OriGene Technologies, Inc. OriGene Technologies GmbH
9620 Medical Center Drive, Ste 200 Schillerstr. 5 Rockville, MD 20850 32052 Herford UNITED STATES GERMANY Phone: +1-888-267-4436 Phone: +49-5221-34606-0 Fax: +1-301-340-8606 Fax: +49-5221-34606-11 [email protected] [email protected]
AP46008PU-N Polyclonal Antibody to RAG1 / RNF74 (C-term) - Aff - Purified
Alternate names: RAG-1, RING finger protein 74, V(D)J recombination-activating protein 1 Quantity: 50 µg Background: As a catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities. Uniprot ID: P15919 NCBI: NM_009019 GeneID: 19373 Host: Rabbit Immunogen: Synthetic peptide corresponding to a near C-terminal region of mouse AA Sequence: IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT
Format: State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Purification: Immunoaffinity column Applications: Western blotting (0.2 - 1 µg/ml). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user. Molecular Weight: RAG1: 119 kDa Species Reactivity: Tested: Human, mouse. Storage: Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch. General Readings: "The V(D)J recombination activating gene, RAG-1." Schatz D.G., Oettinger M.A., Baltimore D. Cell 59:1035-1048(1989) [PubMed: 2598259] [Abstract]
For research and in vitro use only. Not for diagnostic or therapeutic work. Material Safety Datasheets are available at www.acris-antibodies.com or on request. MP/20190124 1 / 2 AP46008PU-N: Polyclonal Antibody to RAG1 / RNF74 (C-term) - Aff - Purified
Pictures: Mouse Liver; WB Suggested Anti-Rag1 Antibody. . Titration: 1.0 ug/ml. . Positive Control: Mouse Liver; Rag1 antibody - C- terminal region (AP46008PU-N) in Mouse Liver cells using Western Blot
For research and in vitro use only. Not for diagnostic or therapeutic work. Material Safety Datasheets are available at www.acris-antibodies.com or on request. MP/20190124 2 / 2
Powered by TCPDF (www.tcpdf.org)