manitoba to support with Scotty Hills and Curtis Newton. grams including Sports Activities for Winnipeg’s Arthur St. window space the Foundations mission “to improve Newcomer Kids, Empowerment with at 100 Arthur St. Meet the artist the health of Manitobans by prevent- HIGH OCTANE GALLERY, OS- SKYWALK CONCERTS & the Girl Guides, Newcomer Buddy Nov. 10 at 8 p.m. at the Video Pool KEEPSAKES GALLERY 264 ing and reducing disability and BORNE VILLAGE CULTURAL LECTURES 2006/07 Wednesday Welcome Program and our After Studio. McDermot Ave. Musical Keepsakes: death from heart disease and stroke CENTRE 445 River @ Osborne Lectures: Leading teachers and Class Education Program. If you’d Live music every Saturday evening. through research, health promotion St 284-9477. Local community art researchers from the University of like to help out, contact Si-il Park at and advocacy.” To volunteer for the gallery. Currently showing work by WAH-SA GALLERY 302 Fort St Winnipeg will inform, engage and 943-9158ext 285 or 688-1941. Mirek Weichsel, “Flatlands”. 942-5121. Aboriginal artwork. KING’S HEAD PUB 100 King St. challenge you on topics of broad his- door-to-door campaign, or any other Tuesdays: The Original Comedy of the Heart and Stroke Foundation event, torical, political and scientific inter- THE LATE LUNCH SHOW Kings Head. See Comedy for details. est. Thursday Concerts: We present visit www.heartandstroke.mb.ca/ or KEEPSAKES GALLERY 264 Mc- Sundays: All The Kings Men. Nov. 2: Attention independent artists and call toll free 1-888-473-4636. Dermot Ave 943-2446. A non-profit a showcase for some of Manitoba’s producers! Beginning September 15, The Black Aces. Nov. 3: Pat Keenan finest musicians - from jazz to folk gallery promoting handmade art, & the Exploited Labour Choir. Nov. 2006 at 1:00 p.m. Arts and Cultural crafts, pottery, cards and more. Industries Manitoba (ACI) presents LNovemberistings Coordi 2, 2006nator: NickThe W eigeUniterldt contact: [email protected] Want to submit your listing to Uniter Listings? Email your listings to [email protected] Listings Coordinator: Nick Weigeldt E-mail: [email protected] E-mail: [email protected] Deadline for submissions is Wednesday, eight days before the issue you’d like your Phone: 786-9497 Phone: 786-9497 @ listing to first appear in. The Uniter publishes on Thursdays, 25 times a year. 20 LISTINGS uniter.ca Fax: 783-7080

AWARDS & FINANCIAL AID: INFORMATION

The Roger Charest Sr. Award for ments must be submitted in English SOROPTIMIST FOUNDATION OF Deadline: submit online at www. UNIVERSITY Broadcast & Media Arts (two awards only. For more information, please CANADA GRANTS FOR GRADUATE datatel.com/dsf by Jan. 31, 2007. of $500 or one award of $1000) to cre- visit [email protected]. Deadline: Nov. STUDIES Surfing for more Dollars?: Try these ate a special program or series which 30, 2006. OF WINNIPEG websites for more possibilities! These may later be suitable for broadcast The Soroptimist Foundation of Canada two sites will lead you through Cana- and may further the cause of multicul- annually offers several $7,500 grants INTERNAL AWARDS: SHASTRI INSTITUTE MOUNT to female graduate students in Canada dian based scholarship searches. turalism in Canada. ALLISON UNIVERSITY SUMMER to assist them with university studies www.studentawards.com THE RAY VALDEMAR PEDERSEN The Roman Soltykewych Music Schol- PROGRAMME: that will qualify them for careers that BURSARY: arship ($500) is available to applicants www.scholarshipscanada.com The Shastri Institute and Mount will improve the quality of women’s (individual or group) determined to lives. Examples include but are not This bursary will provide a second Allison University are pleased to pursue further studies in the field of limited to: proving medical services, or third year student in Geography announce the Summer Programme in Ukrainian choral or vocal music. providing legal counseling and as- (or related discipline), who is a Ca- India. Students who have completed sistance, counseling mature women nadian citizen and who demonstrates The Anna Pidruchney Award for New two years of undergraduate study and entering or re-entering the labour an interest in a research project in Writers ($1000) is available annu- have completed a substantial compo- MANITOBA STUDENT AID market, counseling women in crisis, developing countries, with the op- ally to a novice writer for a work on nent of India Studies coursework, or PROGRAM (MSAP): counseling and training women for portunity to explore his/her interest a Ukrainian Canadian theme. Submis- have a particular academic interest non-traditional employment, and REMEMBER… please make sure you further through a 3-week summer sions for this year’s award must be in in Indian Studies may apply. The total positions in women’s centres. To be get your Pre-Study Confirmation of experience in Manila, The Philippines. English. cost of this programme is $5945 which eligible you must meet the following Income form to Manitoba Student Aid Preference will be given to a student includes application fees, tuition, Wm. & Mary Kostash Award for Film criteria: to facilitate calculations for Jan. loan who has completed one of the fol- airfare, room and board, materials, and Video Arts ($1000) is offered to documents. lowing courses: Geographical issues health and field trip costs. Provide a a novice writer for a work promoting A female in the Developing World, Population statement of purpose no longer than Ukrainian Canadian identity through Canadian citizen or landed immigrant Geography, and Geography of Glo- 300 words outlining how this pro- the medium of film, video or multime- balization. The value of the award is gramme will benefit you, an official dia (i.e. DVD) Accepted registrant in a graduate $3000. Applications can be picked up transcript of all post-secondary stud- studies program (Masters or PhD) DO YOU KNOW... you can still apply for in the Awards office in Graham Hall or Applications are available from URDC. ies and a complete application form. or professional program at a similar a Government Student Loan on-line at Student Central in Centennial Hall. Phone (780) 497-4374 or email Applications are available by visiting level (medicine, law) in an accredited for the 2006-2007 academic year. Go Deadline: Nov. 10, 2006. [email protected]. Deadline: our website www.sici.org. Deadline: Canadian University, at the time of the to website www.studentaid.gov.mb.ca. Nov. 20, 2006. Jan. 15, 2007. application deadline (Jan. 31). If you have questions, phone the MSAP UNIVERSITY OF WINNIPEG Pursuing a course of studies which office at 204-945-6321 or surf their BURSARY APPLICATIONS: QUEEN ELIZABETH II SILVER SOROPTIMIST WOMEN’S will lead to a career mainly of service website mentioned above. Their office JUBILEE ENDOWMENT FUND FOR OPPORTUNITY AWARDS: is located at 1181 Portage Avenue, 4th Application forms are now avail- to women. STUDY IN A SECOND OFFICIAL floor in the Robert Fletcher building able in the Awards office located in Do you find yourself going back to LANGUAGE AWARD PROGRAM: Intending to spend a minimum of two (Portage and Wall St.). Graham Hall or at Student Central in school later in life? Do you ned finan- years in such a career in Canada. Centennial Hall. Bursaries are small, All disciplines are eligible, except cial assistant to complete your educa- supplementary financial assistance translation. Applications are by nomi- tion? Women’s Opportunity Awards Intending to use the award for awards, normally $300 - $750 in nation by the candidate’s university. are cash awards that assist women in academic studies in the academic year value. In order to be considered, you One nomination per university. Eligi- obtaining the skills and education they following receipt of it. DO YOU KNOW... you can check the must prove financial need and you bility requirements are as follows: need to improve their employment Contributing to your community status of your student aid application, status. Recipients may use the awards must be making satisfactory academic Candidates must be Canadian citi- through volunteer service. find out what documentation is still for any expenses related to their progress (i.e. maintaining a “C” aver- zens or permanent residents and be outstanding, update your address educational pursuits. Needing financial assistance. age). Because funds are limited, not enrolled in the second or third year information and much more on line? everyone who qualifies will receive of their first undergraduate university To be eligible you must meet the fol- Applicants may apply in either English Go to www.studentaid.gov.mb.ca. Link a bursary. Many of our University of program. lowing criteria: or French. Applications are avail- to MySAO to log into your existing Winnipeg bursaries are available to able in the Awards office located in account. our students in any year of their pro- Candidates attending a Quebec insti- be a female head of household (single Graham Hall. For more information gram. Return completed applications tution can be in their first year of a or married, with the primary responsi- contact Heather Menzies, 1204 – One to the Awards office in Graham Hall. first undergraduate program. bility of supporting yourself and your Evergreen Place, Winnipeg MB, R3L Deadline date: Jan. 31, 2007. dependents) The value of the award is $7,000, plus 0E9. Deadline: Jan. 31, 2007. DO YOU KNOW... Manitoba Student travel costs. A minimum of two awards attend an undergraduate degree Aid staff can be on campus on Fri- will be given and non-renewable. For program or a vocational/skills training THE DATATEL SCHOLARS days from 1 – 4 p.m. To meet with a more information, please contact program. FOUNDATION SCHOLARSHIPS: representative, you need to set up an EXTERNAL AWARDS: [email protected]. Deadline at the U of have financial need. appointment time. Come to Student W Awards Office: Nov. 20, 2006. The University of Winnipeg is a new Services to book an appointment or JOURNALISM SCHOLARSHIP FOR Datatel client institution and as such, NATIVE CANADIANS If you have further questions, contact phone Tanis Kolisnyk at 786-9984. Heather Menzies, 1204 - One Evergreen Datatel is offering unique scholarships FRANK KNOX MEMORIAL ranging in value from $1,000 to $2500 The Gil Purcell Memorial Journalism Place, Winnipeg MB, R3L 0E9 or phone FELLOWSHIPS PROGRAM: to students from our institution. Scholarship for Native Canadians is 475-2526. Applications are available now being offered by the Canadian These awards are open to Canadian in the Awards office located in Graham Datatel Scholars Foundation Scholar- Press. Valued at $4000, the purpose is citizens or permanent residents of Hall. Deadline: Dec. 15, 2006 ships – for outstanding students cur- to encourage aboriginal Canadians to Canada who have recently graduated rently attending eligible Datatel client enter the field of journalism through or who are about to graduate from SOROPTIMIST INTERNATIONAL institutions. study at a Canadian post-secondary an institution in Canada, which is OF THE AMERICAS FELLOWSHIP Returning Student scholarships – for institution. In addition to the monetary affiliated to AUCC (the U of Winnipeg AWARD: award, there is a possibility of summer is affiliated toA UCC). The Fellows will outstanding students currently attend- employment. Eligibility requirements be required to devote the major part The Fellowship Award may be awarded ing eligible Datatel client institutions, are as follows: of their time to study in one of the to any women who: who have returned to higher educa- Faculties of Harvard University: Arts tion after an absence of five years or Resides in the Northwest Region Native Canadian (status or non-status and Sciences (including Engineering), more. of Soroptimist International of the Indian, Metis, or Inuit) Business Administration, Design, Americas Nancy Goodhue Lynch scholarships Registered at a Canadian university or Divinity Studies, Education, Law, Public – for outstanding undergraduate stu- community college Administration (John F. Kennedy School Is established in business or one of dents majoring in Information Tech- of Government), Medicine, Dental the professions. nology related curriculum programs at Enrolled in a journalism program Medicine and Public Health. Eligibility Conducts her business or practices eligible Datatel client institutions. or actively involved in a volunteer requirements are as follows: capacity with a student newspaper or her profession Application Process: Open to Canadian citizens or perma- broadcast station. Holds a Bachelor’s or Master’s Degree nent residents of Canada who have The Datatel Scholars Foundation from an accredited college or univer- Open to both French and English graduated no earlier than the spring online scholarship application process sity. speaking native Canadian. of 2005 or will graduate before Sept. is as follows. Applications are available from 2007 from an institution in Canada. Presents a plan of worthwhile post 1. A student attending an eligible schools of journalism, native organiza- Applicants to the Harvard Law School graduate study at an accredited Datatel client institution may apply via tions or from Deborah McCartney, HR, should have graduated no earlier than college or university leading to an the online application form between The Canadian Press, 36 King Street the spring of 2004. advanced degree or to enhanced September 1, 2006 and Jan. 31, 2007. standing or competence in her busi- East, Toronto Ontarion, M5C 2L9. Her Candidates are responsible for gain- (NOTE: applicants must submit their ness or profession. email address is [email protected]. ing admission to Harvard University by completed application with two letters Deadline date: Nov. 15, 2006. the deadline set by the various facul- Provides such other information as of recommendation by Jan. 31, 2007 ties. Candidates should note that the the Fellowship Committee may deem in order to be considered for nomina- UKRAINIAN RESOURCE competition is very keen and that only necessary. tion.) candidates with extraordinary records AND DEVELOPMENT CENTRE Soroptimist members and their im- 2. The scholarship administrator SCHOLARSHIPS: should apply. mediate families are not eligible for from each participating Datatel client Applications are now being accepted The value of the award is $20,000 U.S. any Soroptimist monetary awards institution reviews, evaluates, and for the following awards offered by plus tuition fees and student health available to the public. nominates applicants between Feb. 1, insurance. Up to three awards for 2006 & Feb. 15, 2006. the Ukrainian Resource and Develop- Applications are available in the graduate studies (Master’s and Ph.D.) ment Centre (URDC). Awards office located in Graham Hall. 3. Nominated student applications will be offered. The normal duration The International Initiatives in Deaf are forwarded to the Datatel Scholars is for one academic year however, Deadline: Jan. 15, 2007. Foundation review committee for final Studies Award ($500) to enable students in degree programs may be a post-secondary student (full or evaluation and award determination in eligible for renewal. Please note that the spring. part-time) to pursue his/her interest all applications and supporting docu- in deaf studies and/or hearing impair- For more information go to their web- ment as it relates to an international site or email scholars@datatel. context. contact: [email protected] The Uniter November 2, 2006 sports 21

Sports Editor: Mike Pyl Sports E-mail: [email protected]

“I have noticed it seems to be rather difficult to (The UWSA) is a very big key. Any student activity needs to get U of W students to attend any event on campus,” said be supported by the student association. It legitimizes it, Mission: Impossible? Nosaty. “Many students look at the university as a means and they have access to that side of the campus, as well as to achieve a degree and nothing more.” their advertising tools. Activities created by students, for Examining Wesmen Apathy Exacerbating the urge to flee campus immediately students, I think are more successful than activities cre- after their last class is that fact that most students have ated by ‘those old guys over there’.” part-time jobs that consume a large part of their time out- Mike Pyl rector. “You live and die with your alma mater.” side of school. Coupled with the small student residence Sports Editor Wedlake also credits the American drinking age with population and the aforementioned drinking age which rousing support among students. lures potential Wesmen fans to bars instead, you have a Many students look “Remember, the drinking age is 21 in every state. recipe anathema to school spirit as a whole. Imagine. And so the sport at the university is a much more focal “When I was a student, I always felt (school spirit) at the university as a means The Wesmen trail by one with 30 seconds left. The point of their lives (because there’s nothing else).” was really lacking,” said Foy. “It was kind of discourag- capacity-filledD uckworth Centre crowd is screaming, “Dee- “It’s really hard to compare American audience’s ing because I was involved in different student groups. to achieve a degree and FENCE!” succeeded by two consecutive claps of their hands. relations with their sports teams (to Canada),” said Levi However, I found some solace in the idea that it’s not just The raucous student section in the first five rows is on their Foy, Programming Coordinator for the UWSA responsible this school and it’s not a relatively new thing. We just try to nothing more” feet, clad in matching red Wesmen t-shirts, jumping up and for the organization of the Wesmen Tailgater on Nov. 2. “If work around it and try to build momentum for things like down, screaming expletives, and generally making an oth- you go to Minot (ND), or even a Fighting Sioux game, it’s a (the Wesmen Tailgater).” – Scotty Nosaty erwise average road game a nightmare for the opposing huge thing down there, and it’s always been a part of the That is not to say the only people in attendance at Bison players. The players, feeding off the electric atmo- American pastime. Whereas in Canada, we’ve always stuck games are parents and a few tumbleweeds. Rather than sphere, are a unit inspired, playing aggressive man-to-man to hockey. Outside of that, Canadians in general haven’t fighting the extreme uphill battle of recruiting students, defence right up in the chests of their checks. taken much interest in other sports.” the athletic department significantly adjusted their target What would it take to get you out to a Wesmen The Bison point guard passes the ball into the The entrenchment, or lack thereof, of university audience, choosing to focus on young families, a shift that game? What can be done to stimulate interest? Does post. He hesitates for a second, and begins to back his sports in a given culture is a particularly difficult issue has seen the university lead the Canada West conference anyone even care? Let us know your thoughts by email- man down. But as soon as the ball touches the ground, to address. However, the UWSA Director of Athletics and in attendance for six consecutive seasons. They host many ing [email protected]. Winnipeg point guard Erfan Nasajpour streaks in from the Recreation, Scott Nosaty, feels progress can be made groups such as the Winnipeg Minor Basketball Association weak side and smacks the ball away. simply by spreading the word more effectively. several times a season, charge free admission for children Suddenly, Nasajpour’s breaking down mid-court. The under 12, and offer deals such as the Family Super Pass. crowd is shrieking in anticipation as the clock ticks down. “Our focus, really, is young families,” said Wedlake Five seconds left. He reaches the foul line and looks to pull of the shift that occurred when he became athletic direc- One Idea… up, just as he spots a cutting Dan Shynkaryk slashing to- To many disinterested tor in 2000. “You have to go wherever the success is. If we wards the hoop. He guides a bounce pass just off the hip can make inroads with (students), that’s fine. But an active So, it’s clear if any serious action is to of the Bison defender, as Shynkaryk catches the ball in students, Wesmen sports are campaign, and for us to ignore our market source, that’s happen, the UWSA will have to lead the way. If stride, laying it up off the glass as the clock expires. The not a good thing.” they decide that upping student attendance is in crowd erupts into jubilation as the student section floods only meant for “those tall, ath- One approach both the UWSA and the athletic de- fact a real priority, here’s something they could the court, mobbing the Wesmen who have already begun partment are considering is to recruit students in groups. try. celebrating at half court. letic people that walk around For example, Thursday’s basketball home opener coin- Recruit and train a group of “Wesmen Alas, one can dream. While such scenes are cides with “Res Night”, drawing in those who live in stu- Boosters”, consisting of 20-30 students. common at many NCAA schools like Duke, Michigan State, in sweats and track suits” dent housing. Depending on level of interest (there may be and Gonzaga, campuses across Canada have effectively “(Last Friday) the Kinesiology students had a big ac- enough initial interest without monetary com- tuned out their school’s athletic teams, where, seem- tivity here,” said Wedlake. “Maybe breaking it into smaller pensation), offer to pay them an honorarium of ingly, most of the students who do attend come dressed groups like Kinesiology students, Athletic Therapy stu- sorts – perhaps waive their fees, pay for their as empty bleachers. “I think the biggest thing preventing people from at- dents, History group, breaking it into more manageable textbooks, or offer a small scholarship. Their role The University of Winnipeg is no exception, where tending Wesmen games is just a general lack of knowledge groups (could work). They can come and have some fun, would be twofold: one, over the course of the week the 19 national championship banners of the Duckworth with regards to the Wesmen schedule,” said Nosaty, who some food, some drink, and create a social activity so they leading up to a selected game, their role would be Centre seem so far removed from the rest of campus, the was just elected in the UWSA by-election two weeks ago. “I get to meet themselves in a different forum than class.” to generate as much excitement as possible for Wesmen may as well be playing in Calgary. To many dis- wandered the halls recently, and I noticed ten posters and Currently, the students that do attend games belong the weekend. Talk to classrooms, hand out flyers, interested students, Wesmen sports are only for meant for one banner up concerning the Wesmen game this week- to a niche audience: they are basketball and/or volleyball walk around with megaphones, just make them- “those tall, athletic people that walk around in sweats and end. Nine of these posters and the banner were located fans. But in order to broaden their appeal to the masses selves as visible as possible. And two, during the track suits”. on the second floor of the Duckworth Centre – talk about and increase attendance, Foy said it’s important “for both game itself, they would emulate an NCAA Division One of the foremost reasons our campus has yet to overkill. No offence intended to those who put up the post- sides to use their resources to draw in more students”. I student section – stand throughout the entire catch Wesmen fever is our country’s sporting culture. While ers, but they are not really high-traffic areas. The banner However, Wedlake makes it clear any strong push to mobi- game, scream organized cheers, and basically American college athletics are engrained in the lives of a especially should have been placed along the escalators in lize interest will not come from his side of Spence Street. be as rowdy as possible. The hope would be that team’s fan base – in Texas, you go watch high school foot- Centennial (Hall). I noticed this seems to be the case of all While he’s encourages it, and would certainly help facili- eventually their enthusiasm would be contagious, ball on Fridays, college on Saturdays, and NFL on Sundays the events concerning the Wesmen.” tate it, support would ultimately have to be drummed up and the rest of the crowd would match their inten- – CIS games are reduced as one entertainment option Further plaguing our school’s interest in colle- by the UWSA. sity. Hopefully, you would eventually create more among a plethora of movies, bars, comedy clubs, concerts, giate athletics is our status as a commuter school. This “When we have the support of the student union, it demand to join the “Wesmen Boosters”, and even and art galleries. holds implications extending beyond the Wesmen, as it goes real well,” said Wedlake. “For us to try to do things, more would come to the selected games for the “Your alma mater, in the United States, means some- poses a significant barrier to any student extra-curricular it’s difficult. But for the students themselves to generate exciting atmosphere. thing to you,” said Bill Wedlake, the university’s athletic di- engagement. their own activities, once they’re here, they’ll have fun.

Wesmen Display Dominance in Back to Back Sweeps Saturday night’s game turned out to be an exciting The third set was virtually all Wesmen. Addison- one. It had a ping-pong start as the score was only 8-7 Schneider’s stellar serving had the game at 20-7 at one Jonathan Oliveros Villaverde berth into the CIS championship. at the first timeout. A big block by UBC at 10-10 seemed point. However, UBC’s Christoph Eichbaum answered with Even the players match-up similarly. Winnipeg’s Ben to incite some strong play out of the team and they took great serving of his own to come back to within seven at Schellenberg and UBC’s Andrew Bonner both were named a 13-10 lead. The Thunderbirds maintained that lead until 23-16. Rochon snapped that comeback with a solid kill The University of Winnipeg Wesmen defeated Canada West All-Stars, Dustin Addison-Schneider and his the second timeout as the Wesmen were behind 13-16. and Trevor Shaw’s tip became the winner at 25-18. In the UBC Thunderbirds on Friday and Saturday, with both counter-part Jarred Krause both standout as phenome- When the game was 14-17, Richard Wiebe scored a kill, this match, Wiebe led the team with a very impressive 20 games only going three sets (25-19, 25-21, 25-21 in nal setters, and rookie of the year Ryan DeBruyn and CIS Schellenberg made a huge block, and, after a long point, kills followed by Schellenberg and Rochon with 12 kills of the first game and 31-29, 25-22, 25-18 in the second). rookie team player Kyle Duperron are returning in their Wiebe killed another one to tie it back up at 17-17. The their own. The scores, however, do not do justice to how close the sophomore year. score stayed close as the teams traded set points until Wiebe seemed to be unable to explain his own games really were. It’s nearly impossible to tell the difference between great blocking by the Wesmen had them take the set nor his team’s dominating performance, “I prepared like “Scores were a little misleading,” said head coach the two teams besides their jerseys. Therefore, the only way at 31-29. I do for every other game. I think everyone prepared the Larry McKay. “[The Thunderbirds] are a very good team to differentiate the team was for them to play the season Both teams continued to play strong as the scores same way.” with a very good coach. The players play like their coach. opener against each other at the Duckworth Centre. were 8-7 in favour of UBC at the first timeout and a “I feel good, real good that we can go six sets to They’re a very good team.” In the first game, the first two sets were easily won long point at 13-12 had UBC keep it tied. However, after zero,” continued Wiebe, “Knowing we can play really well Before the matches, the teams were very even on as the Wesmen basically led the entire time, winning 25-19 Wiebe’s sixth kill, Marty Rochon’s seventh, and another when everyone does their part.” paper. The Wesmen are ranked fifth in the ISC Top Ten, and 25-21. In the third set, UBC tried to mount a comeback one by Wiebe had Winnipeg take a 16-13 lead. UBC didn’t “It’s really good to start our season like that,” said with the Thunderbirds ranked sixth. Both teams finished in taking a 16-8 lead. However, the Wesmen came back give up as they managed to get a tie at 19-19. However, Schellenberg, who shortly thereafter forgot about the game 12-8 last season, both teams lost last year in the first round strong winning 17 of the next 22 points to take the deciding Schellenberg’s and Wiebe’s dominant hitting led the team to “focus on Manitoba”, whom they play this weekend at of the play-offs, and both teams have aspirations to get a set 25-21. Schellenberg led the team with 13 kills. to a 25-22 second set victory. Manitoba on Nov. 3rd. November 2, 2006 The Uniter contact: [email protected] Sports Editor: Mike Pyl E-mail: [email protected] Phone: 786-9497 22 Sports Fax: 783-7080

Wesmen Take Their Lumps and Give Them Back Women’s V-Ball splits weekend with Thunderbirds sportsresourcezone.net

Josh Boulding coming within three, but the Wesmen vice errors and other mistakes made held on to take the first set in a deci- by the Thunderbirds to take a one point sive 25-20 win. lead into the second technical that held After gathering up their sea-legs, The second set had the Wesmen through to the end of the game. Again, the Wesmen women’s volleyball team facing a shifted Thunderbirds court Kiesman pulled out a block to put the has set sail into smoother waters after as the opposing team tried a differ- Wesmen ahead of the Thunderbirds splitting the weekend’s games with the ent player lineup to gain an advantage. and to match point, leading to their UBC Thunderbirds. Though the Wesmen were a little slow third win in 25-22 and a sweep over Friday left the Wesmen facing their on correcting their style, they held on to the previous nights victors. first loss of the season against the stay right behind UBC. Dayna Kiesman Flashes of control over the game eighth ranked team coming out of the showed up at the net for a timely block showed, as the Wesmen played hard In light of the bungled raid, Shaq (left) has proven more preseason. Losing 3-1 (25-23, 16-25, that tied the game and left the Wesmen through the entire game against UBC. adept at enforcing on the court than off. 28-26, 25-18) to the Thunderbirds left capable to go up by two and win the However, there were also moments Nicola Dirks as the leading Wesmen second set 25-23. that lacked control. Even after having a with 16 kills in the losing effort. Again, the third set showed a year of CIS experience, left side Marlee Shaq DRO­PS Ball in Child “[The players] weren’t as nervous young team against an older one as Bragg is still making errors on the PO­RNO­GRAPHY Raid [as they were Friday night],” said Diane the Thunderbirds initial attack took court. Although she had 11 kills, she Scott, head coach of the Wesmen. the Wesmen somewhat by surprise. also finished with nine errors with an His on-court performance over Battling through the first three Taking the first six of eight points the attacking percentage of 0.054. the course of his career has been noth- ing but an emphatic slam dunk. games to come out with two close Thunderbirds looked strong. However, “[Bragg] is hitting smarter,” said But his latest foray into law en- losses and a large win, the Wesmen fell the Wesmen found a way to force the Scott. “Most of the time. There’s forcement, however, was little more one final time to the Thunderbirds as side-outs and take back possession more pressure being a second year than a botched lay up. Stephanie Kurz, a fifth year left side fin- to come back to fight to a 7-7 score player…[and Bragg’s] still on a learn- Miami Heat centre and police en- ished with 18 kills to lead her team to before UBC took the fifteenth point to ing curve.” thusiast Shaquille O’Neal took part in a botched child pornography raid last their first win of the regular season. the first technical time-out. It will be an interesting test of month as part of the police unit dubbed Saturday, the Wesmen brought “We gave them some confidence Dirks’ leadership and Bragg’s ability Blue Ridge Thunder while working as a different game plan and a set of at the beginning of the third set,” said as the Wesmen move across town to a reserve deputy in Bedford County, aggressive players, especially in the Scott, as it again took the Wesmen face in number one ranked Manitoba Virginia. first set. a little time to adjust to UBC’s large Bisons tomorrow at the University According to a letter published in the Chatham Star-Tribune, suspect “We came out more prepared,” middle players, leading to three points of Manitoba. A confident, but young A.J. Nuckols and his wife were “held said Scott. “We took more charge of off of blocked strikes or sets too close team, with an overall positive record at at gunpoint, taunted and led into the the first set. We went way ahead…we to the net. the start of the regular season has a house,” and that his home was in- earned that.” “But we still battled back and it lot to look forward to this year in what vaded by a “paramilitary search-and- The Wesmen took an early lead, was a good opportunity for us to adapt will prove to be, if nothing else, an seizure team” that confiscated comput- ers, cameras, DVDs and VHS tapes. His going up to nine points ahead of the to that challenge.” entertaining season of women’s CIS children were also interrogated. Thunderbirds at one point in the first With a little help from the fans, volleyball. It wasn’t until after the raid that set. The Thunderbirds fought back the Wesmen played off of a few ser- police realized the Internet company had provided the incorrect IP address, a common strategy used to seek out online pedophiles. A week later, police returned the family’s belongings, ad- mitting their mistake. Last week, O’Neal denied his in- Can the Big Blue Bring it Home? volvement in the incident, only smil- ing and saying, “It wasn’t me”, despite Bedford County Sheriff’s Lt. Michael Harmony having confirmed his involve- Scott Christiansen their own. Expect them to avoid risky Barrin Simpson, the team’s star line- ment. When pressed further, O’Neal passes to avoid another six turnover backer, never one to throw around light-heartedly joked about “knocking game like last week in Vancouver. You compliments, admits that Toronto down the wrong door”. will see conservative offensive play and Montreal are both “two outstand- O’Neal has made no secret of his It has been another eventful season calling, with quick outs and dumps, ing teams,” insisting that the Bombers desire to become a sheriff upon his re- tirement. He is currently a firearms- for our Winnipeg Blue Bombers. but very few difficult or deep passes have “just stepped up on their level certified reserve police officer in Miami Injuries and inconsistent play have against the stingy Argo secondary. this year”. This is surprisingly good Beach (SI.com, Miami.com). plagued the team the entire year, but The Bombers will rely heavily on Troy news, because the Bombers have fal- they are still where they need to be – Westwood, the team’s placekicker, to tered against weaker competition (i.e. that is, in the hunt for the Grey Cup. convert decent drives into key points Hamilton) because of what some call NHL Fleecing EURO­PE, Says IIHF Study Led by veterans Charles Roberts, Milt in what could be a low scoring game. “Pre-game Underestimations”. They Stegall, Barrin Simpson and Doug should be prepared for stern tests A study published last week by the Brown, the Bombers are set to go up In the past, the Bombers have had against Toronto and Montreal, both of International Ice Hockey Federation last against the rest of the only mediocre chances to do some great things in the whom boast stellar defenses and tal- week criticized the NHL for impeding best in the Canadian Football League’s playoffs, but often seemed to show un- ented offensive weapons. the development of young European players, squashing the notion the best Eastern Conference. With the unpre- inspired play. This year, however, with opportunity for a European to make the dictable play of all three teams in the the Grey Cup in Winnipeg, the team will The core of the Blue Bombers team NHL is to play in North American junior conference, a lot of fans want to know surely have extra incentive to avoid a has been together for a while now, and and minor pro leagues. what to expect from the Blue and Gold letdown. the urgency to succeed is starting to The IIHF says that NHL clubs are come this Sunday’s semi-final, and show. With free agency and potential signing far too many marginal players and robbing them of the opportunity to hopefully beyond. “For the community and for the city, retirements looming, the team realizes improve in European leagues, a pro- having Winnipeg in the Grey Cup would that this season could be their best and cess which ultimately dilutes the qual- The Blue Bombers come into be a great game,” exclaimed Stoddard. last chance. ity of talent on both sides of the ocean. the semi-final running, with the top But star slot back receiver Milt Stegall, The study found of 1,200 European rusher in the Canadian Football League like any wily veteran should, remains “Win or go home,” emphasizes pro and junior players to have left for North American between 1997 and in Charles “Chuck Diesel” Roberts. more cautious. “You have to take the Stegall, motivating the veterans to per- 2006, 20 percent never played in the Roberts will undoubtedly carry a bunch same mindset that you always have form this weekend. “It’s just win or go NHL. Further, 62 percent left little or of the offensive load. week in and week out,” said Stegall. home”. no impact. The IIHF called for a ratio Nonetheless, it’s sure to add a little of 80-20 between North Americans and “In the playoffs,” said slotback extra fuel to what is surely a blazing If Kevin Glenn and Doug Brown are Europeans, an increase from its current Jamie Stoddard, “you really need to fire of playoff intensity for the team. back in the line-up, healthy, and effec- 70-30 state. have your running game going. With tive, the Bombers have a good chance a good running game, it means you’re As a Blue Bombers fan, looking at in the playoffs. If they can overcome the keeping your defence off the field, the Eastern Conference standings and fact that they’re not playing the semi- giving them a much needed rest.” their opponents’ 10-8 records doesn’t final in Winnipeg, their trend of playoff really send shivers up your spine. failures and their subtly stiff competi- (continued on next page) Apart from a focus on the running Based on these numbers, you might tion, there is no reason why they can’t game, the Blue Bombers will have to expect to see some softer competi- win just a few games and bring the Cup key on turnovers, specifically limiting tion, but the Bombers definitely don’t. back to Winnipeg. Sports Editor: Mike Pyl contact: [email protected] The Uniter November 2, 2006 E-mail: [email protected] Phone: 786-9497 Fax: 783-7080 SPORTS 23

THE PANELISTS NFL Picks (continued from previous page) Dustin Addison-Schneider is the starting setter for the Wesmen men’s volleyball team.

Every week hundreds of thousands of fans Thomas Asselin is co-host of the University of Winnipeg’s only sports radio talk show, the spend hours scrutinizing the week’s most piv- Ultra Mega Sports Show, broadcasting every Monday at 4:30 p.m. on CKUW 95.9 FM. The study employed a five-grade otal matchups. They scour websites, watch the Mike Pyl is The Uniter's Sports Editor and founder of the paper’s NFL Picks. player ranking system: 1. minor- sports networks’ tickers at the bottom of the leaguers; 2. marginal NHL players; screen, dial pricey 1-900 numbers, all in search Kalen Qually is a regular contributor to Uniter Sports, and NFL Picks defending champion. 3. average NHL players like Tomas of the particular insight that will guarantee them Holmstrom and Richard Zednik; 4. a big payday. Well, look no further. Dan Verville is a columnist with Red River’s Projector, as well as a regular voice stars like Marian Hossa and Saku Each week we preview five of the league’s on the Call-Ups, which can be heard Wednesdays at 7pm on 92.9 Kick FM. Koivu; 5. superstars like Alexander juiciest matchups of the week. If NFL football is Ovechkin and Jaromir Jagr. your Sunday religion, Uniter Sports will be your Nick Weigeldt is The Uniter’s very own Listings Coordinator. “If the NHL found a way whereby Bible. Our crack team of analysts will show you fewer Europeans of the 1, 2, and 3 cat- the way. egories played in the NHL and fewer (As to which way is anybody’s guess.) still in the minors, then these players could remain as important contribu- tors to their club teams in Europe thus increasing the quality of play in Europe and development the talents of more Game #1: Cincinnati @ Baltimore Game #4: Denver @ Pittsburgh players with NHL potential,” said the “Cincinnati is a team that is reeling at “Denver will be looking to bounce IIHF in the report. “Hence, using fewer the moment; having lost three of the past four back from their 34-31 loss to the Colts on Europeans could be profitable for the (albeit two of those games by only two points Sunday. To do that they’ll need to see an im- NHL.” (WinnipegFreePress.com) each) they don’t look like the team that provement from their defence, which was started the season looking like legitimate scorched for 345 yards and 3 TDs by Peyton WO­MEN’s Basketball challengers in the AFC. And their task in Week Manning, despite an encore performance by ANNO­UNCES 2007 Recruits Nine isn’t going to get any easier as they Mike Bell (15 rushes, 136 yards, 2 tds). They’ll ride into Baltimore to play the divisional be going up against a reeling Pittsburgh The Winnipeg Wesmen wom- rival Ravens. This game will go a long way in team that is trying to find its identity... en’s basketball team, while yet to have determining who finishes first in the division, and see a return of the Ben Roethlisberger played a 2006-07 regular season so look for an intense game by both teams. that managed the team to the Super Bowl. I game, has already announced three But the Ravens with an inspired Steve McNair don’t know if he’ll be back next week. Denver members of next year’s recruiting and Jamal Lewis in the backfield will take a 45 - Pittsburgh 13” – Thomas Asselin class. close one over the Bengals.” – Nick Weigeldt The Score Amy Ogidan of Oak Park High Addison-Schneider says: Denver School, Rosemary Mills of Westwood Addison-Schneider says: Baltimore Asselin says: Denver Collegiate, and Caity Purvis-Collins Asselin says: Baltimore Pyl says: Denver of Churchill High School have com- Women’s Volleyball mitted to the Wesmen. Pyl says: Cincinnati Qually says: Denver (1-1, 1st in Great Plains, no. 10 CIS Coaches’ Poll) “We are extremely pleased that Qually says: Cincinnati Verville says: Denver Amy, Rosemary and Caity commit- Verville says: Baltimore Weigeldt says: Pittsburgh ted early,” said Winnipeg head coach Weigeldt says: Baltimore Friday, October 27 UBC 3 Wesmen 1 Tanya McKay. “The three of them are (25-23, 16-25, 28-26, 25-18) currently training hard to have a great year with their high school teams and Game #5: Indianapolis Saturday, October 28 are working on their skill packages to Wesmen 3 UBC 0 prepare them for university basketball Game #2: Kansas City @ St. Louis @ New England (25-20, 25-23, 25-22) a year from now.” “Despite the fact that both these teams “Notwithstanding some horrendous mo- Ogidan, regarded as one of the are 4-3 heading into this one, I can’t see St. ments from this past season, there is no one Men’s Volleyball better high school players in the coun- Louis putting up much of fight.A lthough both more dangerous in a “top of the 3rd, four-run (2-0, 1st in Great Plains, no. 5 try, headlines the group. Having aver- Huard and Bulger had big games in Week 8, lead” situation than Alex Rodriguez. When the CIS Coaches’ Poll) aged 22 points, 10 rebounds, and five expect the ground assault to be the difference stakes are at their lowest, A-Rod is the best steals a game in her grade 11 season in this one. And with Larry Johnson’s pa- player in baseball. Likewise, the Indianapolis Friday, October 27 with the Raiders, she is prominently Wesmen 3 UBC 0 placed on the national team radar. tient running style, expect him to find a lot of Colts. Indy has not been the powerhouse they (25-19, 25-21, 25-21) holes in the St. Louis’ defenisve line and rack were last year, but they have thrived in finding “Amy is an extremely talented basketball player, one who possesses up some serious yardage en route to an easy ways to win. Which brings us to this week’s Saturday, October 28 Chiefs victory.” – Dan Verville matchup with the rival Patriots. Over the last Wesmen 3 UBC 0 the ability to impact all aspects of the five years, New England has owned them (31-29, 25-22, 25-18) game,” said Murray Brown, Oak Park’s head coach. “Not only is she physi- Addison-Schneider says: Kansas City when it counted most. But this is only Week cally gifted, but she also understands Asselin says: Kansas City 9, and nobody dominates quite like Peyton Men’s Basketball the game well. She presents match- Pyl says: St. Louis Manning in an irrelevant, midseason game.” (Preseason) up problems for most teams as she Qually says: St. Louis – Mike Pyl has great perimeter skills, including Verville says: Kansas City UNIVERSITY OF MANITOBA INVITATIONAL the ability to shoot from beyond the Weigeldt says: St. Louis Addison-Schneider says: Indianapolis three point line while at the same time Asselin says: Indianapolis Friday, October 27 being a dominate interior player.” Pyl says: Indianapolis Wesmen 63 Mary University 57 Mills, a 5-foot-10 guard, aver- Qually says: New England aged 29 points and seven rebounds Verville says: Indianapolis Saturday, October 28 last season for the Warriors, while also Game #3: New Orleans @ Tampa Bay Western Ontario 87 Wesmen 73 “After being dealt a serious blow by the Weigeldt says: New England a member of the Jr. Wesmen develop- ment program. Purvis-Collins, who Baltimore Ravens last week, losing both Reggie Women’s Basketball (Preseason) played for the Manitoba provincial Bush and their second game of the season, I team this past summer, is expected to expect N’Orleans to exact some revenge on Saturday, October 28 bring a sweet shooting stroke to the the battered Buccaneers. Even against the for- Mary University 81 Wesmen 70 team (Wesmen.ca). midable arm of Brad Gradkowski. And by for- midable, I meant vulnerable. Even though the Sunday, October 29 Buccanneers inexplicably beat the Eagles sev- Mary University 79 Wesmen 65 eral weeks ago I don’t find them intimidat- ing or, for lack of a better term, any good. But what do I know, I am terrible at this NFL Picks thing.” – Kalen Qually Addison-Schneider says: Tampa Bay COMING UP Asselin says: New Orleans Pyl says: New Orleans MEN’S VOLLEYBALL Qually says: New Orleans Away @ Manitoba Bisons (no. 3) – Nov. 3 (8:00) WOMEN’S VOLLEYBALL Verville says: New Orleans Away @ Manitoba Bisons (no. 1) – Nov. 3 (6:00) Weigeldt says: New Orleans MEN’S BASKETBALL Home vs. Manitoba Bisons – Nov. 2 (8:00) Away @ Manitoba Bisons – Nov. 4 (8:00) WOMEN’S BASKETBALL Home vs. Manitoba Bisons – Nov. 2 (6:15) Away @ Manitoba Bisons – Nov. 4 (6:15) November 2, 2006 The Uniter contact: [email protected] 24

Crossword puzzles provided by www.BestCrosswords.com. Used with permission.

Across 41- Obtain, slangily Down 32- Desires 1- African acacia tree 42- Natural blue dye 1- Of the highest quality 33- They’ve got something coming 6- Float through the air 44- Devour 2- Spring up 35- Slander 10- Turkish governor 45- Juridical 3- Trite 37- Mission control gp. 13- Muse of lyric poetry 47- Ridge 4- Pertaining to the uterus 39- Male sheep who may play football 14- Competent 49- Average 5- Base for St Louis! 15- Wise 51- Valuate 6- North American elk 40- Close 16- Tendon 53- Second-largest continent 7- In the sack 43- Vassals 17- Rind 56- Spectral 8- Ran away 46- Glitter 18- Career golfers 59- Eldest son of Noah 9- Tending to a definite end 48- Powdery residue 19- Nicholas II was the 61- Dissolve, as cells 10- Ingot 50- 4th letter of the Hebrew alphabet last Russian one 64- River in central Switzerland 11- Feeling of self-importance 52- Lathers 20- Language of European Jews 65- Gaze intently 12- Affirmative answer 54- Amulet 22- Evoke 66- Long fish 15- Round body 55- Nest of a bird of prey 24- Equally old 67- Scheme 20- Exclamation to express joy 57- Ad word 28- Inventor of logarithms 68- Jeopardy 21- Drunkard 58- Horse’s gait 31- Valuable collection 69- Some 23- Horseshoe 60- Blend 32- Young of the dog 70- Third son of Adam 25- Longest river in Europe 61- Pasture used for grazing 34- Monetary unit of Bulgaria 71- Equipped 26- Benefit 62- Monetary unit of Japan 36- Enthusiastic vigor and liveliness 27- Pre-Easter season 63- Wily 37- Not for a Scot 29- Overjoy 65- Mineral spring 38- Insoluble protein 30- Not emp. LAST PUZZLE'S SOLUTIONS