DOCSLIB.ORG

The Genetic Basis of Hemifacial Microsomia

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Genetic Basis of Hemifacial Microsomia THE GENETIC BASIS OF HEMIFACIAL MICROSOMIA Jerome Christopher Siong Teck Lim The Institute of Child Health, University College London Submitted to the University of London for the degree of Doctor of Medicine UMI Number: U592B06 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted. In the unlikely event that the author did not send a complete manuscript and there are missing pages, these will be noted. Also, if material had to be removed, a note will indicate the deletion. Dissertation Publishing UMI U592B06 Published by ProQuest LLC 2013. Copyright in the Dissertation held by the Author. Microform Edition © ProQuest LLC. All rights reserved. This work is protected against unauthorized copying under Title 17, United States Code. ProQuest LLC 789 East Eisenhower Parkway P.O. Box 1346 Ann Arbor, Ml 48106-1346 Abstract The aetiology of hemifacial microsomia is uncertain; vascular, metabolic, teratogenic and genetic factors have been proposed as aetiological influences. The evidence for a genetic basis comes from observations of the phenotype in individuals carrying chromosomal rearrangements, and from a small number of studies involving families in whom the condition appeared to be transmitted in a Mendelian fashion. Malformations reminiscent of hemifacial microsomia have also been seen in knockout and mutant animal models, and these have given rise to a number of candidate genes for the disease. Two main objectives were defined at the start of this project. The first of these was to expand upon the currently available clinical data by interviewing and examining patients with hemifacial microsomia or isolated microtia who presented to two specialist treatment centres in London, Great Ormond Street Hospital and Mount Vernon Hospital. Alongside this a genome scan was performed on a family in which hemifacial microsomia appeared to be segregating in an autosomal dominant manner. Whilst definite linkage to a single locus could not be inferred from the results of the genome scan, a few regions of interest were identified, and linkage to a large proportion of the genome was excluded. One area of particular interest, 2q32 - 2q37, was analysed in greater detail, and other regions together with their potential disease genes have been highlighted. 2 Table of contents Page Abstract 2 Table of contents 3-6 Figures and tables 7-13 Acknowledgements 14 Introduction 15-16 1.1. Incidence & Epidemiology 17-18 1.2. Clinical features 19 1.2.1. Facial abnormalities 19-20 1.2.2. Ear abnormalities 20-22 1.2.3. Central nervous system abnormalities 22 1.2.4. Eye abnormalities 23 1.2.5. Skeletal abnormalities 23-24 1.2.6. Other abnormalities 24-25 1.3. Nomenclature 26 1.4. Embryology 27-31 1.5. Aetiology 32 1.5.1. Vascular 32-33 1.5.2. Metabolic 33-34 1.5.3. Teratogenic 34-35 1.5.4. Multiple gestations 36-37 1.5.5. Bleeding in pregnancy 37-38 1.5.6. Other aetiological theories 39 3 Page 1.6. Genetic aspects 1.6.1. Mendelian and non-Mendelian inheritance 40-41 1.6.2. Mode of inheritance of hemifacial microsomia 41-43 1.6.3. Investigation of human disease genes 44 1.6.4. Chromosomal rearrangements 44-45 1.6.5. Genetic mapping 46-48 1.6.6. Recombination fractions 48-49 1.6.7. Linkage 49-51 1.6.8. Genetic mapping in hemifacial microsomia in humans 51-52 1.6.9. Investigation of the genetic basis of complex diseases 53-58 1.6.10. Animal models 59-66 Aims of project 67-68 2. Materials and methods 69 2.1. Method of patient data collection 70-71 2.2. Materials 72-75 2.3. Methods of genome scan 2.3.1. Clinical details of patients studied in genome scan 76-78 2.3.2. Polymerase chain reaction 78 2.3.3. Gel electrophoresis 79 2.3.4. Capillary array electrophoresis 79-80 2.3.5. Data analysis 80 4 Page Results of patient data collection 81-82 3.1. Age and sex distribution 83-86 3.2. Laterality 87 3.3. Grade of microtia 88 3.4. Skin tags 89-90 3.5. Abnormalities of the external auditory meatus 91-94 3.6. Facial nerve palsy 95 3.7. Cleft lip and palate 95 3.8. Affected relatives 96-100 3.9. Bleeding in pregnancy 101-102 3.10. Incidence of twinning 102 Discussion of patient data collection 103-104 4.1. Age and sex distribution 105-106 4.2. Laterality 107-110 4.3. Grade of microtia 110-111 4.4. Skin tags 111-112 4.5. Abnormalities of the external auditory meatus 112-113 4.6. Facial nerve palsy 113-114 4.7. Cleft lip and palate 115 4.8. Affected relatives 116-117 4.9. Bleeding in pregnancy 118-119 4.10 Incidence of twinning 119-120 5 Page Results of genome scan 121 5.1. Analysis of candidate loci 122 5.2. Genome search 123 5.2.1. Two point linkage analysis 123-160 5.2.2. Two point lod scores of interest 161-184 5.2.3. Genome-wide multipoint linkage analysis 185-210 5.2.4. Multipoint regions of interest 210-221 Discussion of genome scan 222-224 6.1. Genotyping difficulties 224-225 6.2. Potential sources of error 226-230 6.3. Change of affection status of individual V:7 231-233 6.4. Regions of interest excluded by the results of genome scan 234-237 6.5. Lod scores relative to candidate genes suggested by animal 238-240 models 6.6. Regions of interest warranting further investigation 241-249 6.7. Future work 250-251 Reference list 252-273 Appendix A Patient information and consent forms 274-279 Appendix B Patient data collection form 280-282 6 Figures and Tables Page Figure 1 Schematic drawing of the pharyngeal arches 27 Figure 2 Lateral view of the head of an embryo showing the six 28 auricular hillocks Figure 3 Schematic representation of the development of the middle 29 ear structures Figure 4 Schematic representation of the derivatives of the first three 31 branchial arches Figure 5 Pedigree of family R exhibiting autosomal dominant 77 hemifacial microsomia Figure 6 Year of birth distribution of microtia patients 84 Figure 7 Year of birth distribution of hemifacial microsomia patients 85 Figure 8 The pedigree for the family with hemifacial microsomia 97 affecting three generations. Figure 9 The haplotypes for the markers from the Research Genetics 162 Marker Set version 8 analysed in the region 5q34-5q35 Figure 10 The haplotypes for other markers from the Research Genetics 164 Marker Set version 8 analysed in the region 5q34-5q35 Figure 11 The haplotypes for the markers from the Research Genetics 166 Marker Set version 8 analysed in the region 3q25 Figure 12 The haplotypes for the markers from the Research Genetics 168 Marker Set version 8 analysed in the region 5pl4 7 Page Figure 13 The haplotypes for the markers from the Research Genetics 170 Marker Set version 8 analysed in the region 1 lq25 Figure 14 The haplotypes for the markers from the Research Genetics 172 Marker Set version 8 analysed in the region 13q34 Figure 15 The haplotypes for the markers from the Research Genetics 174 Marker Set version 8 analysed in the region 2q32-2q37 Figure 16 The haplotypes for the markers from the Research Genetics 176 Marker Set version 8 analysed in the region 8q24 Figure 17 The haplotypes for the markers from the Research Genetics 178 Marker Set version 8 analysed in the region 16pl 2 Figure 18 The haplotypes for the markers from the Research Genetics 180 Marker Set version 8 analysed in the region 3p25 Figure 19 The haplotypes for the markers from the Research Genetics 182 Marker Set version 8 analysed in the region 8q22 Figure 20 The haplotypes for the markers from the Research Genetics 184 Marker Set version 8 analysed in the region 10q22 Figure 21 Chromosome 1 multipoint lod score results 187 Figure 22 Chromosome 2 multipoint lod score results 188 Figure 23 Multipoint lod scores for the Research Genetics markers used 189 in the telomeric region of 2q 8 Page Chromosome 3 multipoint lod score results 190 Chromosome 4 multipoint lod score results 191 Chromosome 5 multipoint lod score results 192 Chromosome 6 multipoint lod score results 193 Chromosome 7 multipoint lod score results 194 Chromosome 8 multipoint lod score results 195 Chromosome 9 multipoint lod score results 196 Chromosome 10 multipoint od score results 197 Chromosome 11 multipoint od score results 198 Chromosome 12 multipoint od score results 199 Chromosome 13 multipoint od score results 200 Chromosome 14 multipoint od score results 201 Chromosome 15 multipoint od score results 202 Chromosome 16 multipoint od score results 203 Chromosome 17 multipoint od score results 204 Chromosome 18 multipoint od score results 205 Chromosome 19 multipoint od score results 206 Chromosome 20 multipoint od score results 207 Chromosome 21 multipoint od score results 208 Chromosome 22 multipoint od score results 209 Page Figure 44 Schematic illustration of map locations of microsatellite 211 markers for 2q32 - 2q37 Figure 45 The haplotypes for the additional markers analysed in the 213 region 2q32 - 2q37 in addition to those from the Research Genetics Marker Set version 8 Figure 46 Plot of the multipoint scores for the additional markers analysed 214 in the region 2q32 - 2q37 Figure 47 The haplotypes for the markers from the Research Genetics 216 Marker Set version 8 analysed in the region 8p21 Figure 48 The haplotypes for the markers from the Research Genetics 218 Marker Set version 8 analysed in the region 14q23 Figure 49 The haplotypes for the markers from the Research Genetics 220 Marker Set version 8 analysed in the region 15ql 1 — 15ql2 Figure 50 Output from Genetic Profiler analysis of data showing multiple 227 “stutter” peaks Figure 51 Output from Genetic Profiler demonstrating spectral overlap 228 Figure 52 The relative positions of markers
Load more

Recommended publications
  • Seq2pathway Vignette
    seq2pathway Vignette Bin Wang, Xinan Holly Yang, Arjun Kinstlick May 19, 2021 Contents 1 Abstract 1 2 Package Installation 2 3 runseq2pathway 2 4 Two main functions 3 4.1 seq2gene . .3 4.1.1 seq2gene flowchart . .3 4.1.2 runseq2gene inputs/parameters . .5 4.1.3 runseq2gene outputs . .8 4.2 gene2pathway . 10 4.2.1 gene2pathway flowchart . 11 4.2.2 gene2pathway test inputs/parameters . 11 4.2.3 gene2pathway test outputs . 12 5 Examples 13 5.1 ChIP-seq data analysis . 13 5.1.1 Map ChIP-seq enriched peaks to genes using runseq2gene .................... 13 5.1.2 Discover enriched GO terms using gene2pathway_test with gene scores . 15 5.1.3 Discover enriched GO terms using Fisher's Exact test without gene scores . 17 5.1.4 Add description for genes . 20 5.2 RNA-seq data analysis . 20 6 R environment session 23 1 Abstract Seq2pathway is a novel computational tool to analyze functional gene-sets (including signaling pathways) using variable next-generation sequencing data[1]. Integral to this tool are the \seq2gene" and \gene2pathway" components in series that infer a quantitative pathway-level profile for each sample. The seq2gene function assigns phenotype-associated significance of genomic regions to gene-level scores, where the significance could be p-values of SNPs or point mutations, protein-binding affinity, or transcriptional expression level. The seq2gene function has the feasibility to assign non-exon regions to a range of neighboring genes besides the nearest one, thus facilitating the study of functional non-coding elements[2]. Then the gene2pathway summarizes gene-level measurements to pathway-level scores, comparing the quantity of significance for gene members within a pathway with those outside a pathway.
    [Show full text]
  • Autism Multiplex Family with 16P11.2P12.2 Microduplication Syndrome in Monozygotic Twins and Distal 16P11.2 Deletion in Their Brother
    European Journal of Human Genetics (2012) 20, 540–546 & 2012 Macmillan Publishers Limited All rights reserved 1018-4813/12 www.nature.com/ejhg ARTICLE Autism multiplex family with 16p11.2p12.2 microduplication syndrome in monozygotic twins and distal 16p11.2 deletion in their brother Anne-Claude Tabet1,2,3,4, Marion Pilorge2,3,4, Richard Delorme5,6,Fre´de´rique Amsellem5,6, Jean-Marc Pinard7, Marion Leboyer6,8,9, Alain Verloes10, Brigitte Benzacken1,11,12 and Catalina Betancur*,2,3,4 The pericentromeric region of chromosome 16p is rich in segmental duplications that predispose to rearrangements through non-allelic homologous recombination. Several recurrent copy number variations have been described recently in chromosome 16p. 16p11.2 rearrangements (29.5–30.1 Mb) are associated with autism, intellectual disability (ID) and other neurodevelopmental disorders. Another recognizable but less common microdeletion syndrome in 16p11.2p12.2 (21.4 to 28.5–30.1 Mb) has been described in six individuals with ID, whereas apparently reciprocal duplications, studied by standard cytogenetic and fluorescence in situ hybridization techniques, have been reported in three patients with autism spectrum disorders. Here, we report a multiplex family with three boys affected with autism, including two monozygotic twins carrying a de novo 16p11.2p12.2 duplication of 8.95 Mb (21.28–30.23 Mb) characterized by single-nucleotide polymorphism array, encompassing both the 16p11.2 and 16p11.2p12.2 regions. The twins exhibited autism, severe ID, and dysmorphic features, including a triangular face, deep-set eyes, large and prominent nasal bridge, and tall, slender build. The eldest brother presented with autism, mild ID, early-onset obesity and normal craniofacial features, and carried a smaller, overlapping 16p11.2 microdeletion of 847 kb (28.40–29.25 Mb), inherited from his apparently healthy father.
    [Show full text]
  • Linkage Analysis in 15 Families, Physical And
    European Journal of Human Genetics (2002) 11, 145 – 154 ª 2002 Nature Publishing Group All rights reserved 1018 – 4813/02 $25.00 www.nature.com/ejhg ARTICLE Familial juvenile hyperuricaemic nephropathy (FJHN): linkage analysis in 15 families, physical and transcriptional characterisation of the FJHN critical region on chromosome 16p11.2 and the analysis of seven candidate genes Blanka Stibu˚ rkova´1, Jacek Majewski2, Katerˇina Hodanˇova´1, Lenka Ondrova´1, Marke´ta Jerˇa´bkova´1, Marie Zika´nova´1, Petr Vylet’al1, Ivan Sˇebesta3, Anthony Marinaki4, Anne Simmonds4, Gert Matthijs5, Jean-Pierre Fryns5, Rosa Torres6, Juan Garcı´a Puig7, Jurg Ott2 and Stanislav Kmoch*,1 1Center for Integrated Genomics, Institute for Inherited Metabolic Disorders, Charles University 1st School of Medicine and General Faculty Hospital Prague, Czech Republic; 2Laboratory of Statistical Genetics, Rockefeller University, New York, NY, USA; 3Department of Clinical Biochemistry, Charles University 1st School of Medicine and General Faculty Hospital Prague, Czech Republic; 4Purine Research Unit, GKT, Guy’s Hospital, London, UK; 5Center for Human Genetics, University of Leuven, Leuven, Belgium; 6Department of Clinical Biochemistry, La Paz Hospital, Madrid, Spain; 7Division of Internal Medicine, La Paz Hospital, Madrid, Spain Familial juvenile hyperuricaemic nephropathy (FJHN) is an autosomal dominant renal disease characterised by juvenile onset of hyperuricaemia, gouty arthritis, and progressive renal failure at an early age. Recent studies in four kindreds showed linkage of a gene for FJHN to the same genomic interval on chromosome 16p11.2, where the gene for the phenotypically similar medullary cystic disease type 2 (MCKD2) has been localised. In this study we performed linkage analysis in additional 15 FJHN families.
    [Show full text]
  • Congenital Disorders of Glycosylation from a Neurological Perspective
    brain sciences Review Congenital Disorders of Glycosylation from a Neurological Perspective Justyna Paprocka 1,* , Aleksandra Jezela-Stanek 2 , Anna Tylki-Szyma´nska 3 and Stephanie Grunewald 4 1 Department of Pediatric Neurology, Faculty of Medical Science in Katowice, Medical University of Silesia, 40-752 Katowice, Poland 2 Department of Genetics and Clinical Immunology, National Institute of Tuberculosis and Lung Diseases, 01-138 Warsaw, Poland; [email protected] 3 Department of Pediatrics, Nutrition and Metabolic Diseases, The Children’s Memorial Health Institute, W 04-730 Warsaw, Poland; [email protected] 4 NIHR Biomedical Research Center (BRC), Metabolic Unit, Great Ormond Street Hospital and Institute of Child Health, University College London, London SE1 9RT, UK; [email protected] * Correspondence: [email protected]; Tel.: +48-606-415-888 Abstract: Most plasma proteins, cell membrane proteins and other proteins are glycoproteins with sugar chains attached to the polypeptide-glycans. Glycosylation is the main element of the post- translational transformation of most human proteins. Since glycosylation processes are necessary for many different biological processes, patients present a diverse spectrum of phenotypes and severity of symptoms. The most frequently observed neurological symptoms in congenital disorders of glycosylation (CDG) are: epilepsy, intellectual disability, myopathies, neuropathies and stroke-like episodes. Epilepsy is seen in many CDG subtypes and particularly present in the case of mutations
    [Show full text]
  • Prevalence and Incidence of Rare Diseases: Bibliographic Data
    Number 1 | January 2019 Prevalence and incidence of rare diseases: Bibliographic data Prevalence, incidence or number of published cases listed by diseases (in alphabetical order) www.orpha.net www.orphadata.org If a range of national data is available, the average is Methodology calculated to estimate the worldwide or European prevalence or incidence. When a range of data sources is available, the most Orphanet carries out a systematic survey of literature in recent data source that meets a certain number of quality order to estimate the prevalence and incidence of rare criteria is favoured (registries, meta-analyses, diseases. This study aims to collect new data regarding population-based studies, large cohorts studies). point prevalence, birth prevalence and incidence, and to update already published data according to new For congenital diseases, the prevalence is estimated, so scientific studies or other available data. that: Prevalence = birth prevalence x (patient life This data is presented in the following reports published expectancy/general population life expectancy). biannually: When only incidence data is documented, the prevalence is estimated when possible, so that : • Prevalence, incidence or number of published cases listed by diseases (in alphabetical order); Prevalence = incidence x disease mean duration. • Diseases listed by decreasing prevalence, incidence When neither prevalence nor incidence data is available, or number of published cases; which is the case for very rare diseases, the number of cases or families documented in the medical literature is Data collection provided. A number of different sources are used : Limitations of the study • Registries (RARECARE, EUROCAT, etc) ; The prevalence and incidence data presented in this report are only estimations and cannot be considered to • National/international health institutes and agencies be absolutely correct.
    [Show full text]
  • MECHANISMS in ENDOCRINOLOGY: Novel Genetic Causes of Short Stature
    J M Wit and others Genetics of short stature 174:4 R145–R173 Review MECHANISMS IN ENDOCRINOLOGY Novel genetic causes of short stature 1 1 2 2 Jan M Wit , Wilma Oostdijk , Monique Losekoot , Hermine A van Duyvenvoorde , Correspondence Claudia A L Ruivenkamp2 and Sarina G Kant2 should be addressed to J M Wit Departments of 1Paediatrics and 2Clinical Genetics, Leiden University Medical Center, PO Box 9600, 2300 RC Leiden, Email The Netherlands [email protected] Abstract The fast technological development, particularly single nucleotide polymorphism array, array-comparative genomic hybridization, and whole exome sequencing, has led to the discovery of many novel genetic causes of growth failure. In this review we discuss a selection of these, according to a diagnostic classification centred on the epiphyseal growth plate. We successively discuss disorders in hormone signalling, paracrine factors, matrix molecules, intracellular pathways, and fundamental cellular processes, followed by chromosomal aberrations including copy number variants (CNVs) and imprinting disorders associated with short stature. Many novel causes of GH deficiency (GHD) as part of combined pituitary hormone deficiency have been uncovered. The most frequent genetic causes of isolated GHD are GH1 and GHRHR defects, but several novel causes have recently been found, such as GHSR, RNPC3, and IFT172 mutations. Besides well-defined causes of GH insensitivity (GHR, STAT5B, IGFALS, IGF1 defects), disorders of NFkB signalling, STAT3 and IGF2 have recently been discovered. Heterozygous IGF1R defects are a relatively frequent cause of prenatal and postnatal growth retardation. TRHA mutations cause a syndromic form of short stature with elevated T3/T4 ratio. Disorders of signalling of various paracrine factors (FGFs, BMPs, WNTs, PTHrP/IHH, and CNP/NPR2) or genetic defects affecting cartilage extracellular matrix usually cause disproportionate short stature.
    [Show full text]
  • Psykisk Utviklingshemming Og Forsinket Utvikling
    Psykisk utviklingshemming og forsinket utvikling Genpanel, versjon v03 Tabellen er sortert på gennavn (HGNC gensymbol) Navn på gen er iht. HGNC >x10 Andel av genet som har blitt lest med tilfredstillende kvalitet flere enn 10 ganger under sekvensering x10 er forventet dekning; faktisk dekning vil variere. Gen Gen (HGNC Transkript >10x Fenotype (symbol) ID) AAAS 13666 NM_015665.5 100% Achalasia-addisonianism-alacrimia syndrome OMIM AARS 20 NM_001605.2 100% Charcot-Marie-Tooth disease, axonal, type 2N OMIM Epileptic encephalopathy, early infantile, 29 OMIM AASS 17366 NM_005763.3 100% Hyperlysinemia OMIM Saccharopinuria OMIM ABCB11 42 NM_003742.2 100% Cholestasis, benign recurrent intrahepatic, 2 OMIM Cholestasis, progressive familial intrahepatic 2 OMIM ABCB7 48 NM_004299.5 100% Anemia, sideroblastic, with ataxia OMIM ABCC6 57 NM_001171.5 93% Arterial calcification, generalized, of infancy, 2 OMIM Pseudoxanthoma elasticum OMIM Pseudoxanthoma elasticum, forme fruste OMIM ABCC9 60 NM_005691.3 100% Hypertrichotic osteochondrodysplasia OMIM ABCD1 61 NM_000033.3 77% Adrenoleukodystrophy OMIM Adrenomyeloneuropathy, adult OMIM ABCD4 68 NM_005050.3 100% Methylmalonic aciduria and homocystinuria, cblJ type OMIM ABHD5 21396 NM_016006.4 100% Chanarin-Dorfman syndrome OMIM ACAD9 21497 NM_014049.4 99% Mitochondrial complex I deficiency due to ACAD9 deficiency OMIM ACADM 89 NM_000016.5 100% Acyl-CoA dehydrogenase, medium chain, deficiency of OMIM ACADS 90 NM_000017.3 100% Acyl-CoA dehydrogenase, short-chain, deficiency of OMIM ACADVL 92 NM_000018.3 100% VLCAD
    [Show full text]
  • Targeted Polymerase Chain Reaction-Based Enrichment and Next Generation Sequencing for Diagnostic Testing of Congenital Disorders of Glycosylation Melanie A
    ARTICLE Targeted polymerase chain reaction-based enrichment and next generation sequencing for diagnostic testing of congenital disorders of glycosylation Melanie A. Jones, PhD1, Shruti Bhide, MS1, Ephrem Chin, MB(ASCP), QLC1, Bobby G. Ng, BS2, Devin Rhodenizer, BS1, Victor W. Zhang, MD, PhD1, Jessica J. Sun, MS1, Alice Tanner, PhD, MS1, Hudson H. Freeze, PhD2, and Madhuri R. Hegde, PhD, FACMG1 2 Purpose: Congenital disorders of glycosylation are a heterogeneous stability and in the immune response ; hence, the proper devel- group of disorders caused by deficient glycosylation, primarily affecting opment and functioning of many organ systems depend on the N-linked pathway. It is estimated that more than 40% of congenital normal N-glycosylation. Deficient N-glycosylation results in 3 disorders of glycosylation patients lack a confirmatory molecular multiple organ dysfunction that can be life threatening. Con- diagnosis. The purpose of this study was to improve molecular genital disorders of glycosylation (CDG) are a group of more diagnosis for congenital disorders of glycosylation by developing than 30 autosomal recessive disorders caused by deficient gly- 4 and validating a next generation sequencing panel for comprehensive cosylation, primarily affecting the N-linked pathway. Symp- mutation detection in 24 genes known to cause congenital disorders toms of CDG can include severe developmental delay, ataxia, of glycosylation. Methods: Next generation sequencing validation seizures, liver fibrosis, retinopathy, cardiac dysfunction, and 3,5 was performed on 12 positive control congenital disorders of gly- coagulopathies. CDG occurs worldwide, with an estimated 6 cosylation patients. These samples were blinded as to the disease- prevalence as high as 1 in 20,000.
    [Show full text]
  • ARP55242 P050) Data Sheet
    COG4 antibody - middle region (ARP55242_P050) Data Sheet Product Number ARP55242_P050 Product Name COG4 antibody - middle region (ARP55242_P050) Size 50ug Gene Symbol COG4 Alias Symbols COD1; DKFZp586E1519; CDG2J Nucleotide Accession# NM_015386 Protein Size (# AA) 789 amino acids Molecular Weight 89kDa Subunit 4 Product Format Lyophilized powder NCBI Gene Id 25839 Host Rabbit Clonality Polyclonal Official Gene Full Name Component of oligomeric golgi complex 4 Gene Family COG This is a rabbit polyclonal antibody against COG4. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ Target Reference Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718 Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.Multiprotein complexes are key determinants of Golgi Description of Target apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport.
    [Show full text]
  • Cog5–Cog7 Crystal Structure Reveals Interactions Essential for the Function of a Multisubunit Tethering Complex
    Cog5–Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex Jun Yong Haa, Irina D. Pokrovskayab, Leslie K. Climerb, Gregory R. Shimamuraa, Tetyana Kudlykb, Philip D. Jeffreya, Vladimir V. Lupashinb,c, and Frederick M. Hughsona,1 aDepartment of Molecular Biology, Princeton University, Princeton, NJ 08544; bDepartment of Physiology and Biophysics, University of Arkansas for Medical Sciences, Little Rock, AR 72205; and cBiological Institute, Tomsk State University, Tomsk, 634050, Russian Federation Edited by Thomas C. Südhof, Stanford University School of Medicine, Stanford, CA, and approved September 30, 2014 (received for review August 4, 2014) The conserved oligomeric Golgi (COG) complex is required, along have been structurally characterized to date (11, 14). Defining the with SNARE and Sec1/Munc18 (SM) proteins, for vesicle docking quaternary structure of the other CATCHR-family MTCs remains and fusion at the Golgi. COG, like other multisubunit tethering a major challenge. complexes (MTCs), is thought to function as a scaffold and/or The COG complex is an MTC that is essential for vesicle chaperone to direct the assembly of productive SNARE complexes transport within the Golgi apparatus and from endosomal com- at the sites of membrane fusion. Reflecting this essential role, partments to the Golgi (3). Defects in individual COG subunits mutations in the COG complex can cause congenital disorders of can lead to the aberrant distribution of glycosylation enzymes glycosylation. A deeper understanding of COG function and dys- within the Golgi and thereby to severe genetic diseases known as function will likely depend on elucidating its molecular structure. congenital disorders of glycosylation (CDGs) (17, 18).
    [Show full text]
  • A Novel De Novo Mutation in MYT1, the Unique OAVS Gene Identified So
    European Journal of Human Genetics (2017) 25, 1083–1086 & 2017 Macmillan Publishers Limited, part of Springer Nature. All rights reserved 1018-4813/17 www.nature.com/ejhg SHORT REPORT Anovelde novo mutation in MYT1, the unique OAVS gene identified so far Marie Berenguer1, Angele Tingaud-Sequeira1, Mileny Colovati2, Maria I Melaragno2, Silvia Bragagnolo2, Ana BA Perez2, Benoit Arveiler1,3, Didier Lacombe1,3 and Caroline Rooryck*,1,3 Oculo-auriculo-vertebral spectrum (OAVS) is a developmental disorder characterized by hemifacial microsomia associated with ear, eyes and vertebrae malformations showing highly variable expressivity. Recently, MYT1, encoding the myelin transcription factor 1, was reported as the first gene involved in OAVS, within the retinoic acid (RA) pathway. Fifty-seven OAVS patients originating from Brazil were screened for MYT1 variants. A novel de novo missense variant affecting function, c.323C4T (p. (Ser108Leu)), was identified in MYT1, in a patient presenting with a severe form of OAVS. Functional studies showed that MYT1 overexpression downregulated all RA receptors genes (RARA, RARB, RARG), involved in RA-mediated transcription, whereas no effect was observed on CYP26A1 expression, the major enzyme involved in RA degradation, Moreover, MYT1 variants impacted significantly the expression of these genes, further supporting their pathogenicity. In conclusion, a third variant affecting function in MYT1 was identified as a cause of OAVS. Furthermore, we confirmed MYT1 connection to RA signaling pathway. European Journal of Human Genetics (2017) 25, 1083–1086; doi:10.1038/ejhg.2017.101; published online 14 June 2017 INTRODUCTION ID 00095945 and 00095942, 00095943/00095955 for variants previously Oculo-auriculo-vertebral spectrum (OAVS) is a developmental dis- described2).
    [Show full text]
  • Developmental Anomalies of the Temporomandibular Joint
    Developmental Anomalies of the Temporomandibular Joint R. Bruce Ross, DDS, MSc, FRCD he processes by which the human face develops in the Division of Orthodontics embryo are exceedingly complex, but they work out per- The Hospital for Sick Children fectly—-almost every time. Occasionally, however, the Toronto, Ontario, Canada T development of structures such as those comprising the temporo- mandibular articulation is disturbed, leading to an anomalous Professor Faoulty of Dentistry morphology in later life. It is important to note that an anomaly is University of Toronto not necessarily an undesirable condition requiring treatment. It Toronto, Ontario, Canada may be benign, with no associated problems, and therefore of no consequence; in fact, it may never be identified. Ross and Correspondence to: Johnston' have published a review of the developmental processes Dr R. B. Ross and etiology of undesirable conditions affecting the temporo- Faculty oS Dentistry mandibular joint (TMJ). University of Toronto Craniofacial anomalies may be caused by genetic faults (eg, 124 Edward Street Treacher Collins syndrome) or caused by a teratogenic agent (eg, Toronto, Ontario thahdomide), but most often it appears the cause is multifactorial M5G lG6 0anads Fax:416-813-6375 (eg, cleft hp and palate). When the entire human genome is avail- E-mail: [email protected] able and studied in persons with congenital anomalies, there may well be indicators for, or at least a demonstrable predisposition to, developmental problems. Problems involving the TMJ can be acquired or congenital (developmental). Tbe vast majority seen in a dental office are acquired dysfunctions, traumatic injuries, or pathologic condi- tions.
    [Show full text]