DOCSLIB.ORG

GKN1 Monoclonal Antibody (M01), Clone 2E5

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
GKN1 Monoclonal Antibody (M01), Clone 2E5 Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic GKN1 monoclonal antibody (M01), clone 2E5 Catalog # : H00056287-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Transfected lysate) Description: GKN1. Immunogen: GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGN GFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPK GLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCY enlarge TTSVLWIVDISFCGDTVEN Western Blot (Recombinant protein) Host: Mouse Sandwich ELISA (Recombinant Reactivity: Human protein) Isotype: IgG1 kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge ELISA Western Blot detection against Immunogen (43.89 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Publication Reference 1. Anti-amyloidogenic property of human gastrokine 1. Altieri F, Di Stadio CS, Severino V, Sandomenico A, Minopoli G, Miselli G, Di Maro A, Ruvo M, Chambery A, Quagliariello V, Masullo M, Rippa E, Arcari P.Biochimie. 2014 Nov;106:91-100. 2. Helicobacter pylori infection and administration of non-steroidal anti-inflammatory drugs down-regulate the expression of gastrokine-1 in gastric mucosa. Mao W, Chen J, Peng TL, Yin XF, Chen LZ, Chen MH.Turk J Gastroenterol. 2012 Jun;23(3):212-9. Page 1 of 3 2016/5/24 3. Downregulation of gastrokine-1 in gastric cancer tissues and restoration of its expression induced gastric cancer cells to apoptosis. Mao W, Chen J, Peng TL, Yin XF, Chen LZ, Chen MH.J Exp Clin Cancer Res. 2012 May 23;31:49. doi: 10.1186/1756-9966-31-49. 4. Characterization of the Human Gastric Fluid Proteome Reveals Distinct pH-Dependent Protein Profiles: Implications for Biomarker Studies. Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL.J Proteome Res. 2011 Aug 15. [Epub ahead of print] 5. Overexpression of gastrokine 1 in gastric cancer cells induces fas-mediated apoptosis. Rippa E, La Monica G, Allocca R, Romano MF, De Palma M, Arcari P.J Cell Physiol. 2010 Dec 28. [Epub ahead of print] Applications Western Blot (Transfected lysate) Western Blot analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5. Lane 1: GKN1 transfected lysate(20 KDa). Lane 2: Non-transfected lysate. Protocol Download Western Blot (Recombinant protein) Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged GKN1 is approximately 0.1ng/ml as a capture antibody. Protocol Download ELISA Gene Information Entrez GeneID: 56287 GeneBank BC059778 Accession#: Protein AAH59778 Accession#: Page 2 of 3 2016/5/24 Gene Name: GKN1 Gene Alias: AMP18,BRICD1,CA11,FOV,MGC70354,foveolin Gene gastrokine 1 Description: Omim ID: 606402 Gene Ontology: Hyperlink Gene Summary: The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq Other 18 kDa antrum mucosa protein,BRICHOS domain containing 1 Designations: Related Disease Tobacco Use Disorder 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 3 of 3 2016/5/24.
Load more

Recommended publications
  • Evaluation of GKN1 and GKN2 Gene Expression As a Biomarker of Gastric Cancer
    Archive of SID Gastroenterology and Hepatology From Bed to Bench. BRIEF REPORT ©2018 RIGLD, Research Institute for Gastroenterology and Liver Diseases Evaluation of GKN1 and GKN2 gene expression as a biomarker of gastric cancer Fatemeh Dokhaee1, Sogol Mazhari2, Mohammad Galehdari1, Ayad Bahadori Monfared3, Kaveh Baghaei4 1 Faculty of Biological Sciences, North Tehran Branch, Islamic Azad University, Tehran, Iran 2 Basic and Molecular Epidemiology of Gastrointestinal Disorders Research Center, Research Institute for Gastroenterology and Liver Diseases, Shahid Beheshti University of Medical Science, Tehran, Iran 3 Faculty of Medicine, Shahid Beheshti University of Medical Sciences, Tehran, Iran 4 Gastroenterology and Liver Diseases Research Center, Research Institute for Gastroenterology and Liver Diseases, Shahid Beheshti University of Medical Sciences, Tehran, Iran ABSTRACT Aim: The aim of this study was to investigate the expression of GKN1 and GKN2 genes as probable biomarkers for gastric cancer. Background: Gastric cancer is a multifactorial process characterized by the uncontrolled growth and dissemination of abnormal cells. Survival rates of gastric cancer tend to be poor, a plausible explanation is a combination of a late-stage diagnosis and limited access to treatment. In this regard, finding relevant and measurable biomarkers is urgently needed. Methods: 27 samples of gastric cancer tissues were enrolled into this study, according to their pathological responses. The alteration of genes expression were evaluated by Real-Time PCR technique. Results: Our findings showed the significant reduction of Gastrokin-1 and Gastrokine-2 genes expression in the cancerous specimens in comparison with the normal tissues. (P = 0.008 and P = 0.004 respectively). Conclusion: Our findings showed the significant reduction of Gastrokin-1 and Gastrokine-2 genes expression in the cancerous specimens in comparison with the normal tissues.
    [Show full text]
  • Investigation of the Underlying Hub Genes and Molexular Pathogensis in Gastric Cancer by Integrated Bioinformatic Analyses
    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.20.423656; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Investigation of the underlying hub genes and molexular pathogensis in gastric cancer by integrated bioinformatic analyses Basavaraj Vastrad1, Chanabasayya Vastrad*2 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.20.423656; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract The high mortality rate of gastric cancer (GC) is in part due to the absence of initial disclosure of its biomarkers. The recognition of important genes associated in GC is therefore recommended to advance clinical prognosis, diagnosis and and treatment outcomes. The current investigation used the microarray dataset GSE113255 RNA seq data from the Gene Expression Omnibus database to diagnose differentially expressed genes (DEGs). Pathway and gene ontology enrichment analyses were performed, and a proteinprotein interaction network, modules, target genes - miRNA regulatory network and target genes - TF regulatory network were constructed and analyzed. Finally, validation of hub genes was performed. The 1008 DEGs identified consisted of 505 up regulated genes and 503 down regulated genes.
    [Show full text]
  • Hippo and Sonic Hedgehog Signalling Pathway Modulation of Human Urothelial Tissue Homeostasis
    Hippo and Sonic Hedgehog signalling pathway modulation of human urothelial tissue homeostasis Thomas Crighton PhD University of York Department of Biology November 2020 Abstract The urinary tract is lined by a barrier-forming, mitotically-quiescent urothelium, which retains the ability to regenerate following injury. Regulation of tissue homeostasis by Hippo and Sonic Hedgehog signalling has previously been implicated in various mammalian epithelia, but limited evidence exists as to their role in adult human urothelial physiology. Focussing on the Hippo pathway, the aims of this thesis were to characterise expression of said pathways in urothelium, determine what role the pathways have in regulating urothelial phenotype, and investigate whether the pathways are implicated in muscle-invasive bladder cancer (MIBC). These aims were assessed using a cell culture paradigm of Normal Human Urothelial (NHU) cells that can be manipulated in vitro to represent different differentiated phenotypes, alongside MIBC cell lines and The Cancer Genome Atlas resource. Transcriptomic analysis of NHU cells identified a significant induction of VGLL1, a poorly understood regulator of Hippo signalling, in differentiated cells. Activation of upstream transcription factors PPARγ and GATA3 and/or blockade of active EGFR/RAS/RAF/MEK/ERK signalling were identified as mechanisms which induce VGLL1 expression in NHU cells. Ectopic overexpression of VGLL1 in undifferentiated NHU cells and MIBC cell line T24 resulted in significantly reduced proliferation. Conversely, knockdown of VGLL1 in differentiated NHU cells significantly reduced barrier tightness in an unwounded state, while inhibiting regeneration and increasing cell cycle activation in scratch-wounded cultures. A signalling pathway previously observed to be inhibited by VGLL1 function, YAP/TAZ, was unaffected by VGLL1 manipulation.
    [Show full text]
  • Comparative Population Genomics Reveals Genetic Basis Underlying Body Size of Domestic Chickens
    542 j Journal of Molecular Cell Biology (2016), 8(6), 542–552 doi:10.1093/jmcb/mjw044 Published online October 15, 2016 Article Comparative population genomics reveals genetic basis underlying body size of domestic chickens Ming-Shan Wang1,2, Yong-Xia Huo1,3, Yan Li4, Newton O. Otecko1,2, Ling-Yan Su2,5, Hai-Bo Xu1,2, Shi-Fang Wu1,2, Min-Sheng Peng1,2, He-Qun Liu1,2, Lin Zeng1,2, David M. Irwin1,6,7, Yong-Gang Yao2,5, Dong-Dong Wu1,2,*, and Ya-Ping Zhang1,2,4,* 1 State Key Laboratory of Genetic Resources and Evolution, Yunnan Laboratory of Molecular Biology of Domestic Animals, Kunming Institute of Zoology, Downloaded from Chinese Academy of Sciences, Kunming 650223, China 2 Kunming College of Life Science, University of Chinese Academy of Sciences, Kunming 650204, China 3 College of Life Science, Anhui University, Hefei 230601, China 4 Laboratory for Conservation and Utilization of Bio-Resource, Yunnan University, Kunming 650091, China 5 Key Laboratory of Animal Models and Human Disease Mechanisms of the Chinese Academy of Sciences & Yunnan Province, Kunming Institute of Zoology, Kunming 650223, China http://jmcb.oxfordjournals.org/ 6 Department of Laboratory Medicine and Pathobiology, University of Toronto, Toronto, Ontario M5S 1A8, Canada 7 Banting and Best Diabetes Centre, University of Toronto, Toronto, Ontario M5G 2C4, Canada * Correspondence to: Dong-Dong Wu, E-mail: [email protected]; Ya-Ping Zhang, E-mail: [email protected] Body size is the most important economic trait for animal production and breeding. Several hundreds of loci have been reported to be associated with growth trait and body weight in chickens.
    [Show full text]
  • Whole Genome and Transcriptome Sequencing of Matched Primary And
    www.nature.com/scientificreports OPEN Whole genome and transcriptome sequencing of matched primary and peritoneal metastatic gastric Received: 07 April 2015 Accepted: 04 August 2015 carcinoma Published: 02 September 2015 Zhang J.1,2,*, Huang J. Y.2,3,*, Chen Y. N.1,2,*, Yuan F.4, Zhang H.5, Yan F. H.5, Wang M. J.3, Wang G.6, Su M.6, Lu G.6, Huang Y.6, Dai H.6, Ji J.1,2, Zhang J.1,2, Zhang J. N.1,2, Jiang Y. N.1,2, Chen S. J.2,3, Zhu Z. G.1,2 & Yu Y. Y.1,2 Gastric cancer is one of the most aggressive cancers and is the second leading cause of cancer death worldwide. Approximately 40% of global gastric cancer cases occur in China, with peritoneal metastasis being the prevalent form of recurrence and metastasis in advanced disease. Currently, there are limited clinical approaches for predicting and treatment of peritoneal metastasis, resulting in a 6-month average survival time. By comprehensive genome analysis will uncover the pathogenesis of peritoneal metastasis. Here we describe a comprehensive whole-genome and transcriptome sequencing analysis of one advanced gastric cancer case, including non-cancerous mucosa, primary cancer and matched peritoneal metastatic cancer. The peripheral blood is used as normal control. We identified 27 mutated genes, of which 19 genes are reported in COSMIC database (ZNF208, CRNN, ATXN3, DCTN1, RP1L1, PRB4, PRB1, MUC4, HS6ST3, MUC17, JAM2, ITGAD, IREB2, IQUB, CORO1B, CCDC121, AKAP2, ACAN and ACADL), and eight genes have not previously been described in gastric cancer (CCDC178, ARMC4, TUBB6, PLIN4, PKLR, PDZD2, DMBT1and DAB1).
    [Show full text]
  • Gene Expression Analysis of FABP4 in Gastric Cancer
    Cukurova Medical Journal Cukurova Med J 2016;41(2):248-252 ÇUKUROVA ÜNİVERSİTESİ TIP FAKÜLTESİ DERGİSİ DOI: 10.17826/cutf.202020 ARAŞTIRMA/RESEARCH Gene expression analysis of FABP4 in gastric cancer Gastrik kanserde FABP4 gen ekspresyon analizi Abdulkarim Yasin Karim University of Salahaddin, College of Science, Department of Biology, Iraq Cukurova Medical Journal 2016;41(2):248-252. Abstract Öz Purpose: Gastric cancer has high incidence and mortality Amaç: Gastrik kanser birçok ülkede yüksek oran ve rate in several countries and is still one of the most mortalite oranına sahiptir ve günümüzde halen en sık frequent and lethal disease. In this study, we aimed to görülen ölümcül hastalıklarından biridir. Bu çalışmada, determine diagnostic markers in gastric cancer by gastrik kanseri teşhisini için moleküler tekniklerle FABP4 molecular techniques; include mRNA expression analysis geninin mRNA ekspresyon analizini içeren yeni markırlar of FABP4 gene. Fatty acid binding protein 4 (FABP4) belirlemeyi amaçladık. Yağ asidi bağlayıcı protein 4 gene encodes the fatty acid binding protein found in (FABP4) geni adipositlerde bulunan yağ asidi bağlayıcı adipocytes. The protein encoded by FABP4 are a family of proteini kodlar. FABP4 tarafından kodlanan protein, uzun small, highly conserved, cytoplasmic proteins that bind zincirli yağ asitleri ve diğer hidrofobik ligandlara bağlanan long-chain fatty acids and other hydrophobic ligands. It is küçük, yüksek düzeyde korunmuş, sitoplazmik bir protein thought that FABPs roles include fatty acid uptake, ailesidir. FABP’ün yağ asidi alımı, taşınması ve transport, and metabolism. metabolizmayı içeren görevleri olduğu düşünülmektedir. Material and Methods: Total RNA were extracted from Gereç ve Yöntem: Total RNA, 47 gastrik kanserinin paired tumor and normal tissues of 47 gastric cancer.
    [Show full text]
  • Independent Methylome-Wide Association Studies Of
    applyparastyle "fig//caption/p[1]" parastyle "FigCapt" applyparastyle "fig" parastyle "Figure" Schizophrenia Bulletin vol. 46 no. 2 pp. 319–327, 2020 doi:10.1093/schbul/sbz056 Advance Access publication 5 June 2019 Independent Methylome-Wide Association Studies of Schizophrenia Detect Consistent Case–Control Differences Downloaded from https://academic.oup.com/schizophreniabulletin/article-abstract/46/2/319/5511546 by University of Exeter user on 28 April 2020 Robin F. Chan1, Andrey A. Shabalin1, Carolina Montano2, Eilis Hannon3, Christina M. Hultman4, Margaret D. Fallin5, Andrew P. Feinberg6, Jonathan Mill3, Edwin J. C. G. van den Oord1, and Karolina A. Aberg*,1 1Center for Biomarker Research and Precision Medicine, School of Pharmacy, Virginia Commonwealth University, Richmond, VA; 2Department of Medicine, Boston Children’s Hospital, Boston, MA; 3University of Exeter Medical School, University of Exeter, Exeter, UK; 4Department of Medical Epidemiology and Biostatistics, Karolinska Institutet, Stockholm, Sweden; 5Department of Mental Health, Johns Hopkins Bloomberg School of Public Health, Baltimore, MD; 6Department of Medicine, Johns Hopkins University School of Medicine, Baltimore, MD *To whom correspondence should be addressed; tel: 804-628–3023, fax: +1 804 -628-3991, e-mail: [email protected] Methylome-wide association studies (MWASs) are prom- Introduction ising complements to sequence variation studies. We DNA methylation is a dynamic epigenetic modifica- used existing sequencing-based methylation data, which tion that provides the cellular phenotype both stability assayed the majority of all 28 million CpGs in the human and diversity. Investigations of these modifications pro- genome, to perform an MWAS for schizophrenia in blood, vide promising complements to schizophrenia studies while controlling for cell-type heterogeneity with a re- of sequence variation.
    [Show full text]
  • Detection of Fusion Genes and Their Expression in Gastric Cancer Patients in Mizo Population
    Detection of fusion genes and their expression in gastric cancer patients in Mizo population By Ranjan Jyoti Sarma Registration No. and Date: MZU/M.Phil./473 of 03/05/2018 Dissertation submitted in fulfilment of the Requirements for the degree of Master of Philosophy in Biotechnology Under the supervision of Dr. N. Senthil Kumar Professor, Department of Biotechnology School of Life Sciences, Mizoram University, Aizawl, Mizoram-796004, India 2019 ACKNOWLEDGEMENT I am thankful to Prof. N Senthil Kumar for his constant support and motivation throughout the work. I am thankful to the sample donors which made possible to conduct the study. A special thanks to Dr. Jeremy L. Pautu, Regional Cancer Research Centre, Zemabawk; Dr. John Zohmingthanga, Civil Hospital, Aizawl and Dr. Lalawmpuii Pachuau, Civil Hospital, Aizawl. Special thanks to Dr. Arindam Maitra, Scientist, NIBMG for providing the next- generation sequencing facility. I am also thankful to Dr. J. Bhattacharya (Head) along with all the teaching , non- teaching staffs and all the research scholar of Department of Biotechnology, Mizoram University. I am also thankful to DBT, New Delhi for (DBT-Biotech Hub) the fellowship and DBT-BIF for providing the computational facility. I am thankful to my family members for lifting my confidence up with constant support. Dated: Place: Aizawl, Mizoram Ranjan Jyoti Sarma TABLE OF CONTENTS Content Page Number Abbreviations List of Figures List of Tables Introduction and Literature Review 1-14 Objective 15 Materials and Methods 16-26 Result 27-39 Discussion 40-44 Summary 45 Appendices 46-54 Appendix -I: The preview of the questionnaire followed for the sample 46-50 collection of the study.
    [Show full text]
  • A Novel Gene Complementing Resistance to Bordetella
    bioRxiv preprint doi: https://doi.org/10.1101/2021.08.18.456822; this version posted August 18, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. GENETIC ANALYSIS OF BPHSE: A NOVEL GENE COMPLEMENTING RESISTANCE TO BORDETELLA PERTUSSIS-INDUCED HISTAMINE SENSITIZATION Abbas Raza1, Sean A. Diehl2, Laure K. Case3, Dimitry N. Krementsov4, Dawei Li2, Jason Kost2, Robyn L. Ball3, Elissa J. Chesler3, Vivek M. Philip3, Rui Huang5, Yan Chen5, Runlin Ma5, Anna L. Tyler3, J. Mathew Mahoney3,6, Elizabeth P. Blankenhorn7, and Cory Teuscher1,8,* Departments of Medicine1, Microbiology and Molecular Genetics2, Biomedical and Health Sciences4, Neurological Sciences6, Pathology and Laboratory Medicine8, University of Vermont, Burlington, VT, USA 05405 The Jackson Laboratory3, Bar Harbor, Maine, USA 04609 School of Life Sciences5, University of the Chinese Academy of Sciences, Beijing, China 100049 Department of Microbiology and Immunology7, Drexel University College of Medicine, Philadelphia, Pennsylvania, USA 19129 *Address correspondence to: Cory Teuscher, PhD C331 Given Medical Building 89 Beaumont Avenue University of Vermont Burlington, Vermont, 05405, USA E-mail: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.08.18.456822; this version posted August 18, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license.
    [Show full text]
  • Loss of Gastrokine-2 Drives Premalignant Gastric Inflammation and Tumor Progression
    Downloaded from http://www.jci.org on April 7, 2016. http://dx.doi.org/10.1172/JCI82655 The Journal of Clinical Investigation RESEAR CH AR TICLE Loss of gastrokine-2 drives premalignant gastric inflammation and tumor progression Trevelyan R. Menheniott,1,2 Louise O’Connor,1 Yok Teng Chionh,1 Jan Däbritz,1,2 Michelle Scurr,1 Benjamin N. Rollo,1 Garrett Z. Ng,1 Shelley Jacobs,1 Angelique Catubig,1 Bayzar Kurklu,1 Stephen Mercer,1 Toshinari Minamoto,3 David E. Ong,4 Richard L. Ferrero,5 James G. Fox,6 Timothy C. Wang,7 Philip Sutton,1,8 Louise M. Judd,1,2 and Andrew S. Giraud1,2 1Murdoch Children’s Research Institute, Melbourne, Victoria, Australia. 2Department of Paediatrics, University of Melbourne, Melbourne, Victoria, Australia. 3Division of Translational and Clinical Oncology, Cancer Research Institute, Kanazawa University, Kanazawa, Japan. 4University Medicine Cluster, Division of Gastroenterology and Hepatology, National University Hospital Singapore, Singapore. 5Centre for Innate Immunity and Infectious Diseases, Monash Institute of Medical Research, Monash University, Clayton, Victoria, Australia. 6Division of Comparative Medicine, Department of Biological Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts, USA. 7Division of Digestive and Liver Disease, Department of Medicine, Columbia University Medical Center, New York, New York, USA. 8Centre for Animal Biotechnology, School of Veterinary and Agricultural Science, University of Melbourne, Parkville, Victoria, Australia. Chronic mucosal inflammation is associated with a greater risk of gastric cancer (GC) and, therefore, requires tight control by suppressive counter mechanisms. Gastrokine-2 (GKN2) belongs to a family of secreted proteins expressed within normal gastric mucosal cells. GKN2 expression is frequently lost during GC progression, suggesting an inhibitory role; however, a causal link remains unsubstantiated.
    [Show full text]
  • Candidate Genes for Chromosomes 6 and 10: Quantitative Trait Loci for Age-Related Retinal Degeneration in Mice
    Biology Faculty Works Biology 6-5-2010 Candidate Genes for Chromosomes 6 and 10: Quantitative Trait Loci for Age-Related Retinal Degeneration in Mice D.G. Ogando Kam D. Dahlquist Loyola Marymount University, [email protected] M. Alizadeh K. Kunchithapautham J. Li See next page for additional authors Follow this and additional works at: https://digitalcommons.lmu.edu/bio_fac Part of the Biology Commons Recommended Citation Dahlqist, Kam [et al]. 2010. "Candidate genes for chromosomes 6 and 10 quantitative trait loci for age- related retinal degeneration in mice." Molecular Vision 16 (111-13): 1004-1018. This Article is brought to you for free and open access by the Biology at Digital Commons @ Loyola Marymount University and Loyola Law School. It has been accepted for inclusion in Biology Faculty Works by an authorized administrator of Digital Commons@Loyola Marymount University and Loyola Law School. For more information, please contact [email protected]. Authors D.G. Ogando, Kam D. Dahlquist, M. Alizadeh, K. Kunchithapautham, J. Li, N. Yu, M.M. LaVail, B. Rohrer, D. Vollrath, and M. Danciger This article is available at Digital Commons at Loyola Marymount University and Loyola Law School: https://digitalcommons.lmu.edu/bio_fac/20 Molecular Vision 2010; 16:1004-1018 <http://www.molvis.org/molvis/v16/a111> © 2010 Molecular Vision Received 26 November 2009 | Accepted 1 June 2010 | Published 5 June 2010 Candidate genes for chromosomes 6 and 10 quantitative trait loci for age-related retinal degeneration in mice Diego G. Ogando,1 Kam D. Dahlquist,1 Mitra Alizadeh,3 Kannan Kunchithapautham,2 Jun Li,3 Nicole Yu,1 Matthew M.
    [Show full text]
  • Evaluation of GKN1 and GKN2 Gene Expression As a Biomarker of Gastric Cancer
    Gastroenterology and Hepatology From Bed to Bench. BRIEF REPORT ©2018 RIGLD, Research Institute for Gastroenterology and Liver Diseases Evaluation of GKN1 and GKN2 gene expression as a biomarker of gastric cancer Fatemeh Dokhaee1, Sogol Mazhari2, Mohammad Galehdari1, Ayad Bahadori Monfared3, Kaveh Baghaei4 1 Faculty of Biological Sciences, North Tehran Branch, Islamic Azad University, Tehran, Iran 2 Basic and Molecular Epidemiology of Gastrointestinal Disorders Research Center, Research Institute for Gastroenterology and Liver Diseases, Shahid Beheshti University of Medical Science, Tehran, Iran 3 Faculty of Medicine, Shahid Beheshti University of Medical Sciences, Tehran, Iran 4 Gastroenterology and Liver Diseases Research Center, Research Institute for Gastroenterology and Liver Diseases, Shahid Beheshti University of Medical Sciences, Tehran, Iran ABSTRACT Aim: The aim of this study was to investigate the expression of GKN1 and GKN2 genes as probable biomarkers for gastric cancer. Background: Gastric cancer is a multifactorial process characterized by the uncontrolled growth and dissemination of abnormal cells. Survival rates of gastric cancer tend to be poor, a plausible explanation is a combination of a late-stage diagnosis and limited access to treatment. In this regard, finding relevant and measurable biomarkers is urgently needed. Methods: 27 samples of gastric cancer tissues were enrolled into this study, according to their pathological responses. The alteration of genes expression were evaluated by Real-Time PCR technique. Results: Our findings showed the significant reduction of Gastrokin-1 and Gastrokine-2 genes expression in the cancerous specimens in comparison with the normal tissues. (P = 0.008 and P = 0.004 respectively). Conclusion: Our findings showed the significant reduction of Gastrokin-1 and Gastrokine-2 genes expression in the cancerous specimens in comparison with the normal tissues.
    [Show full text]