Molecular Cloning of a Candidate Tumor Suppressor Gene, DLC1, from Chromosome 3P21.31

Total Page:16

File Type:pdf, Size:1020Kb

Molecular Cloning of a Candidate Tumor Suppressor Gene, DLC1, from Chromosome 3P21.31 [CANCER RESEARCH 59, 1966–1972, April 15, 1999] Molecular Cloning of a Candidate Tumor Suppressor Gene, DLC1, from Chromosome 3p21.31 Yataro Daigo, Tadashi Nishiwaki, Teru Kawasoe, Mayumi Tamari, Eiju Tsuchiya, and Yusuke Nakamura2 Laboratory of Molecular Medicine, Human Genome Center, Institute of Medical Science, The University of Tokyo, Tokyo 108, Japan [Y. D., T. N., T. K., M. T., Y. N.], and Department of Pathology, Saitama Cancer Center Research Institute, Saitama, Japan [E. T.] ABSTRACT MATERIALS AND METHODS The short arm of chromosome 3 is thought to contain multiple tumor Cell Lines and Primary Tumor Samples. Fourteen human esophageal suppressor genes, because one copy of this chromosomal arm frequently is carcinoma cell lines [TE series: gifts from Dr. Tetsuro Nishihira, Tohoku missing in carcinomas that have arisen in a variety of tissues. We have University (Miyagi); Ref. 12], six lung cancer cell lines [LC319, a gift from isolated a novel gene encoding a 1755-amino acid polypeptide, through Dr. Takashi Takahashi, Aichi Cancer Center (Aichi); A549, NCI-H23, -H226, large-scale sequencing of genomic DNA at 3p21.3. Mutational analysis of -H460, -H522, gifts from Dr. Takao Yamori, Cancer Institute (Tokyo)], and this gene by reverse transcription-PCR revealed the lack of functional two renal cancer cell lines (RXF631L and ACHN, gifts from Dr. Takao transcripts and an increase of nonfunctional RNA transcripts in a signif- Yamori) were grown in monolayers in RPMI 1640 supplemented with 5–10% icant proportion (33%) of cancer cell lines and primary cancers (4 of 14 fetal bovine serum. esophageal cancer cell lines, 2 of 2 renal cancer cell lines, 11 of 30 primary Tumors and corresponding normal tissue samples were obtained from a total non-small cell lung cancers, and 3 of 10 primary squamous cell carcino- of 48 patients with NSCLCs and 10 patients with primary esophageal squa- mas of the esophagus). However, no alterations of the gene itself were mous cell carcinomas, during surgery at the Cancer Institute Hospital (Tokyo) detected in any of the cancers examined. Introduction of the cDNA or the Osaka Medical Center for Cancer and Cardiovascular Diseases (Osaka). significantly suppressed the growth of four different cancer cell lines, two Of the 48 lung cancers, 35 were adenocarcinomas and 13 were squamous cell of which produced no normal transcript on their own. No such effect carcinomas. Total RNA was extracted from each of the 22 cell lines, from 30 occurred when antisense cDNA, cDNA corresponding to an aberrant of the frozen paired lung tissues, and from all 10 paired esophageal specimens, transcript, or the vector DNA alone were transfected. These data suggest using TRIzol Reagent (Life Technologies, Inc.), according to the manufactur- that aberrant transcription of this gene, designated DLC1 (deleted in lung er’s protocol. Extraction of DNA from the cancer cell lines and primary tissue cancer 1), may be involved in carcinogenesis of the lung, esophagus, and samples was carried out as described previously (13). kidney. DNA Sequencing and Isolation of cDNA. Five cosmid clones (306, 308, 603, 602, and 594; Fig. 1), each of which contains part of the genomic DNA of chromosome 3p21.3 in YAC936c1, were completely sequenced by means of INTRODUCTION the shot-gun method detailed previously (6). We analyzed genomic DNA The short arm of chromosome 3 is thought to include multiple sequences from the target region with an exon-prediction computer program, GRAIL2 (14), and performed an exon-connection experiment (15) by RT-PCR tumor suppressor genes, because one allele of this chromosomal arm to investigate whether the predicted candidate exons were actually transcribed. often has been lost in carcinomas of various tissues. Toward isolation The RT-PCR technique was performed as described previously (7). Then we of the putative tumor suppressor gene(s), we earlier performed de- screened human testis cDNA libraries (nearly 1 million plaques) using the tailed deletion mapping of this chromosomal arm using dozens of exon-connected product as a probe and obtained a full-length cDNA. polymorphic DNA probes and a large number of primary cancer Northern Blot Analysis. Human multiple-tissue blots (Clonetech) were materials. That effort identified candidate regions at 3pter–p25, p22- hybridized with a fragment of DLC1 cDNA, labeled by random-oligonucle- p21.3, and p21.1-p14 (1–3). We subsequently found a homozygous otide priming. Prehybridization, hybridization, and washing were performed deletion at 3p22-p21.3 in a lung cancer cell line (4) and performed according to the supplier’s recommendations. The blots were autoradiographed large-scale genomic DNA sequencing of this 685-kb region because at and analyzed with a BAS 1000 image analyzer (FUJI). least one tumor suppressor gene was likely to be present there (5). All Immunocytochemical Analysis. To achieve c-myc-tagged DLC1, we con- structed pcDNA3.1(1)/DLC1SS that contained c-myc epitope sequences four genes identified in the homozygously deleted region were sub- (LDEESILKQE) at the COOH-terminal of the DLC1 protein and transfected to sequently excluded as candidates for tumor suppressor functions (6). COS-7 cells. Transiently transfected COS-7 cells replated on chamber slides However, because the homozygous deletion might have exerted a were fixed with PBS containing 4% paraformaldehyde, then rendered perme- positional effect on expression of genes in the close vicinity, we able with PBS containing 0.1% Triton X-100 for 3 min at 4°C. Cells were extended our DNA sequencing further and have been characterizing covered with blocking solution (2% BSA in PBS) for 30 min at room genomic structures within a 515-kb segment lying distal to the deleted temperature to block nonspecific antibody-binding sites. Then the cells were region (7–11). Here, we report identification of a possible candidate incubated with a mouse anti-c-myc antibody (diluted 1:800 in blocking solu- gene, DLC1,3 that showed aberrant splicing patterns in one-third of tion). Antibodies were stained with a goat anti-mouse secondary antibody the carcinomas of esophagus, lung, and kidney we examined. The conjugated to rhodamine and viewed with an ECLIPSE E800 microscope DLC1 cDNA exerted growth-suppressive activity in vitro. (Nikon). To confirm the expression of DLC1/c-myc-tagged protein in trans- fected cells, we also performed Western blotting, in a manner described previously (16). Received 12/4/98; accepted 2/16/99. Mutational Analysis. SSCP analysis was performed to screen tumors for The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with genetic alterations in the DLC1 gene. DNA samples extracted from 35 ade- 18 U.S.C. Section 1734 solely to indicate this fact. nocarcinomas and 13 squamous cell carcinomas of the lung were used as 1 This work was supported by the Japan Science and Technology Corporation and by templates. In 31 of the 48 cases, LOH was confirmed at 3p21.3 using either “Research for the Future” Program Grant 96L00102 from The Japan Society for the DNA marker D3S685 or F56-CA1, a microsatellite located within the DLC1 Promotion of Science. 32 2 To whom requests for reprints should be addressed, at Laboratory of Molecular gene. Primers to amplify each exon were end-labeled with [ P]ATP, and the Medicine, Human Genome Center, Institute of Medical Science, The University of Tokyo, PCR products were analyzed by electrophoresis in 5% acrylamide gels con- 4-6-1 Shirokanedai, Minato, Tokyo 108-8639, Japan. Phone: 81-3-5449-5372; Fax: 81- taining 5% glycerol. 3-5449-5433; E-mail: [email protected]. Comparative RT-PCR was performed as described elsewhere (17). The 3 The abbreviations used are: DLC1, deleted in lung cancer 1; NSCLC, non-small cell lung cancer; RT-PCR, reverse transcription-PCR; SSCP, single-strand conformation poly- cDNAs obtained from all 22 cancer cell lines mentioned above, 30 of the lung morphism; LOH, loss of heterozygosity. cancers, all 10 esophageal cancers, and samples of normal tissue adjacent to 1966 Downloaded from cancerres.aacrjournals.org on September 28, 2021. © 1999 American Association for Cancer Research. MOLECULAR CLONING OF DLC1 Fig. 1. Detailed physical map of the 1200-kb sequence corresponding to CEPH YAC936c1 on chromosome 3p21.3, and organization of the DLC1 gene relative to the 3p21.3 region homozygously deleted in a lung cancer cell line. A, locations of the overlapping cosmid clones subjected to nucleotide sequencing. B, all genes identified in the region thus far. Arrows, transcriptional direction of each gene. C and D, exon-intron organization and alternative transcripts of the DLC1 gene. Numbered boxes, locations of exons. each primary tumor served as templates for the PCR in a thermal cycler RESULTS (Perkin-Elmer). Six primer sets were designed to amplify the entire coding region of DLC1 cDNA, from nucleotides 23 to 5373. Isolation of a cDNA Clone. GRAIL2 computer analysis of DNA Tumor materials that showed significant reduction of expression of normal sequences in the region covered by cosmid clone 594 (Fig. 1) pre- DLC1 were examined for 59 CpG island methylation of the DLC1 gene by dicted seven possible exons with “excellent” scores. To examine PCR-based assay. Genomic DNA digested with one of the methylation- whether these candidate exons were transcribed in human tissues, we sensitive restriction enzymes (AccII, CfoI, HaeII, or HapII) was PCR amplified synthesized oligonucleotides corresponding to the possible exon re- according to the methods described previously (18). A methylation-insensitive gions and performed exon-connection experiments. We confirmed by restriction enzyme, MspI, was used as a control enzyme. Colony-Formation Assay. Plasmids designed to express DLC1 were con- RT-PCR that the seven exon candidate segments were parts of the structed by cloning the entire coding region of DLC1 cDNA into the same transcript and temporarily designated the 800-bp PCR product pcDNA3.1(1) vector (Invitrogen), which carries a cytomegalovirus promoter as 594E17.
Recommended publications
  • Casein Kinase 1 Isoforms in Degenerative Disorders
    CASEIN KINASE 1 ISOFORMS IN DEGENERATIVE DISORDERS DISSERTATION Presented in Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy in the Graduate School of The Ohio State University By Theresa Joseph Kannanayakal, M.Sc., M.S. * * * * * The Ohio State University 2004 Dissertation Committee: Approved by Professor Jeff A. Kuret, Adviser Professor John D. Oberdick Professor Dale D. Vandre Adviser Professor Mike X. Zhu Biophysics Graduate Program ABSTRACT Casein Kinase 1 (CK1) enzyme is one of the largest family of Serine/Threonine protein kinases. CK1 has a wide distribution spanning many eukaryotic families. In cells, its kinase activity has been found in various sub-cellular compartments enabling it to phosphorylate many proteins involved in cellular maintenance and disease pathogenesis. Tau is one such substrate whose hyperphosphorylation results in degeneration of neurons in Alzheimer’s disease (AD). AD is a slow neuroprogessive disorder histopathologically characterized by Granulovacuolar degeneration bodies (GVBs) and intraneuronal accumulation of tau in Neurofibrillary Tangles (NFTs). The level of CK1 isoforms, CK1α, CK1δ and CK1ε has been shown to be elevated in AD. Previous studies of the correlation of CK1δ with lesions had demonstrated its importance in tau hyperphosphorylation. Hence we investigated distribution of CK1α and CK1ε with the lesions to understand if they would play role in tau hyperphosphorylation similar to CK1δ. The kinase results were also compared with lesion correlation studies of peptidyl cis/trans prolyl isomerase (Pin1) and caspase-3. Our results showed that among the enzymes investigated, CK1 isoforms have the greatest extent of colocalization with the lesions. We have also investigated the distribution of CK1α with different stages of NFTs that follow AD progression.
    [Show full text]
  • CSNK1D Monoclonal Antibody (M09), Clone 4H8
    CSNK1D monoclonal antibody (M09), clone 4H8 Catalog # : H00001453-M09 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Recombinant protein) Description: CSNK1D. Immunofluorescence Immunogen: CSNK1D (AAH03558, 301 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTP TSHTANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMS TSQIPGRVASSGLQSVVHR enlarge Host: Mouse Immunohistochemistry Reactivity: Human (Formalin/PFA-fixed paraffin- embedded sections) Isotype: IgG2a Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Sandwich ELISA (Recombinant protein) enlarge Western Blot detection against Immunogen (38.28 KDa) . ELISA Storage Buffer: In 1x PBS, pH 7.4 In situ Proximity Ligation Assay Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. (Cell) Instruction: MSDS: Download Interspecies Rat (99) Antigen enlarge Sequence: Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download Immunofluorescence Page 1 of 4 2021/6/19 enlarge this image Immunofluorescence of monoclonal antibody to CSNK1D on HeLa cell . [antibody concentration 10 ug/ml] Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlarge this image Immunoperoxidase of monoclonal antibody to CSNK1D on formalin-fixed paraffin- embedded human placenta. [antibody concentration 3 ug/ml] Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged CSNK1D is 0.3 ng/ml as a capture antibody. Protocol Download ELISA In situ Proximity Ligation Assay (Cell) Proximity Ligation Analysis of protein-protein interactions between TP53 and CSNK1D. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-CSNK1D mouse monoclonal antibody 1:50.
    [Show full text]
  • Gene Expression Barcode Values Reveal a Potential Link Between Parkinson's Disease and Gastric Cancer
    University of Kentucky UKnowledge Internal Medicine Faculty Publications Internal Medicine 2-16-2021 Gene Expression Barcode Values Reveal a Potential Link between Parkinson's Disease and Gastric Cancer Suyan Tian First Hospital of Jilin University, China Shishun Zhao Jilin University, China Mingbo Tang First Hospital of Jilin University, China Chi Wang University of Kentucky, [email protected] Follow this and additional works at: https://uknowledge.uky.edu/internalmedicine_facpub Part of the Geriatrics Commons, Internal Medicine Commons, and the Oncology Commons Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Repository Citation Tian, Suyan; Zhao, Shishun; Tang, Mingbo; and Wang, Chi, "Gene Expression Barcode Values Reveal a Potential Link between Parkinson's Disease and Gastric Cancer" (2021). Internal Medicine Faculty Publications. 231. https://uknowledge.uky.edu/internalmedicine_facpub/231 This Article is brought to you for free and open access by the Internal Medicine at UKnowledge. It has been accepted for inclusion in Internal Medicine Faculty Publications by an authorized administrator of UKnowledge. For more information, please contact [email protected]. Gene Expression Barcode Values Reveal a Potential Link between Parkinson's Disease and Gastric Cancer Digital Object Identifier (DOI) https://doi.org/10.18632/aging.202623 Notes/Citation Information Published by Aging, v. 13. © 2021 Tian et al. This is an open access article distributed under the terms of the Creative Commons Attribution License (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. This article is available at UKnowledge: https://uknowledge.uky.edu/internalmedicine_facpub/231 www.aging-us.com AGING 2021, Vol.
    [Show full text]
  • Association of Genetic Variation in Genes Implicated in the B-Catenin Destruction Complex with Risk of Breast Cancer
    2101 Association of Genetic Variation in Genes Implicated in the B-Catenin Destruction Complex with Risk of Breast Cancer Xianshu Wang,1 Ellen L. Goode,2 Zachary S. Fredericksen,2 Robert A. Vierkant,2 V. Shane Pankratz,2 Wen Liu-Mares,2 David N. Rider,2 Celine M. Vachon,2 James R. Cerhan,2 Janet E. Olson,2 and Fergus J. Couch1 Departments of 1Laboratory Medicine and Pathology and 2Health Sciences Research, Mayo Clinic, Rochester, Minnesota Abstract B P Aberrant Wnt/ -catenin signaling leading to nuclear 95% confidence intervals, 1.05-1.43; trend = 0.01). In accumulation of the oncogene product B-catenin is ob- addition, five SNPs in AXIN2 were associated with in- P served in a wide spectrum of human malignancies. creased risk of breast cancer ( trend < 0.05). Haplotype- The destruction complex in the Wnt/B-catenin pathway based tests identified significant associations between is critical for regulating the level of B-catenin in the specific haplotypes in APC and AXIN2 (P V 0.03) and cytoplasm and in the nucleus. Here, we report a com- breast cancer risk. Further characterization of the APC prehensive study of the contribution of genetic varia- and AXIN2 variants suggested that AXIN2 rs4791171 tion in six genes encoding the B-catenin destruction was significantly associated with risk in premeno- APC, AXIN1, AXIN2, CSNK1D, CSNK1E P complex ( , and pausal ( trend = 0.0002) but not in postmenopausal GSK3B) to breast cancer using a Mayo Clinic Breast women. The combination of our findings and numer- Cancer Case-Control Study. A total of 79 candidate ous genetic and functional studies showing that APC functional and tagging single nucleotide polymor- and AXIN2 perform crucial tumor suppressor func- phisms (SNP) were genotyped in 798 invasive cases tions suggest that further investigation of the contri- and 843 unaffected controls.
    [Show full text]
  • Casein Kinase 1D Encodes a Novel Drug Target in Hedgehog—GLI-Driven Cancers and Tumor-Initiating Cells Resistant to SMO Inhibition
    cancers Article Casein Kinase 1D Encodes a Novel Drug Target in Hedgehog—GLI-Driven Cancers and Tumor-Initiating Cells Resistant to SMO Inhibition Elisabeth Peer 1, Sophie Karoline Aichberger 1, Filip Vilotic 1, Wolfgang Gruber 1,†, Thomas Parigger 1,2, Sandra Grund-Gröschke 1,‡, Dominik Patrick Elmer 1 , Florian Rathje 1, Andrea Ramspacher 1,3 , Mirko Zaja 4, Susanne Michel 4, Svetlana Hamm 4 and Fritz Aberger 1,* 1 Department of Bioscience, Cancer Cluster Salzburg, Paris-Lodron University Salzburg, 5020 Salzburg, Austria; [email protected] (E.P.); [email protected] (S.K.A.); viloticfi@web.de (F.V.); gruber.wolfi@gmail.com (W.G.); [email protected] (T.P.); [email protected] (S.G.-G.); [email protected] (D.P.E.); fl[email protected] (F.R.); [email protected] (A.R.) 2 Laboratory for Immunological and Molecular Cancer Research (SCRI-LIMCR), Salzburg Cancer Research Institute, Cancer Cluster Salzburg, IIIrd Medical Department, Paracelsus Medical University Salzburg, 5020 Salzburg, Austria 3 Research Program for Receptor Biochemistry and Tumor Metabolism, Department of Pediatrics, University Hospital of the Paracelsus Medical University, 5020 Salzburg, Austria 4 4SC AG, Planegg-Martinsried, 82152 Planegg, Germany; [email protected] (M.Z.); [email protected] (S.M.); [email protected] (S.H.) Citation: Peer, E.; Aichberger, S.K.; * Correspondence: [email protected]; Tel.: +43-662-8044-5792 Vilotic, F.; Gruber, W.; Parigger, T.; † Present address: EVER Pharma GmbH, 4866 Unterach, Austria. Grund-Gröschke, S.; Elmer, D.P.; ‡ Present address: Immatics Biotechnologies GmbH, 72076 Tübingen, Germany.
    [Show full text]
  • Protein Interactors of the Cellular Tumor Antigen P53 with Response to Ionizing Radiation
    IPEN Informe Científico Tecnológico. Volumen 12 (2012). p. 49-50. ISSN 1684-1662 Protein interactors of the cellular tumor antigen p53 with response to ionizing radiation Silvia Vasquez1,3,4,*, Roberto Pineda2, Mohanalatha Chandrasekharan3, Prashanth Suravajhala3,4 1 Dirección de Investigación y Desarrollo, Centro Nuclear RACSO, Instituto Peruano de Energía Nuclear, Av. Canadá 1470, Lima 41, Perú 2 Facultad de Ciencias Biológicas, Universidad Ricardo Palma, Av. Benavides 5440, Surco, Lima 33, Perú 3 Bioclues.org, IKP Knowledge Park, Secunderabad, 500009 AP, India 4 Bioinformatics Organization, Hudson, Massachusetts, United States of America Abstract TP53 interacts with the genes CDKN1A, CSNK1A1, CSNK1D, BAX, ATM, MDM2, HIF1A,SP1. This consensus network has many binding regions involved in phosphorylation. To find whether or not the interactions are involved in ionizing radiation (IR), we used protein interaction mining and visualization tools to decipher the network. We conclude that ATM, PCNA, TP53 and CDKN1A show protein interactions on cellular response to IR. Resumen TP53 interactúa con los genes CDKN1A, CSNK1A1, CSNK1D, BAX, ATM, MDM2, HIF1A y SP1. La red consensual mencionada presenta varias regiones de unión que intervienen durante la fosforilación. Para encontrar si estas interacciones participan o no en la respuesta a la radiación ionizante (IR) analizamos la minería de interacciones proteicas y las herramientas de visualización para descifrar la red. Concluimos que ATM, PCNA, TP53 y CDKN1A presentan interacciones proteicas en la respuesta celular a IR. 1. Introduction proteins could also be better candidates and it would be interesting to run pull down assays The cellular tumor antigen p53[1] participates for these proteins to check for their candidacy in the regulation of the cellular cycle and the in CVD.
    [Show full text]
  • Page 1 Exploring the Understudied Human Kinome For
    bioRxiv preprint doi: https://doi.org/10.1101/2020.04.02.022277; this version posted June 30, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Exploring the understudied human kinome for research and therapeutic opportunities Nienke Moret1,2,*, Changchang Liu1,2,*, Benjamin M. Gyori2, John A. Bachman,2, Albert Steppi2, Rahil Taujale3, Liang-Chin Huang3, Clemens Hug2, Matt Berginski1,4,5, Shawn Gomez1,4,5, Natarajan Kannan,1,3 and Peter K. Sorger1,2,† *These authors contributed equally † Corresponding author 1The NIH Understudied Kinome Consortium 2Laboratory of Systems Pharmacology, Department of Systems Biology, Harvard Program in Therapeutic Science, Harvard Medical School, Boston, Massachusetts 02115, USA 3 Institute of Bioinformatics, University of Georgia, Athens, GA, 30602 USA 4 Department of Pharmacology, The University of North Carolina at Chapel Hill, Chapel Hill, NC 27599, USA 5 Joint Department of Biomedical Engineering at the University of North Carolina at Chapel Hill and North Carolina State University, Chapel Hill, NC 27599, USA Key Words: kinase, human kinome, kinase inhibitors, drug discovery, cancer, cheminformatics, † Peter Sorger Warren Alpert 432 200 Longwood Avenue Harvard Medical School, Boston MA 02115 [email protected] cc: [email protected] 617-432-6901 ORCID Numbers Peter K. Sorger 0000-0002-3364-1838 Nienke Moret 0000-0001-6038-6863 Changchang Liu 0000-0003-4594-4577 Ben Gyori 0000-0001-9439-5346 John Bachman 0000-0001-6095-2466 Albert Steppi 0000-0001-5871-6245 Page 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.04.02.022277; this version posted June 30, 2020.
    [Show full text]
  • Analysis of DNA Methylation Sites Used for Forensic Age Prediction and Their Correlation with Human Aging
    Silva DSBS, et al., J Forensic Leg Investig Sci 2021, 7: 054 DOI: 10.24966/FLIS-733X/100054 HSOA Journal of Forensic, Legal & Investigative Sciences Research Article Analysis of DNA Methylation Introduction DNA samples left behind in crime scenes are often used for Sites used for Forensic Age identification purposes by comparing them to reference samples or to a forensic database. In cases where there is no match, investigators may Prediction and their Correlation turn to alternative approaches using advanced technologies to gain valuable leads on phenotypic traits (externally visible characteristics) with Human Aging of the person who had left the DNA material. Previous studies have found that phenotypes can be predicted by using information obtained from different DNA markers, such as single nucleotide Silva DSBS1* and Karantenislis G2 polymorphisms (SNPs), insertion/deletion polymorphisms (InDel), and epigenetic markers [1-11]. It is well established that epigenetic 1Department of Chemistry, Hofstra University, Hempstead-NY, USA modifications are major regulators in the translation of genotype 2John F Kennedy High School, Bellmore-NY, USA to phenotype. Epigenetic regulation encompasses various levels of gene expression and involves modifications of DNA, histones, RNA and chromatin, with functional consequences for the human Abstract genome [12-14]. DNA methylation is the most well-characterized epigenetic modification. It is usually associated with transcriptional Phenotype-related features, such as age, are linked to repression and it involves the addition of a methyl group (– CH3) in genetic components through regulatory pathways and epigenetic the cytosine of CpG dinucleotides. Differences in DNA methylation modifications, such as DNA methylation, are major regulators in levels in specific regions of the genome can affect the expression of the translation of genotype to phenotype.
    [Show full text]
  • Genetic Insights on Sleep Schedules
    Review Genetic insights on sleep schedules: this time, it’s PERsonal 1 1,2 1 S.Y. Christin Chong , Louis J. Pta´ cˇek and Ying-Hui Fu 1 Department of Neurology, University of California San Francisco, San Francisco, CA 94158, USA 2 Howard Hughes Medical Institute, San Francisco, CA 94158, USA The study of circadian rhythms is emerging as a fruitful the genetic basis of circadian behaviors, and this opened opportunity for understanding cellular mechanisms that the floodgate for the study of analogous circadian genes in govern human physiology and behavior, fueled by evi- mammalian model systems [3]. However, are human cir- dence directly linking sleep disorders to genetic muta- cadian behaviors also genetically ‘hard-wired’? tions affecting circadian molecular pathways. Familial Although humans are by nature diurnal, there is a wide advanced sleep-phase disorder (FASPD) is the first rec- spectrum of sleep–wake time preferences in the general ognized Mendelian circadian rhythm trait, and affected population, ranging from ‘morning larks’ to ‘night owls’ [4]. individuals exhibit exceptionally early sleep–wake onset With the advent of high-throughput genotyping technolo- due to altered post-translational regulation of period gies, and the identification of conserved circadian genes, homolog 2 (PER2). Behavioral and cellular circadian mounting evidence now supports the role of genetics in rhythms are analogously affected because the circadian regulating sleep timing [5]. Nevertheless, the identifica- period length of behavior is reduced in the absence of tion of causative genes remains challenging due to complex environmental time cues, and cycle duration of the mo- polygenic interactions, confounding environmental factors, lecular clock is likewise shortened.
    [Show full text]
  • Identification of Three Novel Ca Channel Subunit Genes Reveals
    Downloaded from genome.cshlp.org on October 4, 2021 - Published by Cold Spring Harbor Laboratory Press Letter Identification of Three Novel Ca2+ Channel ␥ Subunit Genes Reveals Molecular Diversification by Tandem and Chromosome Duplication Daniel L. Burgess,1,2 Caleb F. Davis,1 Lisa A. Gefrides,1 and Jeffrey L. Noebels1 1Department of Neurology, Baylor College of Medicine, Houston, Texas 77030 USA Gene duplication is believed to be an important evolutionary mechanism for generating functional diversity within genomes. The accumulated products of ancient duplication events can be readily observed among the genes encoding voltage-dependent Ca2+ ion channels. Ten paralogous genes have been identified that encode isoforms of the ␣1 subunit, four that encode ␤ subunits, and three that encode ␣2␦ subunits. Until recently, only a single gene encoding a muscle-specific isoform of the Ca2+ channel ␥ subunit (CACNG1) was known. Expression of a distantly related gene in the brain was subsequently demonstrated upon isolation of the Cacng2 gene, which is mutated in the mouse neurological mutant stargazer (stg). In this study, we sought to identify additional genes that encoded ␥ subunits. Because gene duplication often generates paralogs that remain in close syntenic proximity (tandem duplication) or are copied onto related daughter chromosomes (chromosome or whole-genome duplication), we hypothesized that the known positions of CACNG1 and CACNG2 could be used to predict the likely locations of additional ␥ subunit genes. Low-stringency genomic sequence analysis of targeted regions led to the identification of three novel Ca2+ channel ␥ subunit genes, CACNG3, CACNG4, and CACNG5,on chromosomes 16 and 17. These results demonstrate the value of genome evolution models for the identification of distantly related members of gene families.
    [Show full text]
  • Novel and Highly Recurrent Chromosomal Alterations in Se´Zary Syndrome
    Research Article Novel and Highly Recurrent Chromosomal Alterations in Se´zary Syndrome Maarten H. Vermeer,1 Remco van Doorn,1 Remco Dijkman,1 Xin Mao,3 Sean Whittaker,3 Pieter C. van Voorst Vader,4 Marie-Jeanne P. Gerritsen,5 Marie-Louise Geerts,6 Sylke Gellrich,7 Ola So¨derberg,8 Karl-Johan Leuchowius,8 Ulf Landegren,8 Jacoba J. Out-Luiting,1 Jeroen Knijnenburg,2 Marije IJszenga,2 Karoly Szuhai,2 Rein Willemze,1 and Cornelis P. Tensen1 Departments of 1Dermatology and 2Molecular Cell Biology, Leiden University Medical Center, Leiden, the Netherlands; 3Department of Dermatology, St Thomas’ Hospital, King’s College, London, United Kingdom; 4Department of Dermatology, University Medical Center Groningen, Groningen, the Netherlands; 5Department of Dermatology, Radboud University Nijmegen Medical Center, Nijmegen, the Netherlands; 6Department of Dermatology, Gent University Hospital, Gent, Belgium; 7Department of Dermatology, Charite, Berlin, Germany; and 8Department of Genetics and Pathology, Rudbeck Laboratory, University of Uppsala, Uppsala, Sweden Abstract Introduction This study was designed to identify highly recurrent genetic Se´zary syndrome (Sz) is an aggressive type of cutaneous T-cell alterations typical of Se´zary syndrome (Sz), an aggressive lymphoma/leukemia of skin-homing, CD4+ memory T cells and is cutaneous T-cell lymphoma/leukemia, possibly revealing characterized by erythroderma, generalized lymphadenopathy, and pathogenetic mechanisms and novel therapeutic targets. the presence of neoplastic T cells (Se´zary cells) in the skin, lymph High-resolution array-based comparative genomic hybridiza- nodes, and peripheral blood (1). Sz has a poor prognosis, with a tion was done on malignant T cells from 20 patients. disease-specific 5-year survival of f24% (1).
    [Show full text]
  • Genomic Incompatibilities in the Diploid and Tetraploid Offspring of the Goldfish × Common Carp Cross
    Genomic incompatibilities in the diploid and tetraploid offspring of the goldfish × common carp cross Shaojun Liua,1,2,JingLuob,c,1, Jing Chaib,c,d,e,1,LiRena,1,YiZhoua,1, Feng Huangb,c,1, Xiaochuan Liub,c,1, Yubao Chena, Chun Zhanga, Min Taoa,BinLub,c, Wei Zhouf,GuoliangLinb,c,ChaoMaif, Shuo Yuanf, Jun Wanga, Tao Lia, Qinbo Qina, Hao Fenga, Kaikun Luoa,JunXiaoa, Huan Zhonga, Rurong Zhaoa, Wei Duana, Zhenyan Songa, Yanqin Wangb,c, Jing Wangb,c,LiZhongb,c,LuWangb,c, Zhaoli Dingd, Zhenglin Dug,XuemeiLuh,YunGaod, Robert W. Murphyd,i, Yun Liua, Axel Meyerj,2, and Ya-Ping Zhangb,c,d,2 aKey Laboratory of Protein Chemistry and Fish Developmental Biology of Education Ministry of China, College of Life Sciences, Hunan Normal University, Changsha, 410081, Hunan, China; bState Key Laboratory for Conservation and Utilization of Bio-Resources in Yunnan, Yunnan University, Kunming, 650091, Yunnan, China; cKey Laboratory for Animal Genetic Diversity and Evolution of High Education in Yunnan Province, School of Life Sciences, Yunnan University, Kunming, 650091, Yunnan, China; dState Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, 650223, Yunnan, China; eKunming College of Life Science, University of Chinese Academy of Sciences, Kunming, 650204, China; fSchool of Software, Yunnan University, Kunming, 650091, Yunnan, China; gCore Genomic Facility, Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing, 100029, China; hKey Laboratory of Genomic and Precision Medicine, Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing, 100101, China; iCentre for Biodiversity and Conservation Biology, Royal Ontario Museum, Toronto, ON, Canada M5S 2C6; and jDepartment of Biology, University of Konstanz, 78457 Konstanz, Germany Edited by Z.
    [Show full text]