Pedigree Insights

Total Page:16

File Type:pdf, Size:1020Kb

Pedigree Insights Andrew Caulfield, April 11, 2006–Bob and John P EDIGREE INSIGHTS Brother Derek, hero of the GI Santa Anita Derby, is a son of the California-based Benchmark, who stood for BY ANDREW CAULFIELD $5,000 in 2002, while Sweetnorthernsaint, a wide-margin winner of the GII Illinois Derby, is by the WOOD MEMORIAL S.-GI, $750,000, AQU, 4-8, 3yo, Florida-based Sweetsouthernsaint, who stood for 1 1/8m, 1:51 2/5, sy. $2,500 (one-hundredth of Seeking the Gold's fee). 1--sBOB AND JOHN, 123, c, 3, by Seeking the Gold Both these stallions are achieving more than could 1st Dam: Minister's Melody (GSW & GISP, reasonably be expected, and it's worth pointing out $451,470), by Deputy Minister that Sweetsouthernsaint, with only 91 named foals in his first two crops, has sired the Santa Anita Derby 2nd Dam: My Song for You, by Seattle Song second General John B. and King's Bishop S. third 3rd Dam: Too Bald, by Bald Eagle Better Than Bonds in addition to his Illinois Derby O/B-Stonerside Stable (KY); T-B Baffert; J-G Gomez; winner. $450,000. Lifetime Record: 9-4-1-3, $680,070. *1/2 But it is Bob and John who possesses the type of to Connie Belle (Storm Cat), SW, $129,830. pedigree one hopes to find in a Kentucky Derby winner. Click for the brisnet.com chart, the free brisnet.com This Stonerside homebred is now on offer at 8-1 with catalogue-style pedigree or the Video, sponsored by Ladbrokes, with Brother Derek at 3-1 and Barbaro, Taylor Made. Discreet Cat and Lawyer Ron also on offer at 8-1. However, most of the other European bookmakers have Saturday's Kentucky Derby trials highlighted exactly Bob and John between 10-1 and 14-1, with the longer why Thoroughbred breeding has such a wide range of odds reflecting the fact that Bob and John has five devotees. While the GI Wood Memorial was won by lengths to make up on Brother Derek from their meeting Bob and John, whose sire Seeking the Gold in the Hollywood Futurity four months ago. commanded a fee of $250,000 in 2002, the Derbys at These longer odds are possibly also a reflection of the Santa Anita and Hawthorne reminded everyone that recent record of Wood Memorial winners in the main event. Only one Wood winner--Fusaichi Pegasus (a you don't necessarily need bottomless reserves to Stonerside co-bred)--has gone on to win the Kentucky breed a live hope for Triple Crown honors. Derby since Pleasant Colony completed the double in The trials were also a reminder that you don't need to 1981 (but Empire Maker, Captain Bodgit and Easy Goer be based in Kentucky to produce a Kentucky Derby all found only one too good for them at Churchill candidate. Downs, and the Stonerside-bred Congaree was third). www.coolmore.com As Funny Cide, Monarchos and Go for Gin all warmed My Song For You was bred to stay reasonably well, up for their Derby victories with the runner's-up spot in as her dam Too Bald was also responsibly for Vaguely the Wood Memorial, perhaps we should be keeping a Noble's magnificent son Exceller, an 11-time Grade-I close eye on Saturday's second Jazil, who gave every winner from 1¼ miles to nearly two miles in Europe indication that he'll benefit from the extra 220 yards at and North America, as well as for the successful Churchill. stallion Baldski. The interesting link between Bob and John and Jazil Too Bald--a Broodmare of the Year--was another very is that they are both by Seeking the Gold (a runner-up good performer at up to 1 1/16 miles and the next dam in the Wood Memorial) out of daughters of Deputy is Hidden Talent, winner of the Kentucky Oaks and Minister. Ashland S. and sister to Heavenly Body, one of the best Fifteen months ago I tried to work out in this column juvenile fillies of 1959. Heavenly Body lives on as the why Seeking the Gold was having an unusually quiet third dam of the outstanding Arc winner Sakhee, while time. I added that "he probably represents a very Hidden Talent is the third dam of Broad Brush. This acceptable risk at his current fee," and suggested that winner of the 1986 Wood Memorial winner went on to there was every chance that he would bounce back. finish a creditable third in the Kentucky Derby. Don't be I'm pleased to say he is doing so. His impressive surprised if history comes close to repeating itself with daughter Pleasant Home put him back on the Grade-I Bob and John next month. map with her victory in the Breeders' Cup Distaff, and Seeking the Ante, Seeking Slew and Wanderin Boy also BOB AND JOHN, c, 2003 became graded winners in 2005. Now Bob and John Native Dancer Raise a Native and Jazil are leading a crop which sold for up to $1.8- Raise You Mr. Prospector million as yearlings. Nashua Gold Digger Coincidentally, Deputy Minister was another top-class Sequence Seeking the Gold stallion who inexplicably went off the boil. After siring a Tom Fool Buckpasser succession of Grade-I winners, including four in his Busanda Con Game 57-strong 1994 crop, Deputy Minister became Hasty Road Broadway champion sire in 1997 and 1998. Although his fee and Flitabout profile rose accordingly, he has come up with only one Northern Dancer Vice Regent Grade-I winner, in Canada, from his last eight crops of Victoria Regina Deputy Minister racing age. Minister’s Bunty’s Flight Mint Copy While Deputy Minister has been struggling as a sire, Melody Shakney GSW & GISP his reputation as a sire of broodmares has grown and Seattle Slew 4 Fls, 1 GSW, My Song for You Seattle Song grown, thanks to the Grade-I successes of such as 1 SW Incantation Sarava, Halfbridled, Redattore, Magistretti, Request For SP 9 Fls, 1 GSW Too Bald 13Fls, Bald Eagle Parole and Bahamian Pirate. His daughters have earned 1Ch, 3GSW, 2SW Hidden Talent him a top-five finish in each of the last four years, with only Mr. Prospector keeping him off the top in 2002 and 2003. The Deputy Minister mares responsible for Bob and John and Jazil--Minister's Melody and Better Than Honour--were both Grade I-placed stakes winners. Minister's Melody had a rather frustrating record, as she won only one stakes race, the GIII Arlington Heights Oaks, but was second in five others, including the GI La Brea. This pair aren't the first daughters of Deputy Minister to do well with a son of Mr. Prospector, previous graded-winning examples being Smart Strike's son Tenpins, Woodman's daughter Woodland Melody and Conquistador Cielo's son Lone Star Sky. I said earlier that Bob and John had a pedigree worthy of a Kentucky Derby winner. His dam was a $400,000 yearling, her appeal stemming partly from the fact that her dam, the stakes-placed My Song For You, was a three-parts sister to Capote. This champion juvenile, who became winter favorite for the Kentucky Derby following his Breeders' Cup Juvenile victory, was by Seattle Slew, whereas My Song For You (a dual winner on dirt and turf) is by Seattle Slew's son Seattle Song, a Grade-I winner at up to 1½ miles. .
Recommended publications
  • Welcometothe
    9 welcome to the ® CHAMPIONS AVENUE 8 BIG BARN ROAD JAY TRUMP ROAD 7 1 Visitor Center Gift Shop 5 Wrigley Media Theatre 4 6 2 International Museum of the Horse SGT RECKLESS 3 American Saddlebred Museum 4 Kids Barn 5 Horse Drawn Trolley Tours 6 Mounted Police Barn Breeds Barn 2 7 3 8 Big Barn 9 Hall of Champions 10 Iron Works Café (Temporarily Closed) 10a High Horizons Food Truck (Open 10am-3pm) 11 Playground 10a SECRETARIAT PARKING 12 Horseback Trail Rides & Pony Rides 1 (Reserve in Visitor Center) 10 11 12 DAILY SCHEDULE MAN O’ WAR 9-10 am Grooming at Barns 7 8 10:00 am Horse Drawn Trolley 5 For Emergencies Call Mounted Police 10:30 am Hall of Champions Show 9 859-509-1450 11:00 am Parade of Breeds Show 7 Equestrian competitions are temporarily closed to spectators. am Big Barn Stall-Side Chat 8 11:45 Enjoy your visit safely! Smoking is prohibited in Barns and Buildings. 1:15 pm Hall of Champions Show 9 Please stand a horse length 2:00 pm Parade of Breeds Show 7 4089 Iron Works Parkway, apart from others. Follow Us! Lexington, Kentucky 40511 2:45 pm Horse Drawn Trolley 5 Masks are required 800-678-8813 in buildings and barns. 3:30 pm Derby Winner Nightcap 9 KyHorsePark.com #KYHORSEPARK KENTUCKY HORSE PARK DAILY SCHEDULE EXPLORE EQUINE HISTORY OPEN WEDNESDAY–SUNDAY, 9 AM TO 5 PM Morning Grooming 7 8 9-10 am Kick off your visit at the Breeds Barn and Big Barn to see the KHP equine team grooming horses and International Museum of the Horse preparing for the day! With over 60,000 square feet, IMH is dedicated Horse Drawn Trolley 5 to the history of the horse and its unique relationship with humans through time.
    [Show full text]
  • Lemon Tiger Barn 5 Hip No. 11
    Consigned by Preferred Equine, Agent Barn Lemon Tiger Hip No. 5 11 Storm Bird Storm Cat .......................... Terlingua Hold That Tiger ................ Caveat Lemon Tiger Beware of the Cat .............. Chestnut Mare; T. C. Kitten foaled 2007 Kingmambo Lemon Drop Kid ................ Charming Lassie Lemon Drop's Love .......... (2002) Pilgrim Ginny Dare ........................ Seven Arts By HOLD THAT TIGER (2000). European champion, black-type winner of $644,235, Grand Criterium-Lucien Barriere [G1], etc. Sire of 9 crops, 18 black-type winners, 1 champion, $27,993,792, including Smiling Tiger ($1,480,704, Bing Crosby S. [G1] (DMR, $150,000), etc.), Jungle Wave [G2] ($689,291). Sire of dam of black-type winner Spiritus. 1st dam LEMON DROP'S LOVE, by Lemon Drop Kid. Unplaced in 1 start. Dam of 6 other foals, 5 to race, 3 winners-- LOVELY SYN (f. by Freud). 4 wins in 4 starts at 3, $202,200, Bouwerie S.- R (BEL, $75,000), New York Stallion S.-R (BEL, $60,000). Shotgun Love (f. by Posse). 3 wins at 4 and 5, 2016, $167,317. Mightylover (g. by Catienus). 5 wins, 3 to 5, $81,128. Love Blues (f. by Bluegrass Cat). Placed at 3, 2016, $6,089. 2nd dam Ginny Dare , by Pilgrim. 3 wins to 5, $132,521, 2nd Spicy Living H. [G3] , 3rd New York H. [G2] . Sister to LYKATILL HIL ($893,270, Del Mar Budweiser Breeders' Cup H. [G2] , etc.), half-sister to CLASSIC ACCOUNT (5 wins in 10 starts, $289,713, Week of Fame Fortune H. [G3] , etc., sire), Came- roon [G3] ($138,674), Art of Dawn (10 wins, $195,710).
    [Show full text]
  • 31 Shades (& Counting) of Derby Gray
    MONDAY, APRIL 26, 2021 CADDO RIVER OUT OF DERBY 31 SHADES (& COUNTING) Shortleaf Stable's 'TDN Rising Star' Caddo River (Hard Spun) OF DERBY GRAY will not make the line-up for Saturday's GI Kentucky Derby after spiking a fever over the weekend. AWe noticed he was off his feed and took his temperature yesterday afternoon. It was slightly elevated,@ trainer Brad Cox said. AIt=s just really bad timing being this close to the Derby. We drew blood on him [Sunday] morning and his white cell counts were a little high. We just can=t run him on Saturday with being a little off his game.@ The defection of the GI Arkansas Derby runner-up will allow GII Remsen S. winner Brooklyn Strong (Wicked Strong) to enter the Derby field. The Mark Schwartz colorbearer, most recently fifth in the Apr. 3 GII Wood Memorial, is scheduled to work at Parx Monday morning for trainer Daniel Velazquez and could ship into Churchill Downs Tuesday morning if all goes well. After sending his Derby quartet out to jog Sunday morning, trainer Todd Pletcher announced a Derby rider for Sainthood Giacomo | Horsephotos (Mshawish). Cont. p6 The Week in Review, by T.D. Thornton IN TDN EUROPE TODAY Gray horses have been in a GI Kentucky Derby rut the past 15 years. No fewer than 31 consecutive grays (or roans) have gone BARON SAMEDI TAKES THE VINTAGE CROP to post without winning on the first Saturday in May (or Baron Samedi won his sixth straight race and stamped himself a potential star of the staying ranks with a win in Sunday’s G3 September) since Giacomo roared home in front at 50-1 in 2005.
    [Show full text]
  • 88 Consigned by Gainesway, Agent VI Dark Bay Or Brown Filly
    Hip No. Barn 6 88 Consigned by Gainesway, Agent VI Dark Bay or Brown Filly Indian Charlie . In Excess (IRE) Uncle Mo . {Soviet Sojourn {Playa Maya . Arch Dark Bay/Br. Filly . {Dixie Slippers May 4, 2020 Seeking the Gold . Mr. Prospector {Enth . {Con Game (2003) {Limit . Cox’s Ridge {Bound By UNCLE MO (2008), [G1] $1,606,000, champion. Sire of 7 crops, 71 black type wnrs, 3 champions, $67,663,189, including Nyquist [G1] ($5,189,- 200) and Unbridled Mo [G1] ($1,067,880), Bast [G1] ($852,200), Mo For- za [G1] ($734,460), Outwork [G1] ($701,800), Dream Tree [G1] ($529,- 845), Mo Town [G1] ($519,600), Gomo [G1], Mopotism [G2] ($876,090). 1st dam ENTH, by Seeking the Gold. Winner at 2, $30,135. Dam of 9 foals of racing age, including a 2-year-old of 2021, seven to race, 6 winners, including-- SOWER (f. by Flatter). 4 wins at 3, $299,890, Jersey Girl S. [L] (BEL, $90,000), Pumpkin Pie S. (BEL, $55,000), 2nd Interborough S. [L] (AQU, $21,000), 3rd Charles Town Oaks [G3] (CT, $29,400), Victory Ride S. [G3] (BEL, $15,000), Garland of Roses S. [L] (AQU, $12,600). VAST (f. by Lea). 2 wins at 2, placed at 3, 2020, $120,910, Hollywood Wildcat S. (MTH, $45,000). Apex (g. by Dynaformer). 5 wins at 3 and 4, $231,256. 2nd dam LIMIT, by Cox’s Ridge. 3 wins at 2 and 3, $84,483, Busanda S. [L] (AQU, $32,640), 3rd Busher Breeders’ Cup S. [G3]. Dam of 6 winners, incl.-- CEASE (g.
    [Show full text]
  • WILL HE >JUSTIFY= the HYPE?
    SATURDAY, APRIL 7, 2018 BLUE GRASS COULD BE WHITE OUT WILL HE >JUSTIFY= Assuming a potential snowstorm Friday night doesn=t put a THE HYPE? damper on things, a full field is set to go postward in Saturday=s GII Toyota Blue Grass S. The conversation about contenders must start with $1-million KEESEP yearling Good Magic (Curlin), who broke his maiden emphatically in the GI Breeders= Cup Juvenile at Del Mar en route to Eclipse Award honors. Heavily favored in the GII Xpressbet Fountain of Youth on seasonal debut at Gulfstream Mar. 3, he settled for a non-threatening third with no obvious excuse. Flameaway (Scat Daddy), second in the Mar. 10 GII Tampa Bay Derby behind expected scratch Quip (Distorted Humor) after annexing the GIII Sam F. Davis S. there in February, took a rained-off renewal of the GIII Bourbon S. in the Keeneland slop last October. Cont. p3 Justify | Benoit Photo IN TDN EUROPE TODAY ASTUTE AGENT HAS GLOBAL PERSPECTIVE >TDN Rising Star= Justify (Scat Daddy), almost certainly the Kelsey Riley sat down with Australia based Frenchman most highly regarded horse in the world to have not yet taken Louis Le Metayer to get his thoughts on various aspects of on stakes company, will get his class test on Saturday when he the Australian racing scene. Click or tap here to go straight faces the likes of MGISW Bolt d=Oro (Medaglia d=Oro) in the to TDN Europe. GI Santa Anita Derby. A 9 1/2-length jaw-dropping debut winner going seven panels here Feb.
    [Show full text]
  • MJC Media Guide
    2021 MEDIA GUIDE 2021 PIMLICO/LAUREL MEDIA GUIDE Table of Contents Staff Directory & Bios . 2-4 Maryland Jockey Club History . 5-22 2020 In Review . 23-27 Trainers . 28-54 Jockeys . 55-74 Graded Stakes Races . 75-92 Maryland Million . 91-92 Credits Racing Dates Editor LAUREL PARK . January 1 - March 21 David Joseph LAUREL PARK . April 8 - May 2 Phil Janack PIMLICO . May 6 - May 31 LAUREL PARK . .. June 4 - August 22 Contributors Clayton Beck LAUREL PARK . .. September 10 - December 31 Photographs Jim McCue Special Events Jim Duley BLACK-EYED SUSAN DAY . Friday, May 14, 2021 Matt Ryb PREAKNESS DAY . Saturday, May 15, 2021 (Cover photo) MARYLAND MILLION DAY . Saturday, October 23, 2021 Racing dates are subject to change . Media Relations Contacts 301-725-0400 Statistics and charts provided by Equibase and The Daily David Joseph, x5461 Racing Form . Copyright © 2017 Vice President of Communications/Media reproduced with permission of copyright owners . Dave Rodman, Track Announcer x5530 Keith Feustle, Handicapper x5541 Jim McCue, Track Photographer x5529 Mission Statement The Maryland Jockey Club is dedicated to presenting the great sport of Thoroughbred racing as the centerpiece of a high-quality entertainment experience providing fun and excitement in an inviting and friendly atmosphere for people of all ages . 1 THE MARYLAND JOCKEY CLUB Laurel Racing Assoc. Inc. • P.O. Box 130 •Laurel, Maryland 20725 301-725-0400 • www.laurelpark.com EXECUTIVE OFFICIALS STATE OF MARYLAND Sal Sinatra President and General Manager Lawrence J. Hogan, Jr., Governor Douglas J. Illig Senior Vice President and Chief Financial Officer Tim Luzius Senior Vice President and Assistant General Manager Boyd K.
    [Show full text]
  • Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes
    Northern Dancer 90th May 2, 1964 THE WINNER’S PEDIGREE AND CAREER HIGHLIGHTS Pharos Nearco Nogara Nearctic *Lady Angela Hyperion NORTHERN DANCER Sister Sarah Polynesian Bay Colt Native Dancer Geisha Natalma Almahmoud *Mahmoud Arbitrator YEAR AGE STS. 1ST 2ND 3RD EARNINGS 1963 2 9 7 2 0 $ 90,635 1964 3 9 7 0 2 $490,012 TOTALS 18 14 2 2 $580,647 At 2 Years WON Summer Stakes, Coronation Futurity, Carleton Stakes, Remsen Stakes 2ND Vandal Stakes, Cup and Saucer Stakes At 3 Years WON Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’s Plate 3RD Belmont Stakes Horse Eq. Wt. PP 1/4 1/2 3/4 MILE STR. FIN. Jockey Owner Odds To $1 Northern Dancer b 126 7 7 2-1/2 6 hd 6 2 1 hd 1 2 1 nk W. Hartack Windfields Farm 3.40 Hill Rise 126 11 6 1-1/2 7 2-1/2 8 hd 4 hd 2 1-1/2 2 3-1/4 W. Shoemaker El Peco Ranch 1.40 The Scoundrel b 126 6 3 1/2 4 hd 3 1 2 1 3 2 3 no M. Ycaza R. C. Ellsworth 6.00 Roman Brother 126 12 9 2 9 1/2 9 2 6 2 4 1/2 4 nk W. Chambers Harbor View Farm 30.60 Quadrangle b 126 2 5 1 5 1-1/2 4 hd 5 1-1/2 5 1 5 3 R. Ussery Rokeby Stables 5.30 Mr. Brick 126 1 2 3 1 1/2 1 1/2 3 1 6 3 6 3/4 I.
    [Show full text]
  • February 2013 Monthly Report
    Permit No. Issue Date Permit Type # Units Address Lot # Total Paid Appl. Value Project/Subdivision Jurisdiction General Contractor Electrical Contractor HVAC Contractor 13010164 2/1/2013 COMADD 6072 LIMABURG RD N/A $150.00 $5,000.00 LUCKY DUCK PUB (WALKIN COOLER) BOONE HERMES CONSTRUCTION CO SHANK ELECTRICAL CONTRACTING 13010177 2/1/2013 SFR 1 2586 TWIN HILLS CT 50 $660.00 $288,091.00 REDSTONE VILLAGE (LOT 50) BOONE THE DREES CO QUINN ELECTRIC CORP 13010179 2/1/2013 BARN 3305 BELLVIEW RD $50.00 $15,667.00 36 X 45 POLE BARN BOONE 12100246 2/4/2013 COMMERCIAL 7852 MALL ROAD N/A $1,500.00 $900,000.00 BJ'S RESTAURANT FLORENCE LPM ELECTRIC INC 13010190 2/4/2013 SFR 1 10286 CEDARWOOD DR 903 $360.00 $115,000.00 CEDARWOOD (LOT 903) BOONE SAULEY HOMES LLC SARGENT ELECTRIC LLC 13010207 2/4/2013 HVAC 1329 OXLEY CT 21 $125.00 $10,253.00 EQUSTRIAN @ TRIPLE CROWN (LOT 21) BOONE CRANE HEATING & AIR INC 13010208 2/4/2013 HVAC 943 CANNONADE CT 8 $75.00 $5,742.00 WHIRLAWAY RUN @ TRIPLE CROWN (LOT 8) BOONE CRANE HEATING & AIR INC 13010209 2/4/2013 HVAC 843 HANCOCK CT 16 $75.00 $5,632.00 GATO DEL SOL @ TRIPLE CROWN (LOT 16) BOONE CRANE HEATING & AIR INC 13010210 2/4/2013 HVACREPLC 10263 CEDARWOOD DR $75.00 $2,500.00 HVAC REPLACEMENT BOONE THOMPSON HEATING CORP 13020003 2/4/2013 HVACREPLC 1495 PRODUCTION DR N $225.00 $10,167.00 BLUEGRASS ELECTRIC CONSULTANTS BOONE BLAIN RYAN ENTERPRISES INC 13020005 2/4/2013 HVAC 10613 PEGASUS CT 39 $75.00 $7,500.00 TRIPLE CROWN (LOT 39) BOONE ARRONCO COMFORT AIR INC 13020006 2/4/2013 HVACREPLC 737 BRITTANY TRAIL $75.00 $19,300.00
    [Show full text]
  • Preakness Stakes .Fifty-Three Fillies Have Competed in the Preakness with Start in 1873: Rfive Crossing the Line First The
    THE PREAKNESS Table of Contents (Preakness Section) History . .P-3 All-Time Starters . P-31. Owners . P-41 Trainers . P-45 Jockeys . P-55 Preakness Charts . P-63. Triple Crown . P-91. PREAKNESS HISTORY PREAKNESS FACTS & FIGURES RIDING & SADDLING: WOMEN & THE MIDDLE JEWEL: wo people have ridden and sad- dled Preakness winners . Louis J . RIDERS: Schaefer won the 1929 Preakness Patricia Cooksey 1985 Tajawa 6th T Andrea Seefeldt 1994 Looming 7th aboard Dr . Freeland and in 1939, ten years later saddled Challedon to victory . Rosie Napravnik 2013 Mylute 3rd John Longden duplicated the feat, win- TRAINERS: ning the 1943 Preakness astride Count Judy Johnson 1968 Sir Beau 7th Fleet and saddling Majestic Prince, the Judith Zouck 1980 Samoyed 6th victor in 1969 . Nancy Heil 1990 Fighting Notion 5th Shelly Riley 1992 Casual Lies 3rd AFRICAN-AMERICAN Dean Gaudet 1992 Speakerphone 14th RIDERS: Penny Lewis 1993 Hegar 9th Cynthia Reese 1996 In Contention 6th even African-American riders have Jean Rofe 1998 Silver’s Prospect 10th had Preakness mounts, including Jennifer Pederson 2001 Griffinite 5th two who visited the winners’ circle . S 2003 New York Hero 6th George “Spider” Anderson won the 1889 Preakness aboard Buddhist .Willie Simms 2004 Song of the Sword 9th had two mounts, including a victory in Nancy Alberts 2002 Magic Weisner 2nd the 1898 Preakness with Sly Fox “Pike”. Lisa Lewis 2003 Kissin Saint 10th Barnes was second with Philosophy in Kristin Mulhall 2004 Imperialism 5th 1890, while the third and fourth place Linda Albert 2004 Water Cannon 10th finishers in the 1896 Preakness were Kathy Ritvo 2011 Mucho Macho Man 6th ridden by African-Americans (Alonzo Clayton—3rd with Intermission & Tony Note: Penny Lewis is the mother of Lisa Lewis Hamilton—4th on Cassette) .The final two to ride in the middle jewel are Wayne Barnett (Sparrowvon, 8th in 1985) and MARYLAND MY Kevin Krigger (Goldencents, 5th in 2013) .
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • Our Emblem--Sweetest Lady, by Lord at P P War {Arg}), Who Won the Kentucky Derby and Preakness S
    Smok’n Frolic in Pedigree Perspectives HEADLINE p. 2 NEWS For information about TDN, DELIVERED EACH NIGHT call 732-747-8060. BY FAX AND INTERNET www.thoroughbreddailynews.com WEDNESDAY, MARCH 26, 2003 BREEDING WOES FOR WAR EMBLEM DUBAI WORLD CUP War Emblem (Our Emblem--Sweetest Lady, by Lord at P P War {Arg}), who won the Kentucky Derby and Preakness S. en route to BELLE DU JOUR BREEZES Australian sprinter Belle winning the Eclipse Award du Jour (Aus) (Dehere) zipped through 800 meters as champion three-year-old under the lights early yesterday colt, is having difficulties morning at Nad al Sheba, stopping covering mares in his first the clock in :46.91. Jockey Len year at stud at Shadai Stal- Beasley, who will ride the mare in lion Station on the Japanese Saturday’s G1 Dubai Golden island of Hokkaido, accord- Shaheen, flew in from Sydney for the ing to The Blood-Horse. Sold workout. Trainer Clarrie Connors said to the Yoshida family last that Belle du Jour was 100 percent, but acknowledges September for a reported that she will face stiff opposition from the American $18 million, War Emblem contingent. “They go so hard and mostly they keep has been reluctant to cover going,” he commented. “We will give them a start and I mares at Shadai since the hope the mare can avoid the backwash of the dirt start of the 2003 breeding kicked up by the leaders.” season and has managed to get only five mares in foal Hard Buck (Brz) (Spend a Buck) blew out 600 meters War Emblem Horsephotos as of Mar.
    [Show full text]
  • 2019 Media Guide July 17 - Sept 2 & Nov 8 - Dec 1
    2019 MEDIA GUIDE JULY 17 - SEPT 2 & NOV 8 - DEC 1 2019 Media Guide 1 Del Mar Stakes Schedule – 80th Summer Season – 2019 Date Event Conditions Distance Purse Wed. Jul 17 OCEANSIDE STAKES Three-year-olds, N/W S/S of $50,000 at 1 M o/o 1 Mile (Turf) $100,000 A in 2019 Thu. Jul 18 FLEET TREAT STAKES Fillies, Three-year-olds, Cal-Bred 7 Furlongs $150,000 G Fri. Jul 19 Osunitas Stakes Fillies & Mares, Three-year-olds & up, N/W S/S 1 1/16 Miles (Turf) $85,000 A $50,000 at 1 M o/o since September 1 Sat. Jul 20 SAN DIEGO HANDICAP (Gr. II) Three-year-olds & up 1 1/16 Miles $200,000 G Sat. Jul 20 SAN CLEMENTE STAKES (Gr. II) Fillies, Three-year-olds 1 Mile (Turf) $200,000 G Sat. Jul 20 Daisycutter Handicap Fillies & Mares, Three-year-olds & up 5 Furlongs (Turf) $85,000 A Sun. Jul 21 EDDIE READ STAKES (Gr. II) Three-year-olds & up 1 1/8 Miles (Turf) $250,000 G Sun. Jul 21 Wickerr Stakes Three-year-olds & up, N/W S/S $50,000 at 1 M 1 Mile (Turf) $85,000 A o/o since September 1 Wed. Jul 24 COUGAR II HANDICAP (Gr. III) Three-year-olds & up 1 1/2 Miles $100,000 G Fri. Jul 26 CALIFORNIA DREAMIN' STAKES Three-year-olds & up, Cal-Bred 1 1/16 Miles (Turf) $150,000 G Sat. Jul 27 REAL GOOD DEAL STAKES Three-year-olds, Cal-Bred 7 Furlongs $150,000 G Sat.
    [Show full text]