Product datasheet Anti-NAA15 Antibody Catalog Number: A05636-1

BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China

Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]

Basic Information Product Name Anti-NAA15 Antibody Name NAA15 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ，0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid. Purification Immunogen affinity purified. Observed MW 101KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user.

Storage 12 months from date of receipt，-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing

Background Information NMDA receptor-regulated 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to 4. NARG1 is the auxiliary subunit of the NatA (Nα-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the in yeast (via the ribosomal , uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.

Reference

Anti-NAA15 Antibody被引用在0文献中。

暂无引用

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-NAA15 Antibody Catalog Number: A05636-1

BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China

Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]

Selected Validation Data

Figure 1. Western blot Figure 2. IHC analysis of analysis of NARG1 using NARG1 using anti- anti-NARG1 antibody NARG1 antibody (A05636-1). lane 1: 293T (A05636-1).NARG1 was whole cell lysates. anti- detected in paraffin- NARG1 antigen affinity embedded section of purified polyclonal mouse intestine tissues. antibody (Catalog # anti-NARG1 Antibody A05636-1)probed with a (A05636-1) . Biotinylated goat anti-rabbit IgG-HRP goat anti-rabbit IgG was secondary antibody The used as secondary signal is developed using antibody . The tissue an Enhanced section was developed Chemiluminescent using Strepavidin-Biotin- detection (ECL) kit Complex (SABC)(Catalog (Catalog # EK1002) . A # SA1022) with DAB as specific band was the chromogen. detected for NARG1 at approximately 101KD. The expected band size for NARG1 is at 101KD.

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2

Powered by TCPDF (www.tcpdf.org)