PEN FLORIDA WORLD MISSIONS MISSIONS RESOURCE AS TAKEN FROM ASSEMBLIES OF GOD WORLD MISSIONS WEBSITE ! Table of Contents
Building Missions In the Local Church Checklist………………..A Building Missions Leadership……………………………………..B Building Missions Support………………………...……………….C Building Missions Vision……………………………….…………..D Building Missions Effectiveness Through Intercessory Prayer………………………………………………...E Building Missions Partnership Through the Missionary Visit……………………………………………………..F Missions Convention Planner……………………………………..G
For more information please contact Thomas Manning [email protected] www.pfwmorg
Building Missions In the Local Church Checklist
A. $VVHPEOLHVRI*RG:RUOG
&217(176 6WHS±%XLOGLQJ0LVVLRQV/HDGHUVKLSLQWKH/RFDO&KXUFK 6WHS±%XLOGLQJ0LVVLRQV6XSSRUWZLWKDQ $QQXDO0LVVLRQV&RQYHQWLRQ 6WHS±%XLOGLQJ0LVVLRQV0RQWKE\0RQWK 6WHS±%XLOGLQJ0LVVLRQV(IIHFWLYHQHVV 7KURXJK3UD\HU 6WHS±%XLOGLQJ0LVVLRQV3DUWQHUVKLS 7KURXJKWKH0LVVLRQDU\9LVLW
,1752'8&7,21 5HDFKLQJWKHZRUOGZLWKWKH*RVSHOLVQRWDQLPSRVVLELOLW\,ILWZHUH-HVXVZRXOG QHYHUKDYHJLYHQXVWKH*UHDW&RPPLVVLRQ%XWLWGRHVUHTXLUHFRPPLWPHQW WRWKHWDVN/HDGLQJDFRQJUHJDWLRQLQDVVXPLQJWKHLUUHVSRQVLELOLW\WRVXSSRUW PLVVLRQVLVQRWUHDOO\WKDWGLI¿FXOW,WGRHVKRZHYHUUHTXLUHFRQVLVWHQF\ 7KURXJKWKH\HDUV,KDYHREVHUYHGWKDWLQHYHU\FKXUFKWKDWH[FHOVLQPLVVLRQV WKHUHDUH¿YHHOHPHQWVWKDWVHHPWREHFRPPRQWRDOO7KHUHDUHPDQ\WKLQJV WKDWDUHKHOSIXOLQEXLOGLQJPLVVLRQVEXWWKH\PD\QRWEHZLWKLQWKHUHDFKRIHYHU\ FKXUFKVRWKH\FDQQRWEHFRQVLGHUHGHVVHQWLDO 7KHVH¿YHHOHPHQWVDUHQRWXQLTXHWRODUJHFKXUFKHVDQGWKH\DUHQRWRXWRI UHDFKIRUVPDOOFKXUFKHV,QRWKHUZRUGVZLWKWKHVH¿YHVWHSVDQ\VL]HFKXUFK FDQEXLOGDVXFFHVVIXOPLVVLRQVRXWUHDFK :LWKWKLVLQPLQG,KDYHSUHSDUHGWKH%OXHSULQW6HULHVFRQVLVWLQJRI¿YHPDQXDOV ZKLFKDGGUHVVWKH¿YHHVVHQWLDOHOHPHQWVIRUEXLOGLQJPLVVLRQV7KHVHYROXPHV DUHSUHSDUHGWRDVVLVWWKHSDVWRUDQGPLVVLRQVWHDPZLWKVWHSE\VWHSLQIRUPDWLRQ LQHDFKRIWKHVHFULWLFDODUHDV ,WEHFDPHREYLRXVWKDWZHFRXOGQRWXVH¿YHPDQXDOVDVDWH[WIRUWKHVHZRUNVKRSV WKXVWKHFXUUHQWPDQXDOZDVERUQ7KLVPDQXDOLVDGLJHVWRIWKH¿YHPDQXDOV PDNLQJLWSRVVLEOHWRGLVWULEXWHLQZRUNVKRSVDVDWH[WIRUWKHFODVVHVRIIHUHG 7KHFKDSWHUKHDGLQJVIRUWKLVGLJHVWDUHWKHDFWXDOWLWOHVRIWKH¿YHPDQXDOV ZKLFKPD\EHRUGHUHGIURP$VVHPEOLHVRI*RG:RUOG0LVVLRQV
67(3 %8,/',1*0,66,216/($'(56+,3,17+(/2&$/&+85&+
3$6725<28$5(7+(.(<7KHSDWK\RXFKRRVHZLOOGHWHUPLQHZKHUHWKH FRQJUHJDWLRQJRHV:LOO\RXUSHRSOHEHFRPH³*UHDW&RPPLVVLRQ&KULVWLDQV´",W DOOGHSHQGVRQ\RX $0,66,2167($0:,//+(/3<28OHDG\RXUFRQJUHJDWLRQLQWRREHGLHQFH WR&KULVW¶VFRPPDQG³*RLQWRDOOWKHZRUOGDQGSUHDFKWKH*RRG1HZVWRDOO FUHDWLRQ´,WKDVEHHQVDLGWKDW³QRVWUHDPULVHVKLJKHUWKDQLWVVRXUFH´DQGLWLV WUXHWKDWIHZFRQJUHJDWLRQVZLOOULVHEH\RQGWKHLUSDVWRULQVSLULWXDOGHSWK :+<&$//,7$7($0" • %HFDXVHWKHZRUG³FRPPLWWHH´VXJJHVWVSHRSOHVLWWLQJDWDWDEOHWDONLQJ WDONLQJWDONLQJ • 7KHZRUG³WHDP´VXJJHVWV ±([FLWHPHQWDQGHQWKXVLDVP ±&RRSHUDWLRQRUZRUNLQJWRJHWKHU ±:LQQLQJRUSRVLWLYHDWWLWXGH • 7KDWLVZKDWPLVVLRQVLVDOODERXW :+<+$9($0,66,2167($0" • :HDFFRPSOLVKPRUHWKURXJKGHOHJDWLRQ • 0RUHSHRSOHJHWLQYROYHGLQ*RG¶VZRUN • &ULWLFLVPLVPLQLPL]HGZKHQSHRSOHWDNHRZQHUVKLSRIWKHZRUN • 7KHFKXUFKERDUGFDQQRWGHYRWHWKHQHFHVVDU\WLPHWRPLVVLRQV +2:/$5*(6+28/'7+(7($0%(" • ,WPD\EHDVVPDOODVWKUHHWR¿YHPHPEHUV • )RUPDQ\FKXUFKHVWKLVZLOOEHDQLGHDOQXPEHU • 4XDOLW\LVSUHIHUUHGRYHUTXDQWLW\ • ,WZLOOEHHDVLHUWR¿QGDIHZTXDOL¿HGPHPEHUVHYHQLQWKHVPDOOHU FKXUFK • 7KHODUJHUFKXUFKZLOOQHHGPRUHWHDPPHPEHUVIRUWKHDGGHG UHVSRQVLELOLWLHV • ,WZLOOEHPRUHGLI¿FXOWIRUDOOLWVPHPEHUVWRPHHWDWWKHVDPHWLPH • ,QWKLVFDVHDVPDOOH[HFXWLYHWHDPVKRXOGFRQGXFWPRQWKO\EXVLQHVV 48$/,),&$7,216)257($00(0%(566+28/'%( • &KXUFKPHPEHULQJRRGVWDQGLQJ • )DLWKIXOLQDWWHQGDQFHDQGWLWKLQJ • 0XVWEHZLOOLQJWRGHYRWHKRXUVPRQWKO\ • 'RQ¶WRYHUORRNWKH\RXWK±WKH\ZLOOEH,HDGLQJWRPRUURZ • ,QFOXGHUHWLUHHV±WKH\W\SLFDOO\KDYHPRUHIUHHWLPH
($&+0(0%(50867+$9($+($577+$7%($76:,7+$3$66,21 )257+(/267 • 'RWKH\ORYHWKHORVW" • 'RWKH\ORYHPLVVLRQVDQGPLVVLRQDULHV" • $UHWKH\FRQVXPHGZLWKPLVVLRQV"
$&223(5$7,9(63,5,7,65(48,5(' • 7KH\PXVWZRUNDVDWHDP • 7KHUHLVQRSODFHIRUD³/RQH5DQJHU´ • 8QLW\LQWKHWHDPVHWVDQH[DPSOHIRUWKHFRQJUHJDWLRQ
7+(<0867%(*(1(5286,17+(,50,66,216*,9,1* • 7KH\PXVWEHUHJXODULQWKHLUPRQWKO\)DLWK3URPLVHJLYLQJ • *HQHURXVLQRWKHUPLVVLRQVDSSHDOV • 1RRQHVKRXOGPDNHGHFLVLRQVFRQFHUQLQJPLVVLRQVIXQGVLIWKH\DUH QRWJHQHURXVJLYHUV
+2:6+28/'7+(0(0%(56%(6(/(&7('" • ,WFRXOGEHE\HOHFWLRQ ±%XWWKLVHQGVXSEHLQJDSRSXODULW\FRQWHVW ±7KLVFRXOGUHVXOWLQHOHFWLQJPHPEHUVZKRFDUHOLWWOHIRUPLVVLRQV • ,WPD\EHYROXQWDU\ ±7KH\PD\EHHQWKXVLDVWLFDWWKHPRPHQWEXWODFNFRPPLWPHQW ±7KDWFRXOGUHVXOWLQPHPEHUVZKRODFNWKHQHFHVVDU\TXDOL¿FDWLRQV • ,WPD\EHE\DSSRLQWPHQW ±7KLVLVWKHEHVWPHWKRGDQGRIIHUVDQXPEHURIDGYDQWDJHV ±,WDOORZVFKRRVLQJSHRSOHZKRDUHFRPPLWWHGWRPLVVLRQV
'85,1*7+(7($06)250$7,21 • 7KHSDVWRUFRXOGQRPLQDWHWKHPHPEHUV • 7KRVHQRPLQDWLRQVFRXOGEHDSSURYHGE\WKHFKXUFKERDUG • ,WPLJKWEHDGYLVDEOHWRNHHSWKHWHDPVPDOOZKLOHLQIRUPDWLRQ • $GGLWLRQDOPHPEHUVFDQDOZD\VEHDGGHGODWHUDVQHHGHG
21&(7+(7($0+$6%((1)250(' • 7KHWHDPFRXOGQRPLQDWHIXWXUHPHPEHUV • 7KHVHQRPLQDWLRQVFRXOGEHWDNHQWRWKHSDVWRUDQGFKXUFKERDUGIRU ¿QDODSSURYDO
+2:/21*6+28/'($&+0(0%(56(59(" • \HDULVWRRVKRUW
• WR\HDUVLVPRUHDGHTXDWHZLWKWKHSRVVLELOLW\RIVHUYLQJVXFFHVVLYH WHUPV • 7HUPVVKRXOGEHVWDJJHUHGWRLQVXUHWKDWH[SHULHQFHGPHPEHUVZLOO DOZD\VKDYHDYRLFHLQGHFLVLRQV
$6$7($07+(<6+$//$'0,1,67(5$//0,66,216)81'6 • 0LVVLRQVIXQGVPD\EHNHSWLQDVHSDUDWHEDQNDFFRXQWRULQWKH FKXUFK¶VJHQHUDOEDQNDFFRXQW • $VHSDUDWHDFFRXQWLQJRIPLVVLRQVIXQGVPXVWDOZD\VEHPDLQWDLQHG • 7KHVHIXQGVVKRXOGQHYHUEHERUURZHGRUFRPLQJOHGZLWKRWKHUIXQGV • 'HFLVLRQVFRQFHUQLQJPRQWKO\FRPPLWPHQWVIRUPLVVLRQDU\VXSSRUW • 5HVSRQVHVWRXUJHQW¿QDQFLDODSSHDOVIRURQHWLPHDVVLVWDQFHIROORZLQJ ÀRRGVHDUWKTXDNHVHWF • 5HVSRQVHVWRFDVKDSSHDOVIRUSURMHFWVIRUEXLOGLQJVODQGHWF • %LUWKGD\DQG&KULVWPDVJLIWVWRWKHPLVVLRQDULHVEHLQJVXSSRUWHG • 2IIHULQJVDWPLVVLRQVDFWLYLWLHVIRUPLVVLRQDULHVDQGRWKHUVSHDNHUV • 7KHDOORFDWLRQRIIXQGVIRUDQDQQXDOPLVVLRQVFRQYHQWLRQDQGUHODWHG DFWLYLWLHV • $SSRLQWPHQWRIDPLVVLRQVWUHDVXUHUWRPDNHDOOPRQWKO\GLVEXUVHPHQWV RIPLVVLRQVIXQGV
7+(7($06(59(6$6$/,1.%(7:((17+(0,66,21$5,(6$1'7+( &21*5(*$7,21 • 7KH\ZLOOFRPPXQLFDWHZLWKWKHPLVVLRQDULHVE\HPDLOHVSHFLDOO\ FRQFHUQLQJSUD\HUQHHGV • 7KH\ZLOOFUHDWHD¿OHRIHDFKRIWKHPLVVLRQDULHVOHWWHUVDQGLQIRUPDWLRQ UHFHLYHG • 7KH\ZLOOVKDUHWKHSUD\HUQHHGVZLWKWKHFRQJUHJDWLRQ
7+(7($0:,//0$,17$,1$1$775$&7,9(0,66,216',63/$< • ,WVKRXOGEHORFDWHGLQDZHOOOLJKWHGZHOOWUDI¿FNHGDUHD • 1DPHRQHRUWZRSHRSOHZLWKDUWLVWLFDELOLW\WRNHHSWKHGLVSOD\ XSGDWHG • 'LVSOD\FXULRVFROOHFWHGIURPPLVVLRQDULHVDQGRYHUVHDVWULSV • ,QFOXGHDPLVVLRQVEXOOHWLQERDUG • 'LVSOD\WKHFHUWL¿FDWHVIRUPLVVLRQDULHVVXSSRUWHGE\WKHFKXUFK
7+(7($0:,//3/$17+(0,66,216&219(17,21 • (VWDEOLVKWKHGDWHV • 3ODQWKHDFWLYLWLHV • 6HFXUHWKHVSHDNHU • 1DPHWKHFRPPLWWHHVDQGVXEFRPPLWWHHV
• 3ODQWKHSURPRWLRQV • 3URYLGHWKH¿QDQFHVWRFRYHUWKHFRVWRIWKHFRQYHQWLRQ • 5HPHPEHU±DOZD\VLQFRRSHUDWLRQZLWKWKHSDVWRU
7+(7($0:,//3/$1$0217+/<0,66,216681'$< • 7KH\ZLOOSUHVHQWDZHOOSODQQHGPLVVLRQV³:LQGRZRQWKH:RUOG´HDFK PRQWK • 7KHVXFFHVVRIWKH)DLWK3URPLVHJLYLQJGHSHQGVRQWKHZRUNDQG SUD\HULQYHVWHGLQWKLVPRQWKO\SUHVHQWDWLRQ • 7KLVµ:LQGRZRQWKH:RUOG´ZLOOFRQWLQXHWRHGXFDWHPRWLYDWHDQG LQVSLUHWKHFRQJUHJDWLRQIRUPLVVLRQVWKURXJKRXWWKH\HDU
:+$7$5(7+(7($0¶635,0$5<*2$/6" &UHDWHZRUOGYLVLRQ 3URPRWHLQWHUFHVVRU\SUD\HUIRUZRUOGQHHGV 2UJDQL]HPLVVLRQVFRQYHQWLRQV 3DUWLFLSDWHLQPRQWKO\PLVVLRQV6XQGD\V 3ODQVKRUWPLVVLRQVWULSV +HOSVHOHFWFDQGLGDWHVIRUVKRUWWHUPVHUYLFH
7+(7($0¶6385326(,6 • 7REHDQH[WHQVLRQRIWKHSDVWRULQSURPRWLQJPLVVLRQVWKURXJKRXWWKH FRQJUHJDWLRQ • 7RPDNHWKHPVHOYHV WKHWHDP DYDLODEOHWRHYHU\GHSDUWPHQWLQ WKHFKXUFKSURYLGLQJUHVRXUFHVDQGHQFRXUDJHPHQWIRUSURPRWLQJ PLVVLRQVWRHYHU\DJHJURXS
%XWWKHWHDP¶VSULPDU\SXUSRVHLVWRSURYLGHDGHTXDWHRSSRUWXQLW\IRUHYHU\ EHOLHYHUWR REH\WKH*UHDW&RPPLVVLRQ
67(3 %8,/',1*0,66,2166833257:,7+ $1$118$/0,66,216&219(17,21
+2::,//$&+85&+%(1(),7)520$1$118$/0,66,216&219(17,21" ,WLVWKHPRVWHIIHFWLYHZD\WRRSHQWKHZRUOGWR\RXUFRQJUHJDWLRQ² 7KLVHTXLSVWKH&KXUFKWREHWWHUSUD\JLYHDQGJR ,WZLOOPDNH\RXUSHRSOHPRUHVRXOFRQVFLRXV²FKXUFKHVFRQGXFWLQJ FRQYHQWLRQVUHSRUWPRUHFRQYHUWVWKDQWKRVHZLWKRXWFRQYHQWLRQV 7KHFRQYHQWLRQFDQJLYH\RXUSHRSOHJUHDWMR\DQGMR\IXO&KULVWLDQVJHW DORQJEHWWHUZLWKHDFKRWKHU :RUNLQJWRJHWKHULQDFRQYHQWLRQZLOOUHVXOWLQEHWWHUXQLW\EHFDXVH SHRSOHZRUNLQJIRUDFRPPRQJRDOVHOGRP¿JKWHDFKRWKHU )DLWK3URPLVHJLYLQJZLOOJHQHUDWHPRUHPRQH\IRUPLVVLRQVXVXDOO\ PRUHWKDQGRXEOHWKHLUSUHYLRXVPLVVLRQVJLYLQJIROORZLQJWKHLU¿UVW FRQYHQWLRQ 7KLVZLOODOORZIRUPRUHGLVSRVDEOHLQFRPHLQ\RXUJHQHUDOIXQGVLQFH \RXUPLVVLRQVFRPPLWPHQWVDUHQRZSDLGIURP)DLWK3URPLVHLQFRPH )DLWK3URPLVHJLYLQJUHOHDVHV*RG¶VSULQFLSOHRIPXOWLSOLFDWLRQPDQ\ WLPHVE\LQFUHDVLQJJHQHUDOIXQGLQFRPH $QDQQXDOFRQYHQWLRQJLYHVRSSRUWXQLW\WRREH\&KULVW¶VFRPPDQG $QDQQXDOFRQYHQWLRQSXWV\RXDQGWKHFKXUFKLQDJUHHPHQWZLWK*RG¶V SXUSRVHZKLFKLVWRUHGHHPPDQNLQG 7KH)DWKHULVQRWZLOOLQJWKDWDQ\RQHEHORVW 3HWHU 7KH6RQFDPHWRVHHNDQGWRVDYHDOOZKRDUHORVW /XNH 7KH+RO\6SLULWFDPHWRFRQYLFWWKHZRUOGRIVLQDQGWRGUDZDOO PHQWR&KULVW -RKQ
%87:21¶77+5((25)2850,66,21$5<6(59,&(6($&+<($5 $&&203/,6+7+(6$0(7+,1*"12+(5(¶6:+< 6(59,&( &219(17,21 3UHVHQWVDVHUYLFH 3UHVHQWVDVWUDWHJ\ ,QYROYHVWKHPLVVLRQDU\ ,QYROYHVHYHU\RQH 3UHVHQWVWKHFDOORIRQH 3UHVHQWVWKHFDOOWRDOO 5HVXOWVLQHPRWLRQDOJLYLQJ 5HVXOWVLQFRQVLVWHQWSHUVRQDOJLYLQJ 5HVXOWVLQRQHWLPHRIIHULQJ 5HVXOWVLQPRQWKO\IDLWKSURPLVHJLYLQJ $VVLVWVRQHPLVVLRQDU\EXGJHW 6XSSRUWVWKHHQWLUHPLVVLRQVEXGJHW
62:+$7,6$0,66,216&219(17,21" • ,WLVDQRUJDQL]HGDFWLYLW\GHGLFDWHGWRSURPRWLQJ ±$QDZDUHQHVVRIVSLULWXDOQHHGWKURXJKRXWWKHZRUOG ±7KHLQGLYLGXDOEHOLHYHUVUHVSRQVLELOLW\WRKHOSUHDFKWKHORVWZLWK WKHJRVSHO
• ,WVKRXOGEHLQIRUPDWLYH ±([SRVLQJWKHFRQJUHJDWLRQWRWKHZRUNRI$VVHPEOLHVRI*RG:RUOG 0LVVLRQV • ,WVKRXOGEHLQVSLUDWLRQDO ±2XUHPRWLRQVPXVWEHWRXFKHGEHIRUHZHZLOOUHVSRQGZLOOLQJO\ ±:HVKRXOGVHHNWKH6SLULWVDQRLQWLQJRQHYHU\SODQDQGSHUVRQZKR SDUWLFLSDWHV • ,WVKRXOGEHPRWLYDWLRQDO ±7KHJRDOLVWRJHWHYHU\RQHWRSUD\DQGJLYHDQGVRPHWRJR :+$7$5(7+(1(&(66$5<(/(0(1762)$68&&(66)8/&219(17,21" $VHULHVRIVHUYLFHVFRQGXFWHGDWOHDVWDQQXDOO\WKDWIRFXV RQPLVVLRQV $PLVVLRQVVSHDNHU $)DLWK3URPLVHFKDOOHQJHWRHYHU\EHOLHYHU 1RVHULHVRIVHUYLFHVVKRXOGEHFRQVLGHUHGDPLVVLRQVFRQYHQWLRQ XQOHVV)DLWK3URPLVHVDUHUHFHLYHG7KH*UHDW&RPPLVVLRQLVJLYHQWR HYHU\EHOLHYHUDQGWKH\PXVWEHJLYHQWKHRSSRUWXQLW\WREHFRPH SHUVRQDOO\LQYROYHG +2:/21*6+28/'$&219(17,21/$67" • 7KHZHHNHQGFRQYHQWLRQLVWKHPRVWFRPPRQ ±6DWXUGD\QLJKWEDQTXHW ±6XQGD\$0±)DLWK3URPLVHV ±6XQGD\30±SHUVRQDOFRPPLWPHQW • $QHLJKWGD\FRQYHQWLRQLVHIIHFWLYH ±7ZR6XQGD\V:HGQHVGD\HYHQLQJDQGD6DWXUGD\EDQTXHW :+$7(9(5)250$7<28&+226( • 7KH SDVWRU VKRXOG SUHDFK RQ PLVVLRQV RQ WKH 6XQGD\ SULRU WR WKH FRQYHQWLRQ • ,WLVFULWLFDOWKDWWKHFRQJUHJDWLRQVHHVDQGKHDUVWKHSDVWRU¶VSDVVLRQIRU WKHORVW • 'LVWULEXWH WKH EURFKXUH :KDW LV D )DLWK 3URPLVH" DW WKH FORVH RI WKLV VHUYLFH 6(7$'$7( • %HJLQ\RXUFRQYHQWLRQSODQQLQJDWOHDVWVL[PRQWKVLQDGYDQFH • 3ODQ\RXUFRQYHQWLRQIRUWKHVDPHPRQWKHDFK\HDU • 6FKHGXOHWKHFRQYHQWLRQZKHQPRVWRI\RXUSHRSOHFDQDWWHQG • 3HDNPRQWKVDUH6HSWHPEHUWKURXJK1RYHPEHUDQG0DUFKWKURXJK0D\ • $YRLGKROLGD\ZHHNHQGVDQGGDWHVZKHQVSHFLDOVFKRRORUFRPPXQLW\ DFWLYLWLHVDUHVFKHGXOHGHDFK\HDU
• 7DNHZHDWKHUYDFDWLRQWLPHDQGRWKHUVSHFLDOZRUNVFKHGXOHVLQWR FRQVLGHUDWLRQ • .HHSWKHGDWHFOHDURIFRPSHWLQJDFWLYLWLHV²GRQ¶WSODQDQ\FKXUFK DFWLYLW\GXULQJ\RXUFRQYHQWLRQZHHNWKDWZRXOGFRPSHWHRUGLVWUDFW IURPWKHIRFXVRIPLVVLRQV
(67$%/,6+$&219(17,21%8'*(7:+,&+:,//,1&/8'( • 3URPRWLRQDOH[SHQVHV • 'HFRUDWLRQV • %DQTXHW • 6SHDNHUVH[SHQVHV ±+RWHODQGIRRG ±)DUHVRUPLOHDJH ±+RQRUDULDRUIUHHZLOORIIHULQJV
6&+('8/(<28563($.(56 • +2:0$1<63($.(56'2:(1(('"7+,6:,//'(3(1'21 • 7KHQXPEHURIDFWLYLWLHVSODQQHG • 7KHDYDLODELOLW\RITXDOL¿HGVSHDNHUV • 7KHDPRXQWRIIXQGVDYDLODEOHWRFRYHUVSHDNHUVH[SHQVHV ±)RUPLVVLRQDULHV²DJHQHURXVIUHHZLOORIIHULQJ ±:RUOG860LVVLRQVVWDIIDQGGLVWULFWSHUVRQQHO²WUDYHOH[SHQVHV DQGKRQRUDULXP ±+RWHODQGIRRGIRUDOOVSHDNHUV 87,/,=(7+(0,66,2167($0 • 'RQ¶WWU\WRGRLWDOO\RXUVHOI • $OORZ\RXUSHRSOHWRWDNHRZQHUVKLS • *LYH\RXUWHDPPHPEHUVWKHRSSRUWXQLW\WRGUHDPELJGUHDPVIRU UHDFKLQJDORVWZRUOG *(7(9(5<21(,192/9(' • 3DUDGHVZLWKFKLOGUHQ\RXWKDQGDGXOWV • 6NLWV²\RXWKSURPRWLQJWKHFRQYHQWLRQ • 6SHFLDOPXVLF • %DQTXHWVIRUDOODJHV • %RRWKVDQGGLVSOD\V 6(7$*2$/ • '21¶7)25*(77225'(50$7(5,$/6 • $OORZWRZHHNVIRUGHOLYHU\ • 2UGHUVXI¿FLHQWEDQQHUVDQGSRVWHUV • %HVXUHWRRUGHUWKHWKHPHYLGHR • )DLWK3URPLVHFDUGVDUHDPXVW • 7KHEURFKXUH:KDWLVD)DLWK3URPLVH"VKRXOGEHRUGHUHGLQVXI¿FLHQW TXDQWLW\WRJLYHWRHYHU\IDPLO\ 35(3$5(7+(&21*5(*$7,21 • %HJLQSURPRWLQJWKHFRQYHQWLRQDWOHDVWWZRPRQWKVLQDGYDQFH • %HJLQWHDFKLQJDERXWIDLWKSURPLVHV • 6KDUHWKH)DLWK3URPLVHJRDO • &UHDWHH[FLWHPHQWDQGDQWLFLSDWLRQ )DLWK3URPLVH6XQGD\VKRXOGEHWKHPRVWLPSRUWDQWGD\RI WKH\HDULQWKHDFWLYLWLHVRIWKHFKXUFK 352027(35$<(5 • 'LVWULEXWHDOLVWRIUHTXHVWVIRUWKHFRQYHQWLRQDQGPLVVLRQDULHV VXSSRUWHGE\WKHFKXUFK • &RQGXFWDVSHFLDOSUD\HUPHHWLQJWRSUD\IRUWKHFRQYHQWLRQDQGWR LQWHUFHGHIRUDORVWZRUOG &5($7((;&,7(0(17)25)$,7+3520,6(681'$< • 3URYLGHDWDEOHZLWKOLWHUDWXUHRI$*0LVVLRQV0LQLVWULHV • )HDWXUHPLVVLRQVLQHDFK6XQGD\6FKRROFODVVIRUWKHGD\ • 'HFRUDWHWKHVDQFWXDU\ZLWKÀDJVSRVWHUVDQGEDQQHUV 3/$17+()$,7+3520,6(6(59,&( • %XLOGWKHSURJUDPPXVLFHWFDURXQGPLVVLRQVHOLPLQDWLQJDOO XQQHFHVVDU\DQQRXQFHPHQWV • 3ODQEDE\GHGLFDWLRQVUHFHSWLRQRIPHPEHUVHWFIRUDQRWKHUWLPH • 3UHSDUHWKHXVKHUVDQGWDEXODWRUVIRUWKHLUGXWLHV • *LYHWKHVSHDNHUDWOHDVWPLQXWHVWRSUHDFKDQGUDLVH)DLWK3URPLVHV (9$/8$7(<285),1$1&,$/%$6( • 5HYLHZWKH)DLWK3URPLVHVUHFHLYHG • (VWLPDWHWKHDPRXQWRIVROLGLQFRPHIRUWKHQH[W\HDU • 6XEWUDFWWKHFXUUHQWPLVVLRQVREOLJDWLRQVWRGHWHUPLQHWKHDPRXQWRI QHZLQFRPH 6(7<285$118$/0,66,216%8'*(7 • /HDYHDPDUJLQRIVDIHW\DVZHOODVIRUXQH[SHFWHGXUJHQWDSSHDOV • 'HVLJQDWHDSRUWLRQHDFKPRQWKWRDIXQGIRU ±9LVLWLQJPLVVLRQDU\VSHDNHUV ±1H[W\HDU¶VFRQYHQWLRQ • 1RZGHWHUPLQHZKLFKPLVVLRQDULHVWKHFKXUFKZLOOSLFNXSIRUPRQWKO\ VXSSRUW (9$/8$7(<285&219(17,21 • :KDWGLGZHGRULJKW" • :KDWGLGZHGRZURQJ" • :KDWGLGZHQRWGREXWVKRXOGKDYHGRQH" • :KDWFRXOGZHGREHWWHU" • :KDWGDWHVZLOOZHVHWIRUQH[W\HDU¶VFRQYHQWLRQ • :KRZLOOZHLQYLWHDVRXUVSHDNHU V " :HFDQFRXQWRQ*RG¶VEOHVVLQJVZKLOHZHIDLWKIXOO\KROGWKH URSHVXSSRUWLQJWKHPLVVLRQDULHVEHFDXVHZHDUH IROORZLQJDIWHU*RG¶VRZQKHDUW 67(3 %8,/',1*0,66,2160217+%<0217+ ,WLVQRWHQRXJKWRKDYHDVXFFHVVIXO)DLWK3URPLVHUHVSRQVHIURP\RXU FRQJUHJDWLRQ7KHFKDOOHQJHRIPLVVLRQVPXVWEHNHSWIUHVKWKURXJKRXWWKH\HDU /HW¶VORRNDWVRPHVWHSVWKDWZLOONHHS\RXUFRQJUHJDWLRQLQYROYHGLQPLVVLRQV ZHHNVRIHYHU\\HDU $PRQWKO\PLVVLRQV6XQGD\LVWKHFRUQHUVWRQHWREXLOGLQJPLVVLRQVYLVLRQRQFH WKHFRQYHQWLRQLVRYHU7KHUHDUHPDQ\RWKHUHOHPHQWVEXW\RXFDQ¶WEXLOG PLVVLRQVHIIHFWLYHO\ZLWKRXWPLVVLRQV6XQGD\ 623/$1,7&$5()8//<68&&(66'2(61¶7-867+$33(1 • *LYHWKLVPRQWKO\PLVVLRQVVORWDQDPHVXFKDV³:LQGRZRQWKH:RUOG´ • (DFK6XQGD\¶VSUHVHQWDWLRQPD\YDU\IURPWRPLQXWHV 7DNHDORRNDWVRPHRIWKHWKLQJV\RXPLJKW SODQIRUPLVVLRQV6XQGD\ 87,/,=(7+(3(17(&267$/(9$1*(/ • &RRUGLQDWH³:LQGRZRQWKH:RUOG´ZLWKWKHZRUOGHGLWLRQRIWKH 3HQWHFRVWDO(YDQJHOUHOHDVHGRQWKH¿UVW6XQGD\RIHDFKPRQWK 86(0217+/<'9'6 • 7KHVHDUHDYDLODEOHE\DQQXDOVXEVFULSWLRQIURP:RUOG0LVVLRQVIRU (DFKPRQWKO\'9'FRQWDLQVDFOLSIRUHDFKDJHJURXS • $GXOWV²1HZVEUHDN D6SDQLVKFOLSLVLQFOXGHGHDFKPRQWK • • 'LVSOD\DÀDJHYHU\PLVVLRQV6XQGD\ • 'LVSOD\WKDWÀDJZKHQWKHPLVVLRQDU\YLVLWVIRUDVHUYLFHRUZKHQSUD\HU LVEHLQJRIIHUHGIRUWKDWFRXQWU\ &$//$0,66,21$5< • &DOOSULRUWR6XQGD\DQGVHWXSDQDSSRLQWPHQWE\SKRQH • $PSOLI\WKHFRQYHUVDWLRQWKURXJK\RXUV\VWHPDQGLQWHUYLHZWKHIDPLO\ GXULQJWKHVHUYLFH • *HWWKHLUSUD\HUQHHGVDQGKDYHWKHFRQJUHJDWLRQSUD\ZKLOHWKH\DUH RQWKHOLQH ,1&/8'(086,&$1''5$0$ • 8VHVNLWVZLWKDPLVVLRQVWKHPH • 3UHVHQWKXPDQYLGHRVZLWKDPLVVLRQVVRQJ • 'RQ¶WIRUJHWPLPH • 7KHPRUHSHRSOHLQYROYHGWKHPRUHVXFFHVVIXO\RXUHIIRUWWREXLOG SDVVLRQIRUWKHORVWRIWKHZRUOG 6+$5((;&(5376)5200,66,21$5,(6/(77(56 • 7KLVVKRXOGEHGRQHRQDOLPLWHGEDVLV • 2QO\ZKHQWKHFRQWHQWLVVRH[FLWLQJRUVRXUJHQWWKDWLWVKRXOGQRWEH LJQRUHG • $OOPLVVLRQDU\QHZVOHWWHUVVKRXOGEHSRVWHGRQ\RXU³:RUOG+DUYHVW´ EXOOHWLQERDUG *,9(23325781,7<)253(5621$/7(67,021,(6 • 6KDUHDWHVWLPRQ\IURPDPHPEHUZKRKDVH[SHULHQFHGGLYLQHEOHVVLQJ DQGSURYLVLRQUHVXOWLQJIURPPDNLQJD)DLWK3URPLVH • 7KHFRQJUHJDWLRQZLOOEHWWHULGHQWLI\ZLWKWKHSHZWKDQZLWKWKHSXOSLW • 2WKHUVZLOOEHLQVSLUHG .((37+(&21*5(*$7,21,1)250('$%287)$,7+3520,6(*,9,1* 217+(),567681'$<2)(9(5<0217+ • 6KDUHIDLWKEXLOGLQJZRUGVWRHQFRXUDJHWKHFRQWLQXHGVXSSRUWIRU PLVVLRQV • 3XEOLVKPLVVLRQVJLYLQJLQWKHFKXUFKEXOOHWLQ )DLWK3URPLVHWRWDO 'XHWRGDWH 5HFHLYHGWRGDWH 3UDLVH*RGIRUYLFWRU\ RU )DLWK3URPLVHWRWDO 'XHWRGDWH 5HFHLYHGWRGDWH 3UD\3UD\3UD\ 6,1&(<28.12:7+$7<28:,//+$9(³:,1'2:6217+(:25/'´ ($&+<($53/$1$+($'<2856&+('8/(0,*+7/22./,.(7+,6 • -DQXDU\²%R\VDQG*LUOV0LVVLRQDU\&UXVDGH • )HEUXDU\²'9' • 0DUFK²:RPHQ¶V0LQLVWU\DQG/LJKWIRUWKH/RVW • $SULO²0LQL&RQYHQWLRQ • 0D\²'9' • -XQH²6HQGHUV)XQG • -XO\²'9' • $XJXVW²3KRQHLQWHUYLHZ • 6HSWHPEHU²'9' • 2FWREHU²&RQYHQWLRQ)DLWK3URPLVH6XQGD\ • 1RYHPEHU²6SHHG7KH/LJKW • 'HFHPEHU²'9' 7KHUHDUHPDQ\RWKHUZD\VWRNHHSPLVVLRQVEHIRUHWKH FRQJUHJDWLRQWKURXJKRXWWKH\HDU $63$672535($&+210,66,2163(5621$/(9$1*(/,60257+( :257+2)$628/$7/($6721&(($&+48$57(5 • 7KHFRQJUHJDWLRQQHHGVWRKHDU\RXUSDVVLRQIRUWKHORVW • 6321625$129(56($60,66,21675,3 • ,I\RXUFKXUFKLVXQDEOHWRGRLWDORQHSDUWQHUZLWKDQRWKHUFKXUFKRU ZLWKDGLVWULFWVSRQVRUHGWULS • 7KLVZLOOWUDQVIRUPWKHDWWLWXGHRIWKRVHZKRJR • 7KH\ZLOOLQWXUQLQÀXHQFHPDQ\RWKHUV *(73(5621$//<,192/9(':,7+$)(:0,66,21$5,(6 • 'HYHORSDSHUVRQDOUHODWLRQVKLS • *LYHPRUHVXEVWDQWLDOPRQWKO\VXSSRUWWRWKHVHPLVVLRQDULHV • &RQVLGHUSURYLGLQJKRXVLQJRUVFKRROLQJDVVLVWDQFHZKLOHWKH\DUH KRPHIRUWKHLULWLQHUDWLRQF\FOH $'237$)$0,/< • 7KLVPD\EHGRQHE\DFODVVDGHSDUWPHQWRUE\WKHFRQJUHJDWLRQ • 5HPHPEHUHDFKIDPLO\PHPEHU¶VELUWKGD\DQGDW&KULVWPDV • %HFRPHWKHLUSUD\HUSDUWQHUV • 5HVHDUFKWKHLUFRXQWU\RIPLQLVWU\ *(772.12:<2850,66,21$5,(6 • 5HTXHVWD³VLJQL¿FDQWHYHQWVOLVW´IURPWKH$VVHPEOLHVRI*RG:RUOG 0LVVLRQVRI¿FHIRUWKHPLVVLRQDULHVWKDW\RXVXSSRUW • 5HPHPEHUWKHPLVVLRQDULHVDW&KULVWPDVWLPH &23<$1'&,5&8/$7(0,66,21$5</(77(56$021*7+( &21*5(*$7,21 • 7KLVZLOOKHOS\RXUPHPEHUVJHWDFTXDLQWHGZLWK\RXUFKXUFK¶V PLVVLRQDU\IDPLO\ • 7KH\ZLOOOHDUQWKDWPLVVLRQVLVQRWDERXWDSURJUDPEXWDERXWSHRSOH *,9(63(&,$/5(&2*1,7,21727+26(:+20$.($)$,7+3520,6( (1&285$*(35$<(5)250,66,216 • )ROORZLQJWKHFRQYHQWLRQKROGD³7KDQN (1&285$*(35$<(5)250,66,216 • 3XEOLVKDPRQWKO\PLVVLRQVSUD\HUSDJH • )RUPPLVVLRQVSUD\HUJURXSVIRUHDFKDUHDRIWKHZRUOG • &RQGXFWIUHTXHQWWRPLQXWHLQWHUFHVVRU\SUD\HUWLPHVGXULQJ UHJXODUVHUYLFHV 6&+('8/()5(48(170,66,21$5<63($.(56 • 0LVVLRQDULHVLPSDUWYLVLRQDQGEXUGHQTXDOLWLHVQHHGHGE\WKHORFDO FRQJUHJDWLRQ • 0LVVLRQDULHVPDNHLWSRVVLEOHIRUWKHFRQJUHJDWLRQWRREH\WKH*UHDW &RPPLVVLRQ 7KRVHDUHJUHDWLGHDVEXWKRZZRXOG,HYHU¿QGWKHWLPHWRGRLWDOO" ,VQ¶WLWDERXWWLPHZH¿QLVKHGWKHWDVN" 67(3 %8,/',1*0,66,216())(&7,9(1(667+528*+35$<(5 35$<(5,67+()25*277(1:($321,10,66,216 7KHZHDSRQVZH¿JKWZLWKDUHQRWWKHZHDSRQVRIWKHZRUOG2QWKHFRQWUDU\ WKH\KDYHGLYLQHSRZHUWRGHPROLVKVWURQJKROGV &RU 1,9 3$8/.1(:7+$735$<(5,6+$5':25. ,QWKHVDPHZD\SUD\HULVHVVHQWLDOLQWKLVRQJRLQJZDUIDUH3UD\KDUGDQGORQJ 3UD\IRU\RXUEURWKHUVDQGVLVWHUV.HHS\RXUH\HVRSHQ.HHSHDFKRWKHU¶V VSLULWVXSVRWKDWQRRQHIDOOVEHKLQGRUGURSVRXW (SK 7KH0HVVDJH 3$8/.1(:7+(9$/8(2)35$<(5 3UD\IRUPHWRRDQGDVN*RGWRJLYHPHWKHULJKWZRUGVDV,EROGO\WHOORWKHUV DERXWWKH/RUGDQGDV,H[SODLQWRWKHPWKDWKLVVDOYDWLRQLVIRUWKH*HQWLOHVWRR (SK 7/% 3$8/.1(:+(1(('('7+(35$<(562)+,63$571(56$7+20( 'RQ¶WIRUJHWWRSUD\IRUXVWRRWKDW*RGZLOOJLYHXVPDQ\FKDQFHVWRSUHDFKWKH *RRG1HZVRI&KULVWIRUZKLFK,DPKHUHLQMDLO3UD\WKDW,ZLOOEHEROGHQRXJKWR WHOOLWIUHHO\DQGIXOO\DQGPDNHLWSODLQDVRIFRXUVH,VKRXOG &RO 7/% 35$<(5:,//5(68/7,1025(:25.(56 • ,WZLOOVHQGRXWZRUNHUVZKRDUH*RGFDOOHGZRUNHUV • ,WZLOOWUDLQWKHPLQ*RG¶VVFKRRORIWKH+RO\6SLULW • ,WZLOOVHQGWKHPWRWKHULJKW¿HOGV • ,WZLOOVXVWDLQWKHPZKHQWKH\JR 35$<(5:,//6833/<7+(1(('('),1$1&( • *RGFDQUHDFKWKHFKHFNERRNVWKDWZHFDQQRW • 7KH+RO\6SLULWFDQFDOOWKRXVDQGVRIEHOLHYHUVDQGEOHVVWKHPEH\RQG PHDVXUHXVLQJWKHLUDELOLWLHVWRHDUQWKH¿QDQFHVWRVXSSRUWPLVVLRQV • 7KURXJKSUD\HU*RGFDQDQGZLOOFDOOPDQ\WREHFRPH³VHQGHUV´ 35$<(5:,//5(029(7+(',)),&8/7,(6 • 2SHQFRXQWULHVFORVHGWRWKHJRVSHO • (QWHUWKHRI¿FHVRINLQJVDQGSUHVLGHQWV • &KDQJHWKHFRXUVHRIZDUVDQGXSULVLQJV • 3URWHFWWKHPLVVLRQDULHVIURPVLFNQHVVDQGGDQJHU • 5HPRYHWKHORQHOLQHVVDQGKRPHVLFNQHVVIURPWKHKHDUWRIWKH PLVVLRQDULHV 35$<(5:,//%5($.'2:1%$55,(56 • 5HPRYHSUHMXGLFHDJDLQVWWKHJRVSHODQGWKHPLVVLRQDU\ • :LSHDZD\VSLULWXDOEOLQGQHVVIURPWKHH\HVRIPLOOLRQV • %ULQJVSLULWXDODZDNHQLQJWKDWZLOOVKDNHZKROHQDWLRQV 7KHEDWWOHZLOORQO\EHZRQWKURXJKSUD\HU +2:&$1:((1&285$*(35$<(5)250,66,216" • ,QFOXGHPLVVLRQVSUD\HUQHHGVLQWKHZHHNO\EXOOHWLQDQGRUSXEOLVKD PRQWKO\PLVVLRQVSUD\HUSDJH • &RQGXFWDIUHTXHQWWRPLQXWHLQWHUFHVVRU\SUD\HUWLPHGXULQJD UHJXODUVHUYLFH • )RUPPLVVLRQVSUD\HUJURXSVIRUHDFKDUHDRIWKHZRUOG • 'LVWULEXWHWRWKHFRQJUHJDWLRQVSHFLDOOLWHUDWXUHWKDWHQFRXUDJHVSUD\HU IRUPLVVLRQV +2:&$1:(35(3$5()25025(())(&7,9(35$<(5" • .QRZ\RXUPLVVLRQDULHVDQGSUD\IRUWKHPUHJXODUO\ • 3ULQWWKHLUQDPHVLQWKHEXOOHWLQRUUHDGWKHPIURPWKHSXOSLWDQGSUD\IRU WKHPRQDURWDWLQJEDVLV • 3ODFHWKHLUSLFWXUHVRQDORRSDQGSURMHFWWKHPSULRUWRWKHVHUYLFHRUDW SUD\HUWLPH • 6HFXUHDOLVWIURP$*:0ZLWKELUWKGDWHVHWFRIHDFKIDPLO\PHPEHU • 8VHWKHSUD\HUUHTXHVWVSURYLGHGE\$*LQWKH:RUOG0LVVLRQVHGLWLRQRI WKH3HQWHFRVWDO(YDQJHORWKHUSHULRGLFDOVDQGPLVVLRQDU\QHZVOHWWHUV • 8VHERRNVWKDWIRFXVRQPLVVLRQVVXFKDV2SHUDWLRQ:RUOG -RKQVWRQH± =RQGHUYDQ 86(7+(5(6285&(6$9$,/$%/(72<28 • ,QWHUFHVVRU :RUOG5HSRUWLVDYDLODEOHHDFK7XHVGD\E\HPDLO&DOO H[W • 3UD\HU1HWSURYLGHVPLVVLRQDU\SUD\HUUHTXHVWVE\HPDLORQ0RQGD\± )ULGD\&DOO H[W • 7KHVHUHVRXUFHVDUHIUHHRIFKDUJH • $QRWKHUNH\UHVRXUFHLV&DOOWR3UD\HU±VXEVFULEHIRUHYHU\IDPLO\LQ\RXU FRQJUHJDWLRQ±DYDLODEOHLQLQGLYLGXDOVXEVFULSWLRQRULQEXON±SXEOLVKHG VHPLDQQXDOO\DQGGLVSOD\VWKHSLFWXUHDQGELUWKGD\RIHDFKPLVVLRQDU\ &DOO +2:&$1:(35$<025(())(&7,9(/<" • %HVSHFL¿F±QDPHWKHPLVVLRQDU\QHHGFRXQWU\RUSURMHFW • $VN*RGWRFDOOPRUHZRUNHUVWRJR • $VN*RGWRFDOOPRUH³VHQGHUV´ • ,QWHUFHGHIRUFRXQWULHVZKHUHWKHUHDUHIHZRUQRPLVVLRQDULHVSUHVHQW :+(1:(35$<)250,66,21$5,(6:(6+28/',1&/8'( $QRLQWLQJZLVGRPDQGIDYRU +HDOWKVWUHQJWKDQGSURWHFWLRQ )LQDQFLDOVXSSO\ &KLOGUHQ¶VHGXFDWLRQ &DUHDQGSURYLVLRQZKHQIDPLO\PHPEHUVDUHVHSDUDWHG )DPLO\¶VVSLULWXDOZHOIDUH %LQGGHPRQLFRSSUHVVLRQ 7KHVXFFHVVRIWKHLUDVVLJQHGPLQLVWU\RQWKH¿HOG %(3(56,67(17,1<28535$<(56 'RQ¶WEHZHDU\LQSUD\HU NHHSDWLW ZDWFKIRU*RG¶VDQVZHUV &RO 7/% $1'5(-2,&()257+($16:(5 DQGUHPHPEHUWREHWKDQNIXOZKHQ WKHDQVZHUV FRPH &RO 7/% 67(3 %8,/',1*0,66,2163$571(56+,3 7+528*+7+(0,66,21$5<9,6,7 7+(*22'1(:6,6$Q\RQHZKRFDOOVXSRQWKHQDPHRIWKH/RUGZLOOEH VDYHG 5RP 7/% 7+(',/(00$,6%XWKRZVKDOOWKH\DVNKLPWRVDYHWKHPXQOHVVWKH\EHOLHYH LQKLP"$QGKRZFDQWKH\EHOLHYHLQKLPLIWKH\KDYHQHYHUKHDUGDERXWKLP" 5RP 7/% *2'¶63/$1,63$571(56+,3 $QG KRZ FDQ WKH\ KHDU DERXW KLP XQOHVV VRPHRQH WHOOV WKHP"$QG KRZ ZLOO DQ\RQHJRDQGWHOOWKHPXQOHVVVRPHRQHVHQGVKLP" 5RP 7/% *2'&$//6620(72%(*2(56 • 7RRWKHUFXOWXUHV • 7RRWKHUODQJXDJHV • 7RRWKHUFRXQWULHV *2'&$//67+(5(6772%(6(1'(56 • 7KURXJK\RXUIDLWKIXOSUD\HUV • 7KURXJK\RXUPRQWKO\IDLWKSURPLVH ± 0DQ\SDUDFKXUFKRUJDQL]DWLRQVVSHQGRUPRUHRQ RSHUDWLRQDOH[SHQVHV ± :K\QRWJLYHRSSRUWXQLW\IRU\RXUSHRSOHWRLQYHVWLQ$* PLVVLRQVZKHUHRQO\LVGHGXFWHGIRUH[SHQVHV )UHTXHQWPLVVLRQDU\YLVLWVKHOSPDLQWDLQ)DLWK3URPLVHJLYLQJDWDKLJK OHYHOWKURXJKRXWWKH\HDU ± :LWKRXWUHJXODUPRWLYDWLRQHQWKXVLDVPODJVDQGPDQ\)DLWK 3URPLVHVPDGHGXULQJWKHFRQYHQWLRQDUHQRWFRPSOHWHG ± 0LVVLRQVLQFRPHGHFUHDVHVDQGWKHFKXUFK¿QGVLWGLI¿FXOWWR NHHSLWVFRPPLWPHQWV 7KHPLVVLRQDU\YLVLWJLYHVRSSRUWXQLW\IRUWKHFDOOWRPLVVLRQVWR GHYHORSLQRWKHUV ± :KHQDVNHGZKDWZHUHWKHJUHDWHVWIDFWRUVLQÀXHQFLQJWKHLU FDOO$VVHPEO\RI*RGPLVVLRQDULHVQDPHGWZRRXWVWDQGLQJ LQÀXHQFHV 3HUVRQDOGHYRWLRQV 0LVVLRQDU\PLQLVWU\ :H¶YHJRWLWEDFNZDUG7KHPLVVLRQDULHVVKRXOGQ¶WKDYHWRVHDUFKIRUVXSSRUWLQJ FKXUFKHV:HVKRXOGEHORRNLQJIRUPLVVLRQDULHVWRVFKHGXOH 626&+('8/(0,66,21$5<63($.(56 • /HVVWKDQIRXUPLVVLRQDU\YLVLWV\HDUO\ZLOOQRWPDLQWDLQDQDZDUHQHVV RIWKHORVWQHVVRIPDQ • :LWKIRUHVLJKWPRVWFKXUFKHVFRXOGKDYHRQHPLVVLRQDU\HDFKPRQWK %(&5($7,9(,16&+('8/,1* • ,IIRUVRPHUHDVRQ\RXFDQ¶WJLYHWKHVFKHGXOHGPLVVLRQDU\WKHIXOO VHUYLFH ± 'RQ¶WFDQFHOLQVWHDG ± ,QWHUYLHZWKHPLVVLRQDU\RUJLYHKLPRUKHUPLQXWHVWRVKDUH WKHLUEXUGHQ 6&+('8/(0,66,21$5,(6,1($&+7<3(2):((./<6(59,&( • 6XQGD\$06XQGD\30DQG:HGQHVGD\ • 7KLVZLOODVVXUHWKDWHYHU\RQHDWWHQGLQJ\RXUFKXUFKZLOOUHFHLYHVRPH PLVVLRQVH[SRVXUH :+(17+(0,66,21$5<&$//6 • $FFHSWWKHFDOORU • 5HWXUQWKHLUFDOODVVRRQDVSRVVLEOH • 7KHPLVVLRQDU\QHHGVWRKHDUIURP\RXHYHQLIWKHDQVZHULVQR 'R\RXZDQWWKHPLVVLRQDU\VHUYLFHWREHDVXFFHVV" &RPPXQLFDWLRQLVWKHNH\ &20081,&$7(:,7+7+(0,66,21$5<35,2572$55,9$/ • $Q\VSHFLDOUHTXHVWVIRUWKHVHUYLFH SUHDFKLQJLQWHUYLHZYLGHR UHSRUWLQJHWF • 6HUYLFHWLPHDQGGLUHFWLRQVWRWKHFKXUFK • 'LUHFWLRQVIURPWKHLQWHUVWDWHWRWKHKRWHO 7(//7+(0,66,21$5< • 7KHW\SHRISDUWLFLSDWLRQWKH\ZLOOKDYH • 7KHW\SHRIVHUYLFHFODVVRUJURXSLQZKLFKWKH\PD\EHLQYROYHG :KHQZHKDYHGRQHRXUSUHSDUDWLRQZHFDQWUXVW*RGWRDQRLQWWKHVHUYLFH '85,1*7+(6(59,&(.((37+()2&86210,66,216 • ,QWURGXFHWKHPLVVLRQDU\NQRZOHGJHDEO\DQGZLWKHQWKXVLDVP • *LYHWKHPLVVLRQDU\WKHVHUYLFHZKHQSURPLVHG • :KHQSRVVLEOHDOORZDGHTXDWHWLPHIRUD¿HOGUHSRUWDQGPLQLVWU\RI WKH:RUG 5(&(,9($12))(5,1*$)7(57+(0,66,21$5<63($.6 • 'RQ¶WOLPLW\RXUJLYLQJWRDSUHGHWHUPLQHGKRQRUDULXPFKHFN • *LYH\RXUFRQJUHJDWLRQWKHRSSRUWXQLW\WRUHVSRQGZLWKDJHQHURXV RIIHULQJ ,)),1$1&(,6$&21&(51 • 6HWDVLGHDSUHGHWHUPLQHGDPRXQWHDFKPRQWKIURPWKH)DLWK3URPLVH JLYLQJIRUDPLVVLRQDU\VSHDNHU¶VIXQG • (VWDEOLVKDPLQLPXPEXWQRWDPD[LPXPRIIHULQJIRUPLVVLRQDU\ VSHDNHUV • ,IWKHRIIHULQJUHFHLYHGGRHVQRWUHDFKWKHPLQLPXPWDNHWKHEDODQFH IURPWKHIXQGIRUPLVVLRQDU\VSHDNHUV $/:$<6$//2:7,0()2535$<(5 • 'LYLQHSDUWQHUVKLSVDUHIRUPHGKHUH • &RPPLWPHQWVDUHPDGH • $OOVKRXOGFRPPLWWRSUD\DQGJLYH • 6RPHZLOOFRPPLWWRJRDVPLVVLRQDULHVZKHUHYHU*RGOHDGVWKHP $)7(57+(6(59,&( • +RVWWKHPLVVLRQDU\IRUDPHDORUGHVVHUWDQGJHWWRNQRZWKHPEHWWHU • %HUHDG\WRJLYHWKHPLVVLRQDU\WKHRIIHULQJFKHFNEHIRUHWKH\OHDYH 7KH\PD\QHHGWKHIXQGVIRUWUDYHOH[SHQVHV • :KHQSRVVLEOHJLYHWKHPLVVLRQDU\DVLJQHGPRQWKO\FRPPLWPHQWIRUP EHIRUHWKH\OHDYH7KLVUHPRYHVDJUHDWGHDORIVWUHVVDQGKDVWHQV WKHLUGHSDUWXUHIRUWKH¿HOG • 5HPHPEHUWKHDYHUDJHPRQWKO\FRPPLWPHQWLVDERXW 2QFH\RX¶YHGRQH\RXUSDUWH[SHFW*RG¶VEOHVVLQJVRQWKH PLVVLRQDU\VHUYLFHV:K\"%HFDXVH\RXDUHPDNLQJLWSRVVLEOHIRU\RXU FRQJUHJDWLRQWRREH\&KULVW¶VFRPPDQG 5(0(0%(5:($5(3$571(56:,7+*2' ,WLV*RG+LPVHOIZKRKDVJLYHQXVWKLVZRQGHUIXOZRUNRIWHOOLQJ+LV*RRG 1HZVWRRWKHUV &RU 7/% Building Missions Leadership B. / Ê 1 *, /Ê- , - 6ÕiÊ£ * ÌÊÕÃÌÀ>Ì\ÊÊ7 ÌiÀÊ* Ì}À>« Þ Ài>Ìi`ÊLÞÊ*>ÕÊ À>> £{{xÊ ÀÌ Ê ÛiÊÛiÕi -«À}wÊi`]Ê "ÊÈxnäÓ£n{ £ #/.4%.43 !#+./7,%$'%-%.43Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°x ).42/$5#4)/.Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°È 3%#4)/. n 4HE #HURCH n 4HE #ORNERSTONE OF 7ORLD -ISSIONSÊ°°°°°°°°°°°°°°°°°°°Ç 0!24 n %VALUATE 9OUR -ISSIONS 0REPAREDNESS ÜÊ ÃÃÃÊ `i`ÊÃÊ9ÕÀÊ ÕÀV ¶Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°n *>ÃÌÀ]Ê9ÕÊÀiÊÌ iÊ iÞÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°£ä Ê ÃÃÃÊ ÌÌii]Ê>Ê ÃÃÃÊ >À`pÃÊ/ iÀiÊ>Ê iÌÌiÀÊ >i¶Ê°°°°°°°°°°°°°°°°°°°°°°°°°££ 0!24 n &ORMING A 4EAM 7 ÞÊ>ÛiÊ>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>¶Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°£Ó ÜÊÌÊÀÊ>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°£Î 0!24 n 0REPARING A -ISSIONS 3TRATEGY Ài>Ì}Ê ÃÃÃÊ*VÞÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°£x ,iëÃLÌiÃÊ>`Ê>ÃÊvÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°£È 0!24 n 0UTTING 9OUR 0LAN )NTO !CTION -iÌÌ}ÊÌ iÊ}i`>Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°£Ê ii«}Ê>Ê,iVÀ`ÊvÊ ÃÃ>ÀiÃÊÌ iÊ ÕÀV Ê-Õ««ÀÌÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Óä iÌÌ}ÊÌÊ ÜÊÌ iÊ ÃÃ>ÀiÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Óä Û>Õ>Ì}Ê ÕÀÀiÌÊ ÃÃÃÊ*ÌiÌ>Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Óä Ài>Ì}Ê>ÊÕ>Ê ÃÃÃÊ Õ`}iÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ó£ iÌiÀ}Ê7 V Ê ÃÃ>ÀiÃÊÌÊ-Õ««ÀÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ó£ ÃÃ>ÀÞÊ Õ`}iÌÊ,iÛiÜÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÓÓ vÀ>ÌÊLÕÌÊ"ÕÀÊ ÃÃ>ÀÞÊ*>ÀÌiÀÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ó{ ÃÃ>ÀÞÊÛ}ÊpÊ Û>Õ>ÌÊ>`Ê>ÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÓÇ Õ>Ê ÃÃÃÊ Õ`}iÌÊ7ÀÊ- iiÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ón V>Ê ÕÀV Ê ÃÌÀiÃÊ7Ì Ê>Ê ÃÃÃÊVÕÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Îä ÜÊÌÊiÌÊÌ iÊ ÃÌÊÀÊÌ iÊ ÃÃ>ÀÞÊ6ÃÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÎÎ 3%#4)/. n !SSEMBLIES OF 'OD 7ORLD -ISSIONSÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Îx 0!24 n !LL !BOUT !SSEMBLIES OF 'OD 7ORLD -ISSIONS 7À`Ê ÃÃÃÊ*ÕÀ«ÃiÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÎÈ 7À`Ê ÃÃÃÊ >À`Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÎÈ 7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌiiÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÎÇ 7À`Ê ÃÃÃÊ-Ì>vvÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÎÇ Î 0!24 n 7ORLD -ISSIONS -INISTRIES ÃÌÊ>`Ê iÃVÀ«ÌÃÊvÊ ÃÌÀiÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Î ÌiÀ>Ì>Ê-iÀÛViÊ ÃÌÀiÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xä ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê ÃÌÀiÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xÎ 0!24 n &INANCIAL (ELPS 0ROGRAMS -i`iÀÃÊÕ`Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xx Ê,iivÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xx ÃÃiLiÃÊvÊ`ÊÕ`>ÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xx 0!24 n 4HE 2OLE OF $ISTRICT 7ORLD -ISSIONS 0ERSONNEL ÃÌÀVÌÊ7À`Ê ÃÃÃÊ ÀiVÌÀÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xÇ ÃÌÀVÌÊ ÃÃÃÊ ÌÌiiÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xÇ -iVÌ>Ê7À`Ê ÃÃÃÊ,i«ÀiÃiÌ>ÌÛiÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°xn 0!24 n ! (ISTORY OF !SSEMBLIES OF 'OD 7ORLD -ISSIONS ÃÌÀÞÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°x ÕÀÀiÌÊ-Ì>ÌÃÌVÃÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Èx 3%#4)/. n -ISSIONARIESÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÈÈ 0!24 n (OW !RE !SSEMBLIES OF 'OD -ISSIONARIES 3UPPORTED 7 >ÌÊ-ÞÃÌiÊvÊ-Õ««ÀÌÊÃÊ1Ãi`¶Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÈÇ 7 ÞÊ1ÃiÊÌ iÊÌiÀ>ÌÊ-ÞÃÌi¶Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÈÇ ÃÃ>ÀÞÊÌiÀ>ÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÈÇ iiwÌÃÊÌÊÌ iÊ V>Ê ÕÀV Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Èn iiwÌÃÊÌÊÌ iÊ ÃÃ>ÀÞÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Èn 0!24 n !DVANTAGES OF 'IVING TO -ISSIONS 4HROUGH THE ,OCAL #HURCHÊ°°°°°°°°°°°°°°° È 0!24 n (OW $OES THE 3YSTEM 7ORK Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Çä ÃÃ>ÀÞÊ ÌiÌÊÀÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ç£ ÃÃ>ÀÞÊ ÌiÌÊ iÀÌwV>ÌiÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÇÓ -i`}Ê ÃÃ>ÀÞÊ-Õ««ÀÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÇÎ ->«iÊ"vviÀ}ÊÀÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Çx 0!24 n 7HERE $OES THE -ONEY 'O Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÇÈ 0!24 n !DDITIONAL &ACTS !BOUT -ONTHLY #OMMITMENTSÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÇÇ 0!24 n 3TEPS TO "ECOMING A -ISSIONARYÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Çn !00%.$)#%3 *VÞÊ-Ì>ÌiiÌÊvÀÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÊÌ iÊ V>Ê ÕÀV Ê°°°°°°°°°°°°°°°°°°°°n£ Û>>LiÊ,iÃÕÀViÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°nÎ { !#+./7,%$'-%.43 vÌÞÌ ÀiiÊÞi>ÀÃÊvÊÃÌÀÞÊ >Ûi]ÊÌÊ>Ê}Ài>ÌÊiÝÌiÌ]Ê`iÌiÀi`ÊÌ iÊ«iÀÃÊÊ>ÊÜ°ÊÀÌÞ iÊvÊÌ ÃiÊÞi>ÀÃÊ >ÛiÊLiiÊëiÌÊÊÜÀ`ÊÃÃÃÊÛÛiiÌ°ÊÊÌ >Ê`ÊvÀÊÌ iÊ ««ÀÌÕÌiÃÊÊ >ÛiÊ >`ÊÌÊÃiÀÛiÊ>ÃÊ>Ê«>ÃÌÀ]ÊÃÃ>ÀÞ]ÊÃÃ>ÀÞÊ>`ÃÌÀ>ÌÀ]Ê`ÃÌÀVÌÊ ÃÃÃÊ`ÀiVÌÀÊ>`ÊVÀ`>ÌÀÊvÀÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>° Ê>Ê`iLÌi`ÊÌÊ Õ`Ài`ÃÊvÊV ÕÀV iÃÊÜ iÀiÊÊ >ÛiÊÃÌiÀi`Ê>LÕÌÊÃÃÃÊ>`ÊÌÊÌ iÊ ÃÃÃÊVÌÌiiÃÊ>`Ê>ÞÊi>`iÀà «ÊÌ >ÌÊ>Üi`ÊiÊÌ iÊ«ÀÛi}iÊÌÊà >ÀiÊÌ iʺ ÜÊÌ»Ê >`ÊºÜ Þ»ÊvÊÃÃðÊ/ ÃÊ>Õ>ÊÃÊ>Ê«À`ÕVÌÊvÊ>ÊvÊÌ ÃiÊiÝ«iÀiViðÊÊ >ÛiÊ`À>ÜÊÌÊ ÞÊvÀÊÞÊÜÊL>V}ÀÕ`]ÊLÕÌÊ>ÃÊvÀÊÌ iÊiÝ«iÀiViÃÊvÊÌ iÀÃÊÜ Ê >ÛiÊ}À>VÕÃÞÊ Ã >Ài`ÊÜÌ Êi°ÊÊ >ÛiÊViVÌi`Ê>ÌiÀ>ÊvÀÊ>ÞÊÃÕÀViÃÊ>`Ê}ÛiÊVÀi`ÌÊÜ iÀiÊ«ÃÃLi°Ê ÕV ÊvÊÌ iÊ>ÌiÀ>ÊÊÌ ÃÊ>Õ>ÊViÃÊvÀÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÀiÃÕÀViÃÊ >ÃÊÜiÊ>ÃÊvÀÊÞÊÜÊV«>Ìð -«iV>Ê}À>ÌÌÕ`iÊÃÊ`ÕiÊÌÊÃiÊÛiÀÞÊVÌÌi`Ê«i«iÊÜ Ê}iiÀÕÃÞÊà >Ài`ÊÜÌ ÊiÊÌ iÊ ÃÌÀÕVÌÕÀiÊ>`ÊvÕVÌÊvÊÃÃÃÊÜÌ ÊÌ iÀÊV}Ài}>ÌðÊ/ iÃiÊVÕ`iÊÀi`Ê ÌÌÀiÊ>ÌÊ ÀÃÌÊÃÃiLÞÊvÊ`]Ê >iÀÃwi`]Ê >vÀ>ÆÊ-ÕiÊ À >ÀÌÊ>ÌÊÀÃÌÊÃÃiLÞÊvÊ`]Ê iÃÊ iÃ]ÊÜ>ÆÊ,>ÞÊ ÕViÀÊ>ÌÊ ÀÌ >`Ê >Ì i`À>]Ê >Ã>ÃÊ ÌÞ]Ê ÃÃÕÀÆÊ>`Ê iÌÌÞÊ-ÌÀV >`Ê>ÌÊ7`>iÊÃÃiLÞÊvÊ`]Ê/ÕÃ>]Ê"> >°Ê / iÊÃiÊ«ÕÀ«ÃiÊvÊÌ ÃÊ>Õ>ÊÃÊÌÊà >ÀiÊÜÀ>LiÊ`i>ÃÊÌ >ÌÊV>Ê>ÃÃÃÌÊV ÕÀV Êi>`iÀÃÊÊ LÕ`}Ê>ÊÃÌÀ}ÊÃÃÃÊÕÌÀi>V iÃÊÜÌ ÊÌ iÀÊV ÕÀV iÃ°Ê >ÞÊ`Ê>iÊÌÊð 9ÕÀÊ«>ÀÌiÀÊÊÌ iÊ >ÀÛiÃÌ] *>ÕÊ À>> x ).42/$5#4)/. >ÀÛiÃÌÌiÊÀiµÕÀiÃÊ`}ÊÜ >ÌiÛiÀÊÃÊiViÃÃ>ÀÞÊÌÊ>VV«Ã ÊÌ iÊÜÀ°ÊÀÊÌ iÊwÀÃÌÊÌiÊ ÊÌ iÊ ÃÌÀÞÊvÊÃÃÃÊÕÌÀi>V ]ÊÌ iÊ ÕÀV Ê >ÃÊÌ iÊV>«>LÌÞÊÌÊÌiÊiÛiÀÞÊ«iÀÃÊÊ Ì iÊÜÀ`Ê>LÕÌÊiÃÕÃÊ ÀÃÌ°Ê/ iÊÌiV }ÞÊvÊÕÀÊ`>ÞÊVLi`ÊÜÌ Ê>Ê-«ÀÌwi`ÊV ÕÀV Ê >iÃÊiÛ>}iâ}ÊÌ iÊÜÀ`Ê«ÃÃLi° / iÃiÊ««ÀÌÕÌiÃÊ`i>`ÊÕÀÊLi`iVit iÃÕÃÊ}>ÛiÊÌ iÊÀi>ÌÊ ÃÃÊpʺÊÞiÊÌ iÀivÀi]Ê>`ÊÌi>V Ê>Ê>ÌÃ]ÊL>«Ìâ}ÊÌ iÊ ÊÌ iÊ>iÊvÊÌ iÊ>Ì iÀ]Ê>`ÊvÊÌ iÊ-]Ê>`ÊvÊÌ iÊÞÊ ÃÌ»Ê >ÌÌ iÜÊÓn\£®ÊpÊÌÊ>Ê Ì iÊ ÕÀV ]ÊÌÊÕÃÌÊ>ÊviÜÊvÊÃÊvÜiÀðÊ/ >ÌÊ`>ÞÊ>ÃÊiÊÃÌ`ÊÊÌ iÊÕÌ>ÊÊ>iiÊ >`Ê}>ÛiÊÌ iÊV>`]ÊiÊ>`iÊiÛiÀÞÊLiiÛiÀÊ>`ÊiÛiÀÞÊV ÕÀV ÊÀiëÃLiÊvÀÊiÛ>}iâ}Ê Ì iÊÜÀ`°Ê/ iÊ ÕÀV ÊÕÃÌÊÕÃiÊiÛiÀÞÊ>Û>>LiÊi>ÃÊÌÊvÕwÊÌ iÊV>`ÊvÊiÃÕÃÊÌÊºÊ ÞiÊÌÊ>ÊÌ iÊÜÀ`]Ê>`Ê«Ài>V ÊÌ iÊ}ëiÊÌÊiÛiÀÞÊVÀi>ÌÕÀi»Ê >ÀÊ£È\£x®° ÊV>ÊV ÕÀV ÊÌ >ÌÊ`iÃÊÌÊLi>ÀÊÌ iÊLÕÀ`iÊvÊÃÃÃÊÜÌ ÊÛÃ]Êv>Ì Ê>`Ê«ÜiÀÊÃÊ Ãi«>À>Ì}ÊÌÃivÊvÀÊÌÃÊÌi`i`Ê«ÕÀ«Ãi°Ê/ iÊ>«ÃÌiÊ*iÌiÀÊÀiÛi>i`ÊÌ iÊ i>ÀÌÊvÊiÃÕÃÊÜ iÊ iÊÃ>`]ʺ/ iÊ À`ÊÃÊ°°°ÊÌÊÜ}ÊÌ >ÌÊ>ÞÊà Õ`Ê«iÀà ]ÊLÕÌÊÌ >ÌÊ>Êà Õ`ÊViÊÌÊÀi«i Ì>Vi»ÊÓÊ*iÌiÀÊÎ\®°ÊÀÊÌ iÊ >ÞÊvÊ*iÌiVÃÌÊÕÌÊiÃÕÃÊViÃÊ>}>]ÊÌ iÊ ÕÀV ½ÃÊ`ÛiÊ «iÀ>ÌÛiÊÃÊÌÊÌiÊÌ iÊÜ iÊÜÀ`Ê>LÕÌÊ° ÛiÀÞÊÃÃiLiÃÊvÊ`ÊV ÕÀV ]ÊÀi}>À`iÃÃÊvÊÃâi]ÊÕÃÌÊ>iÊÌ iÊvÕwiÌÊvÊÌ iÊÀi>ÌÊ ÃÃÊ>Ê«ÀÀÌÞ°ÊÊV ÕÀV ÊÌ >ÌÊÃÊÌÊiÌ ÕÃ>ÃÌV>ÞÊÛÛi`ÊÊÀi>V }ÊÌ iÊÜ iÊ ÜÀ`ÊÜÌ ÊÌ iÊ}ëiÊÃÊÃÃ}ÊÌÃÊÌÀÕiÊ«ÕÀ«Ãi°Ê ÕÀV iÃÊÌ >ÌÊVÃÌ>ÌÞÊÊÜ>À`Ê LiViÊëÀÌÕ>ÞÊÃÌ>}>Ì°Ê/ iÞÊVi>ÃiÊÌÊLiÊÛÌ>]ÊÛ}ÊÀ}>ÃðÊÃÌi>`]ÊV>ÊV ÕÀV iÃÊ ÕÃÌÊÊLiÞ`ÊÌ iÀÊÜ>ÃÊ>`Êi>À}iÊÌ iÀÊÜÀ`ÛiÜ]Ê>}ÊiÛiÀÞÊ>ÌÌi«ÌÊÌÊLÀ}Ê>Ê Ã«ÀÌÕ>Ê`vviÀiViÊÌÊÌ iÀÊVÕÌiÃ]ÊVÌiÃÊ>`ÊÜÀ`° 7Ì ÊÌ iÊvÕ`iÀÃÊvÊÌ iÊÃÃiLiÃÊvÊ`]Ê>ÞÊÜiÊVÌÊÕÀÃiÛiÃÊ`Û`Õ>ÞÊ>`ÊV iVÌÛiÞÊÌÊÌ iÊ}Ài>ÌiÃÌÊiÛ>}iÃÊÌ >ÌÊÌ iÊÜÀ`Ê >ÃÊiÛiÀÊÃiit / iÊvÜ}Ê«>}iÃÊ >ÛiÊLiiÊ«Ài«>Ài`ÊÌÊ>ÃÃÃÌÊÊi>`}ÊV ÕÀV iÃÊÌÊÌ iÊ}>ÊvÊÀi>V }Ê Ì iÀÊvÕÊ«ÌiÌ>ÊÊÜÀ`ÊiÛ>}ið È 3%#4)/. 4HE #HURCH / iÊ ÀiÀÃÌiÊvÊ7À`Ê ÃÃà iÊV>ÊV}Ài}>ÌÊÃÊÌ iÊVÀiÀÃÌiÊÊLÕ`}ÊÃÃÃ°Ê ÀÃÌÊV />`i`ÊÌ iÊ ÕÀV ÊÌÊÀi>V ÊÌ iÊÜÀ`ÊÜÌ ÊÌ iÊ}ëi°Ê/ iÊV ÕÀV Ê>ÌÊ ÌV ÊÃiÌÊÌ iÊiÝ>«iÊ`ÕÀ}ÊÌ iÊwÀÃÌÊViÌÕÀÞÊLÞÊÃi`}ÊÕÌÊ >À>L>ÃÊ>`Ê*>Õ°Ê / iÊÞÊ-«ÀÌÊÃÊÃÌÊV>}ÊiÊ>`ÊÜiÊvÀÊÃÃ>ÀÞÊÃiÀÛVi]Ê>`ÊÌ iÊ Li`iÌÊV ÕÀV ÊVÌÕiÃÊÌÊÃi`ÊÌ iÊÌÊÌ iÊi`ÃÊvÊÌ iÊi>ÀÌ °Ê "iÊ`>ÞÊ>ÃÊÌ iÞÊÜiÀiÊÜÀà «}Ê`ÊpÊÌ iÞÊÜiÀiÊ>ÃÊv>ÃÌ}Ê>ÃÊÌ iÞÊÜ>Ìi`Ê vÀÊ}Õ`>ViÊpÊÌ iÊÞÊ-«ÀÌÊëi\ʺ/>iÊ >À>L>ÃÊ>`Ê->ÕÊ>`ÊVÃÃÊ Ì iÊvÀÊÌ iÊÜÀÊÊ >ÛiÊV>i`ÊÌ iÊÌÊ`°»Ê-ÊÌ iÞÊVÃÃi`ÊÌ ioÊÌ iÞÊ >`Ê >`ÃÊÊÌ iÀÊ i>`ÃÊ>`ÊÃiÌÊÌ iÊvv° VÌÃÊ£Î\Ó]ÎÊ/ iÊ iÃÃ>}i Ç 0!24 %VALUATE 9OUR -ISSIONS 0REPAREDNESS ÜÊ ÃÃÃÊ `i`ÊÃÊ9ÕÀÊ ÕÀV ¶Ê ÊVÃiÊÊ>ÌÊ ÜÊÞÕÀÊV ÕÀV Êi>ÃÕÀiÃÊÕ«ÊÊÌÃÊÃÃÃÊÛÃÊ>`ÊÕÌÀi>V ° ÌiÌÊÃÊ`vwVÕÌÊÌÊi>ÃÕÀi]ÊLÕÌÊÌÊÃÊ«ÃÃLiÊÌÊi>ÃÕÀiÊÃÌÀÞ]ÊÌi>V }Ê>`Ê>V ÌÛÌiÃÊ>`iÊ>Û>>LiÊLÞÊÌ iÊi>`iÀà «Ê>`ÊÌ iÊ«>ÀÌV«>ÌÊ>`ÊÀiëÃiÊvÊÌ iÊV}Ài }>Ì°ÊÊÌ ÀÕ} ÊiÛ>Õ>ÌÊÃÊ>ÊÛ>`ÊiÝiÀVÃiÊÌ >ÌÊÜÊ>ÃÃÃÌÊ>Ê«>ÃÌÀÊ>`ÊV ÕÀV Êi>`iÀà «Ê Êi>ÃÕÀ}ÊÌ iʵÕ>ÌÌÞÊ>`ʵÕ>ÌÞÊvÊÃÃÃÊ>VÌÛÌiÃÊÜÌ ÊÌ iÊV>ÊV}Ài}>Ì° / iÊvÜ}ÊÓäʵÕiÃÌÃÊÜÊ>ÃÃÃÌÊÞÕÊÊiÛ>Õ>Ì}ÊÜ iÀiÊÞÕÊ>ÀiÊÊLÕ`}Ê>ÊÃÌÀ}]Ê ÃÃÃ`i`ÊV ÕÀV °Ê >V ʵÕiÃÌÊ >ÃÊ>ÊÛ>ÕiÊvÊÕ«ÊÌÊwÛiÊ«ÌÃ]Ê`i«i`}ÊÕ«ÊÌ iÊ `i}ÀiiÊvÊÃÕVViÃÃÊÌ iÊ«À}À>ÊÃÊiÝ«iÀiV}°Ê >V ʵÕiÃÌÊà Õ`ÊLiÊ>ÃÜiÀi`ÊV>``ÞÊ >`Ê}À>`i`ÊÊÌ ÃÊ>iÀ\ äÊqÊ Ê>VÌÛÌÞ £ÊqÊ vÕVÌ}Ê«À}À> ÓÊqÊ*À ÎÊqÊ>À {ÊqÊ7ÀÃÊÜi xÊqÊ ÝViiÌÊ«À}À> ÚÚÚÚÊ£°ÊÊ>ÃÊÕÀÊV}Ài}>ÌÊLiiÊÌ>Õ} ÌÊÌ iÊiÌiÀ>ÊÃÌiÃÃÊvÊ>ÊÜ ÊÀiiVÌÊiÃÕÃÊ ÀÃÌÊ ÀÊÜ Ê`iÊÜÌ ÕÌÊ i>À}ÊÌ iÊiÃÃ>}iÊvÊÃ>Û>̶ ÚÚÚÚÊÓ°ÊÊÃÊÀi}Õ>À]ÊvÀiµÕiÌÊÌi>V }Ê}ÛiÊVViÀ}ÊÌ iÊLLV>ÊL>ÃÃÊvÊÃÃÃÊ>`Ê` Û`Õ>ÊÀiëÃLÌÞÊÌÊÀi>V Ê>Ê`Þ}ÊÜÀ`¶ ÚÚÚÚÊΰÊÊ iÃÊÕÀÊV ÕÀV Ê >ÛiÊ>ÊvÕVÌ}ÊÃÃÃÊVÌÌiiÊÌ >ÌÊiiÌÃÊ>ÌÊi>ÃÌÊÃÝÊÌiÃÊ >ÊÞi>ÀÊ>`Ê >ÃÊ>ÊVi>ÀÊÃÌ>ÌiiÌÊvÊ«ÕÀ«Ãi¶ ÚÚÚÚÊ{°ÊÊ>ÃÊÕÀÊV ÕÀV ÊV`ÕVÌi`Ê>Ê>Õ>ÊÃÃÃÊVÛiÌÊ>`ÊÀiViÛi`Êv>Ì Ê«À ÃiÃÊvÀÊ>ÌÊi>ÃÌÊÌ ÀiiÊÞi>Àö ÚÚÚÚÊx°Ê iÃÊiÛiÀÞÊv>ÞÊÕÌÊÊÌ iÊV}Ài}>ÌÊ«>ÀÌV«>ÌiÊÊv>Ì Ê«ÀÃiÊ}Û}¶ ÚÚÚÚÊÈ°Ê iÃÊÕÀÊV ÕÀV Ê >ÛiÊ>ÌÊi>ÃÌÊÃÝÊÃÃ>ÀÞÊëi>iÀÃÊi>V ÊÞi>À¶Ê ÚÚÚÚÊÇ°ÊÀiÊÌ iÊÌ ÞÊÃÃÃÊ-Õ`>ÞÊ«ÀiÃiÌ>ÌÃÊÜiÊ«>i`¶ ÚÚÚÚÊn°ÊÊÀiÊ«i«iÊÜiÊvÀi`ÊvÊÌ iÊii`ÃÊ>`ÊÛVÌÀiÃÊvÊÃÃ>ÀiÃÊÌ iÊV ÕÀV ÊÊ ÃÕ««ÀÌö ÚÚÚÚÊ°ÊÊ iÃÊÌ iÊV}Ài}>ÌÊ«À>ÞÊÀi}Õ>ÀÞÊ>`Ê«ÕLVÞÊvÀÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊëiVwVÊ ii`ö ÚÚÚÚÊ£ä°ÊÊÃÊÃÃÃÊ } } Ìi`ÊÜÌ Ê>Ê>ÌÌÀ>VÌÛi]ÊÜi«>Vi`ÊLÕiÌÊL>À`ÊÌ >ÌÊÃÊÊ vÀiµÕiÌÞÊÕ«`>Ìi`¶ ÚÚÚÚÊ££°Ê iÃÊÕÀÊV ÕÀV ÊVÕV>ÌiÊÀi}Õ>ÀÞÊÜÌ ÊÌ iÊÃÃ>ÀiÃÊÜiÊÃÕ««À̶ n ÚÚÚÚÊ£Ó°ÊÊÃÊ>VÌÛiÊ«>ÀÌV«>ÌÊiVÕÀ>}i`ÊLÞÊ>Ê`i«>ÀÌiÌÃÊÊÌ iÀÊÃÃÃÊ«À}À>Ã¶Ê ]Ê-/ ]Ê / ]Ê>`Ê7 Ã®Ê ÚÚÚÚʣΰÊÊÃÊ>Ê«>i`Ê«À}À>ÊÊ«>ViÊvÀÊÌi>V }ÊÃÃÃÊÊ-Õ`>ÞÊÃV ]ÊVÕ`}ÊiÜÊ LiiÛiÀÃÊ>`ÊiLiÀà «ÊV>ÃÃiö ÚÚÚÚÊ£{°ÊÊ iÃÊÕÀÊV ÕÀV ÊÃÕ««ÀÌÊÃÃiLiÃÊvÊ`ÊÃÃÃÊ>`ÊÃÃ>ÀiÃÊÊ>ÊÊ Ì ÞÊL>Ãö ÚÚÚÚÊ£x°ÊÊ iÃÊÕÀÊV ÕÀV ÊëÃÀÊÀÊ«>ÀÌV«>ÌiÊÊÃÃÃÊÕÌÀi>V iÃ]ÊiÌ iÀÊÊÌ iÊ1Ìi`Ê -Ì>ÌiÃÊÀÊÛiÀÃi>ö ÚÚÚÚʣȰÊÊ ÊÌ iÊV ÕÀV ½ÃÊÃÃÃÊi>`iÀÃÊ>ÌÌi`ÊÃÃÃÊvÕVÌÃÊëÃÀi`ÊLÞÊÌ iÊ`ÃÌÀVÌÊ ÀÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê>`Ê1°-°Ê ÃÃö ÚÚÚÚÊ£Ç°Ê ÊÃÃ>ÀiÃÊviiÊÜiViÊÜ iÊÌ iÞÊÛÃÌÊÕÀÊV ÕÀV ¶ ÚÚÚÚÊ£n°ÊÃÊ>ÌÌi`>ViÊÃÌ>LiÊ>ÌÊÃÃÃÊÃiÀÛViö ÚÚÚÚÊ£°Ê iÃÊÌ iÊV ÕÀV Ê >ÛiÊ>ÊÜiÃÌVi`ÊÃiVÌÊÊÃÃÃÊÊÌ iÊV ÕÀV ÊLÀ>ÀÞ¶ ÚÚÚÚÊÓä°ÊÊ ÊV ÕÀV Êi>`iÀÃÊÃiiÊÌ iÊÃÃÃÊ>`>ÌiÊvÊÜ}ÊÌ iÊÃÌÊ>ÃÊÌ iÊV ÕÀV ½ÃÊVi ÌÀ>Ê«ÕÀ«Ãi]Ê>ÀÕ`ÊÜ V Ê>ÊÌ iÀÊ>VÌÛÌiÃÊÀiÛÛi¶ /Ì>ÊÌ iÊ«ÌÃÊvÀÊÞÕÀÊÀiëÃiÃÊÌÊÃiiÊ ÜÊ i>Ì ÞÊÞÕÀÊV ÕÀV ½ÃÊÃÃÃÊÕÌÀi>V Êð £ääÊqÊn£ÊrÊ ÝViiÌ ÊÊnäÊqÊÈnÊrÊ6iÀÞÊ}` ÊÊÈÇÊqÊxxÊrÊ`]ÊLÕÌÊii`ÃÊ i« ÊÊx{ÊqÊÊÊäÊrÊÊÃÊÌÊÃÌiÀ}ÊÌÊÌ iÊii`ÃÊvÊÌ iÊV}Ài}>ÌÊ>`ÊÀiµÕÀiÃÊi`>ÌiÊ >ÌÌiÌÊ ÜÊ``ÊÞÕÀÊV ÕÀV Êi>ÃÕÀiÊÕ«¶ÊvÊÌ iÊÀiÃÕÌÃÊÜiÀi½ÌÊ}`]ÊÌ>iÊ i>ÀÌ°Ê/ ÃÊ>Õ>ÊÜÊ >ÃÃÃÌÊÞÕÊÊi>`}ÊÞÕÀÊV}Ài}>ÌÊÌÊ>Ê i>Ì ÞÊ>ÌÌÌÕ`iÊ>LÕÌÊÃÃÃÊ>`Ê>Ê } ÊiÛiÊvÊ ÛÛiiÌÊÊÀi>V }ÊÌ iÊÃÌÊÜÀ`ÊÊÕÀÊ}iiÀ>Ìt *>ÃÌÀ]Ê9ÕÊÀiÊ/ iÊ iÞÊ iÊ«>Ì ÊV ÃiÊLÞÊÌ iÊ«>ÃÌÀÊÜÊ`iÌiÀiÊÜ iÀiÊÌ iÊV}Ài}>ÌÊ}iðÊÌÊ >ÃÊLiiÊÃ>`]Ê /º ÊÃÌÀi>ÊÜÊÀÃiÊ } iÀÊÌ >ÊÌÃÊÃÕÀVi°»Ê-ÊÌÊÃÊÜÌ Ê>ÊV ÕÀV °Ê/ iÊV}Ài}>ÌÊÃÊÕ iÞÊÌÊÛiÊÌ iÊÃÌÊ>`Ê`iÛi«Ê>ÊÜÀ`ÊÛÃÊÕiÃÃÊÌ iÊ«>ÃÌÀÊ`iÃÊÌ >ÌÊ>ÌÌÌÕ`i° ÃÌÊ>`Ê ii}>Ìi ÃÊ«>ÃÌÀ]ÊÞÕÊV>ÌÊ`Ê>ÊÌ iÊÜÀÊ>i°Ê/Ê>ÞÊ >ÛiÊÌÀi`Ê>`ÊLiViÊiÝ >ÕÃÌi`Ê>`Ê `ÃVÕÀ>}i`Ê>ÌÊÌ iÊ>VÊvÊÀiÃÕÌðÊ/ >ÌÊÃÊÜ ÞÊÞÕÊii`Ê>ÊÌi>ÊÌÊvÜÊÞÕÀÊi>`iÀà «ÊÊ Ã«À}ÊÌ iÊV}Ài}>ÌÊÜÌ Ê>ÊÛÃÊ>`Ê«>ÃÃÊvÀÊÃÃÃ°Ê *Ài>V Ê ÃÃÃÊ ÊÃÃ>ÀÞÊÃÊÌÊ>ÊÃÕÀÀ}>ÌiÊvÀÊÌ iÊ«>ÃÌÀÊÌÊÌi>V ÊÃÃÃÊÌÊÌ iÊV}Ài}>Ì°Ê/ÀÕi]ÊÌ iÊ «>ÃÌÀÊà Õ`ÊÌ>iÊ>`Û>Ì>}iÊvÊÌ iÊÃÃ>ÀÞ½ÃÊ«ÀiÃiViÊÌÊvÀÊ>`ÊëÀiÊÌ iÊ«i«i°Ê ÕÌÊ vÊÌ iÊ«>ÃÌÀÊÃÊÌÀÕÞÊVÌÌi`ÊÌÊÃÃÃ]Ê iÊÜÊ«Ài>V ÊÃÃÃt ÊL>VÊÛiÀÊÌ iÊÀiVÀ`ÊvÊÞÕÀÊÃiÀÃÊ«Ài>V i`Ê`ÕÀ}ÊÌ iÊ«>ÃÌÊÞi>À°ÊÜÊ>ÞÊvÊÌ iÊ «ÀiÃiÌi`ÊÌ iÊÃÃÃÊiÃÃ>}i¶ÊvÊÌ iÊ«>ÃÌÀÊ`iýÌÊà ÜÊ>Ê«>ÃÃÊvÀÊÃÃÃ]ÊÌ iÊV}Ài}> ÌÊÃÊÌÊiÞÊÌÊ}iÌÊiÝVÌi`ÊiÌ iÀ°ÊëiVÌÊÞÕÀÊ«ÀÀÌiðÊ*i«iÊÕÃÌÊLiÊi`ÊLÞÊiÝ>«i° ÌÊÞÊà Õ`Ê>Ê«>ÃÌÀÊ«Ài>V ÊÃÃÃÊÌÊ ÃÊV}Ài}>Ì]ÊLÕÌÊ iÊ>ÃÊà Õ`Êà ÜÊ ÃÊ ÛiÊ>`ÊVViÀÊvÀÊÃÃÃÊLÞÊÕÃ}ÊÃÃ>ÀÞÊÕÃÌÀ>ÌÃÊÊ ÃÊÀi}Õ>ÀÊÃiÀðÊ/Ê`Ê Ì Ã]Ê iÊÕÃÌÊÃÌ>ÞÊvÀi`Ê>LÕÌÊÃÃð -V i`ÕiÊ ÃÃ>ÀÞÊ-«i>iÀà *Ài>V }ÊÃÃÃÊÃÊÌÊÌ iÊÞÊÜ>ÞÊ>Ê«>ÃÌÀÊV>Êà ÜÊiÌ ÕÃ>ÃÊvÀÊÃÃðÊ-V i`Õ}Ê ÃÃ>ÀÞÊëi>iÀÃÊ`ÕÀ}ÊÌ iÊÞi>ÀÊëi>ÃÊÛÕiÃÊÌÊÞÕÀÊV}Ài}>ÌÊ>LÕÌÊÌ iÊ«>ViÊvÊà ÃÃÊÊÞÕÀÊ«ÀÀÌiðÊ7 iÊ«ÃÃLi]ÊÃÃ>ÀiÃÊà Õ`Êëi>ÊÌÊÌ iÊV ÕÀV Ê>ÊÕÊvÊ ViÊi>V ʵÕ>ÀÌiÀ°ÊÌÊÃÊ`vwVÕÌÊÌÊ>Ì>Ê>ÊÛÃÊvÀÊÃÃÃÊÜÌ ÊviÜiÀÊÃÃ>ÀÞÊÛÃÌð Ê}`ÊÜ>ÞÊÌÊ`iÃÌÀ>ÌiÊÞÕÀÊVÌiÌÊÌÊÃÃÃÊÃÊLÞÊÃiÌÌ}Ê>ÊiÝ>«iÊvÊ}iiÀ ÕÃÊÃÃÃÊ}Û}°Ê iÊÌ iÊwÀÃÌÊÌÊ}Ûi]Ê>`Êi>`ÊÞÕÀÊV}Ài}>ÌÊÌÊ>ÊiÜÊ«>Ì ÊvÊëÀÌÕ>Ê Li`iVi°Ê/ iÊVÌÌi`Ê ÀÃÌ>ÊÃÊ>Ê}iiÀÕÃÊ ÀÃÌ>° ÌÌi`Ê>`Ê-Õ««ÀÌÊ ÃÃÃÊVÌÛÌiÃÊ *>ÃÌÀÃÊÃiÌÊ>ÊiÝ>«iÊLÞÊÌ iÀÊ>ÌÌÌÕ`i]Ê«Ài«>À>ÌÊ>`Ê}Û}]Ê>ÃÊÜiÊ>ÃÊLÞÊÌ iÀÊ«ÀiÃiViÊÊ ÃÃ>ÀÞÊ>VÌÛÌiÃÊV`ÕVÌi`ÊLÞÊÌ iÊV>ÊV}Ài}>Ì° -iÌiÃÊ«>ÃÌÀÃÊÕÌiÌ>ÞÊÃi`Ê>ÊÜÀ}ÊiÃÃ>}iÊÌÊÌ iÀÊV}Ài}>ÌÃÊLÞÊÃÃ}Ê ÃÃÃÊL>µÕiÌÃÊ>`ÊÃiÀÛViÃÊvÀÊÛ>ÀÕÃÊÀi>Ãð À>ÌivÕÞ]ÊÃÌÊ«>ÃÌÀÃÊÜÕ`ÊiÛiÀÊ`ÊÌ Ã°Ê ÕÌÊÌ iÞÊÕÃÌÊ>Ü>ÞÃÊLiÊ>Ü>ÀiÊÌ >ÌÊÌ iÞÊÃi`Ê Ã}>ÃÊÌ >ÌÊÀiÛi>ÊÌ iÀÊ>ÌÌÌÕ`iÊÌÊÌ iÊ«i«iÊÌ iÞÊi>`° *À>ÞÊvÀÊ ÃÃ>Àià ii«ÊÃÃ>ÀiÃÊLivÀiÊÌ iÊV}Ài}>Ì°Ê*À>ÞÊ«ÕLVÞÊvÀÊÃÃ>ÀiÃ°Ê iÃ}>ÌiÊ>ÊëiV>Ê LÕiÌÊi>V ÊÌ ÊÌ >ÌÊVÕ`iÃÊ«À>ÞiÀÊÀiµÕiÃÌÃÊvÀÊÌ iÊÃÃ>ÀiÃÊÌ iÊV ÕÀV ÊÃÕ««ÀÌÃ°Ê *>ÃÌÀ]Ê9ÕÊÀiÊÌ iÊ Ý>«iÊ >ÞÊÌ iÊÞÊ-«ÀÌÊV >i}iÊÞÕÊÌÊÌ iÊ } iÃÌÊiÝ>«iÊÊà Ü}ÊÞÕÀÊV}Ài}>ÌÊÛiÊ >`ÊV«>ÃÃÊvÀÊ>ÊÃÌÊ>`Ê`Þ}ÊÜÀ`°Ê->ÞÊ>}ÊÜÌ ÊÌ iÊ>«ÃÌiÊ*>Õ]ʺÜÊÞÊiÝ >«iÊ>ÃÊÊvÜÊÌ iÊiÝ>«iÊvÊ ÀÃÌ»Ê£Ê ÀÌ >ÃÊ££\£]Ê 6®° 9ÕÊ>ÀiÊÌ iÊÞÊiÊÜ ÊV>Êi>`ÊÞÕÀÊV}Ài}>ÌÊÌÊLi`iViÊÌÊ ÀÃ̽ÃÊV>`Ê Ì >ÌÊiÛiÀÞÊ ÀÃÌ>ÊLiÊÛÛi`ÊÊiÛ>}iâ}ÊÌ iÊÜÀ`t £ä Ê ÃÃÃÊ ÌÌii]ÊÊ ÃÃÃÊ >À`p ÃÊ/ iÀiÊ>Ê iÌÌiÀÊ >i¶ ÃÌÊV ÕÀV iÃÊ`ÊÌÊ >ÛiÊ>ÊÃÃÃÊVÌÌii°Ê/ ÃÊÃÊÌÊÃÕÀ«ÀÃ}]ÊÃViÊ{ÎÊ«iÀViÌÊ vÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊÀi«ÀÌi`ÊÊÃÃ>ÀÞÊëi>iÀÃÊ`ÕÀ}ÊÌ iÊ«>ÃÌÊÞi>À°Ê / >vÕÞ]ÊÌ ÕÃ>`ÃÊvÊÃÃiLiÃÊvÊ`ÊV}Ài}>ÌÃÊ>ÀiÊ>VÌÛiÊÊÃÃÃÊ>`Ê >ÛiÊ vÕVÌ}ÊÃÃÃÊVÌÌiiÃÊÀÊÃÃÃÊL>À`Ã°Ê ÕÌÊ >ÛiÊÞÕÊiÛiÀÊÌVi`ÊÌ >ÌÊÌ iÊÜÀ`ÃÊ VÌÌiiÊ>`ÊL>À`Ê`½ÌÊV>ÕÃiÊÕV ÊiÝVÌii̶Ê7iÊvÀÊVÌÌiiÃÊ>`ÊL>À`ÃÊvÀÊÕÃÌÊ >LÕÌÊ>ÞÌ }ÊÌ >ÌÊÌ>iÃÊ«>ViÊÊÌ iÊV>ÊV ÕÀV ° / iÊ«ÕÀ«ÃiÊvÊ>ÊVÌÌiiÊÀÊL>À`ÊÃÊÌÊiÌÀÕÃÌÊ>ÊviÜÊ«i«iÊÜÌ ÊÌ iÊÀiëÃLÌÞÊvÊ V`ÕVÌ}ÊViÀÌ>ÊLÕÃiÃÃÊÀÊ>}ÊViÀÌ>Ê«>ðÊ/ iÊV}Ài}>ÌÊÕÃÕ>ÞÊ`iýÌÊ«>ÀÌV «>ÌiÊÊÀÊ >ÃÊÜi`}iÊvÊÌ iÊ«>ÃÊ>`iÊLÞÊÌ iÊ>ÛiÀ>}iÊVÌÌiiÊÀÊL>À`° ÃÃÃÊà Õ`ÊiÛiÀÊLiÊÀii}>Ìi`ÊÌÊ>ÊviÜÊ«i«i°ÊÃÌi>`]ÊÌÊà Õ`ÊLiÊÌ iÊ«>ÃÃÊvÊÌ iÊ Ü iÊV}Ài}>Ì°ÊÀÊÌ >ÌÊÀi>Ã]Ê>ÊLiÌÌiÀÊÌiÀÊvÀÊ>ÊÃÃÃÊVÌÌiiÊÀÊÃÃÃÊL>À`Ê ÃÊ>ʺ ÃÃÃÊÜ>ÀiiÃÃÊ/i>°»Ê/ ÃÊ>iÊÜÊVi>ÀÞÊ`iÌvÞÊÌ ÃiÊ«i«iÊiÌÀÕÃÌi`ÊÜÌ Ê iÃÌ}ÊÌ iÊ«>ÀÌV«>ÌÊvÊiÛiÀÞÊLiiÛiÀÊÊÌ iʵÕiÃÌÊvÀÊÜÀ`ÊiÛ>}iâ>Ì° "Ì iÀÊÜÀÊ>ÞÊLiÊ`iÊLÞÊVÌÌiiÃ]ÊLÕÌÊiÌÊÃÃÃÊLiÊ}Õ`i`ÊLÞÊ>ÊÌi>°ÊÊÌi>ÊÃÕ} }iÃÌÃÊÛiiÌÊ>`ÊiÝVÌiiÌ°ÊÌÊÃÕ}}iÃÌÃÊ>VÌÛiÊ«>ÀÌV«>ÌÊÀ>Ì iÀÊÌ >Ê«>ÃÃÛÌÞ°ÊÊÌi>ÊÃÊ i`ÊLÞÊÌ«Êi>`iÀà «Ê>`Êà ÜÃÊÌ iÊÜ>ÞÊvÀÊÌ iÀÃÊÌÊvÜ°ÊÊÌi>ÊiÃÌÃÊÌ iÊÃÌʵÕ>wi`Ê iLiÀÃÊ>`Ê`i>`ÃÊ>ÌÌiÌÊvÀÊiÛiÀÞi°ÊÊÌi>ÊLÕ`ÃÊÞ>ÌÞÊÌÊ>ÊV>ÕÃi°ÊÊÌi>ÊÃÕ} }iÃÌÃÊÜ}]Ê>`ÊÜiÊ>ÊÜÊÜ iÊÜiÊ}iÌÊÛÛi`ÊÊÃÃð Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊ>ÊiÝÌiÃÊvÊÌ iÊ«>ÃÌÀÊ>`ÊV ÕÀV ÊL>À`Ê>`Ê>ÃÃÃÌÃÊ Ì iÊÊÃiÌÌ}ÊÜÀ`ÊÛÃÊ>`ÊiÃÌ}ÊÌ iÊ«iÀÃ>Ê«>ÀÌV«>ÌÊvÊiÛiÀÞÊLiiÛiÀÊÊLiÞ }Ê ÀÃ̽ÃÊV>`ÊÌʺÊÌÊ>ÊÌ iÊÜÀ`°» ½ÌÊÞÕÊÌ ÊÞÕÀÊV ÕÀV Êii`ÃÊ>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>¶ ££ 0!24 &ORMING A 4EAM 7 ÞÊ>ÛiÊ>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>¶Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊÌÊii`i`ÊÕiÃÃÊV ÕÀV Êi>`iÀÃÊ>ÀiÊÃiÀÕÃÊ>LÕÌÊLiÞ}Ê ÊÌ iÊV>`ÃÊvÊ ÀÃÌ°Ê ÕÌÊViÊÌ ÃÊVÌiÌÊÃÊ>`i]Ê>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê ÃÊiÃÃiÌ>ÊÊLÕ`}ÊÃÃÃÊÛÃÊ>`Ê«>Ãð / iÃiÊ>ÀiÊÕÃÌÊ>ÊviÜÊvÊÌ iÊLiiwÌÃÊvÊVÀi>Ì}Ê>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊvÀÊÌ iÊÊ V>ÊV ÕÀV \Ê £°ÊÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÊ i«ÊiÃÌ>Là ÊÃÃÃÊ>ÃÊ>Ê«À>ÀÞÊ«ÕÀ«ÃiÊvÊ Ì iÊV>ÊV ÕÀV °Ê-iÊÜʵÕiÃÌÊÜ iÌ iÀÊÃÃÃÊà Õ`ÊLiÊ>Ê«ÀÀÌÞ]ÊLÕÌÊ>Ê iÃÌÊÃÌÕ`ÞÊvÊ-VÀ«ÌÕÀiÊÜÊi>ÛiÊÊ`ÕLÌÊ>LÕÌÊÌ°Ê ÀÃÌÊ`i`ÊÌÊÃ>ÛiÊÌ iÊÜÀ`]Ê >`ÊiÊiÌÀÕÃÌi`ÊÌ iÊ ÕÀV ÊÜÌ ÊÌ iÊÀiëÃLÌÞÊvÊÌ>}ÊÌ iÊ}`ÊiÜÃÊÌÊ iÛiÀÞÊVÀiÀÊvÊÌ iÊ}Li°Ê ÕÌÊÜiÊ >ÛiÊÞiÌÊÌÊwà ÊÕÀÊÌ>ð Ó°ÊÊÊ>VÌÛiÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÊ} ÌiÊÌ iÊ«>ÃÌÀ½ÃÊÜÀ>`°Ê/ ÃÊ`iýÌÊ i>ÊÌ iÊ«>ÃÌÀÊÜÊÀii}>ÌiÊ>ÊÀiëÃLÌÞÊÌÊÌ iÀÃ]ÊLÕÌÊ iÊÜÊ >ÛiÊ i«ÊÊ vÕw}ÊÌ iÊÃÃÃÊÛÃÊvÊÌ iÊV>ÊV}Ài}>Ì°Ê/ iÊ«>ÃÌÀÊÜÊ>ÌÌi`Ê>`Ê «>ÀÌV«>ÌiÊÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊiiÌ}ÃÊÜ iÊ«ÃÃLi°ÊiÊÜÊi>`ÊLÞÊ iÝ>«iÊ>`Êà >ÀiÊ ÃÊÛÃÊÜÌ ÊÌi>ÊiLiÀÃÊÃÊÌ >ÌÊÌ iÞÊ >ÛiÊ>ÊVi>ÀÊ«VÌÕÀiÊvÊ Ì iÀÊ`iÃÌ>Ì° ΰÊÊÊ>VÌÛiÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÊiÃÌÊ}Ài>ÌiÀÊ«>ÀÌV«>ÌÊvÀÊ`i«>ÀÌ iÌÊi>`iÀÃÊ>ÃÊÜiÊ>ÃÊÌ iÊiÌÀiÊV}Ài}>Ì°ÊÌÊViÃÊ>ÃÊÊÃÕÀ«ÀÃiÊÌ >ÌÊÜÌ Ê «À«iÀÊi>`iÀà «]ÊÌ iÊÀiÊ«i«iÊÜ Ê>ÀiÊÛÛi`]ÊÌ iÊÀiÊÜÀÊÜÊLiÊÊ >VV«Ã i`°Ê {°ÊÊ-i`ÊV>Êi>`iÀÃÊiÃV>«iÊVÀÌVÃ°Ê ÕÌÊ«i«iÊ`½ÌÊVÀÌVâiÊÜ >ÌÊÌ iÞÊ`Ê«iÀà >Þ°Ê/ iÀivÀi]ÊvÊÞÕÊÜ>ÌÊÌÊâiÊVÀÌVÃ]Ê}iÌÊÀiÊ«i«iÊÛÛi`°Ê"LÛ ÕÃÞ]ÊÜ iÊÀiÊ«i«iÊ>ÀiÊÛÛi`ÊÊ«ÀÌ}Ê>ÊÃÃÃÊÛÃ]ÊÌ iÊV}Ài}> ÌÊÜÊ}ÛiÊÀiÊ>ÌÌiÌÊÌÊÃÃð x°ÊÊ"iÊvÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>½ÃÊ}Ài>ÌiÃÌÊÀiëÃLÌiÃÊÃÊÌÊLÀ}Ê>ÊVi>ÀiÀÊ Õ`iÀÃÌ>`}ÊvÊiÛiÀÞÊiLiÀ½ÃÊ«iÀÃ>ÊÀiëÃLÌÞÊÌÊvÕwÊÌ iÊÀi>ÌÊ ÃðÊ/ >ÌÊÀiëÃLÌÞÊÃÊiÝ«ÀiÃÃi`ÊÌ ÀÕ} Ê«iÀÃ>Êv>Ì Ê«ÀÃiÃÊ>`iÊ`ÕÀ }ÊÌ iÊÃÃÃÊVÛiÌ° È°ÊÊiÜÊV ÕÀV ÊL>À`ÃÊ >ÛiÊÌ iÊÌiÊÌÊ}ÛiÊÃÃÃÊÌ iÊ>ÌÌiÌÊÌÊ`i>`ÃÊ>`Ê`i ÃiÀÛiðÊ7 iÊ>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊvÀi`]ÊÌ iÊiÌÀiÊV ÕÀV ÊÜÊLiiwÌ°Ê / iÊL>À`ÊÜÊ >ÛiÊÀiÊÌiÊÌÊ`iÛÌiÊÌÊ>`ÃÌÀ>ÌÛiÊ>vv>ÀÃÊvÊÌ iÊV ÕÀV °Ê ÃÃÃÊÜÊLiiwÌÊLiV>ÕÃiÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÊVÌÊÀiÊÌiÊ >`Ê>ÌÌiÌÊÌÊÌ iÊÃÃÃÊÕÌÀi>V ÊvÊÌ iÊV>ÊV}Ài}>Ì° £Ó ÜÊÌÊÀÊ>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i> 7 ÞÊ >½ÌÊ/ iÊ ÕÀV Ê >À`ÊÃÊ iÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>¶ UÊÊ/ iÊV ÕÀV ÊL>À`ÊÃiÀÛiÃÊ>ÃÊÌ iÊÃÃÃÊVÌÌiiÊÊ>ÞÊV ÕÀV iÃ]ÊLÕÌÊÌ iÊL>À`ÊÃi `Ê >ÃÊÌ iÊÌiÊii`i`ÊÌÊ}ÛiÊ«À«iÀÊ>ÌÌiÌÊÌÊÌ iÊVÀÌV>Ê>Ài>ÊvÊÃÃÃ°Ê UÊ ÃiµÕiÌÞ]Ê>ÞÊV ÕÀV iÃÊ >ÛiÊ`ÃVÛiÀi`ÊÌ >ÌÊ>ÊÃi«>À>ÌiÊ}ÀÕ«ÊÃÊÀiÊ`iÃÀ>Li°Ê UÊÊ/ iÊ«>ÃÌÀÊ>`Ê>ÊiLiÀÊvÊÌ iÊV ÕÀV ÊL>À`ÊVÕ`ÊÀi«ÀiÃiÌÊÌ iÊL>À`Ê>ÃÊiLiÀÃÊvÊ Ì iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>° ÜÊ >À}iÊ- Õ`Ê/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê i¶ UÊ/ ÃÊ`i«i`ÃÊÕ«ÊÌ iÊÃâiÊvÊÌ iÊV ÕÀV Ê>`ÊÌÃÊÃÃÃÊÛÛiiÌ°Ê UÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê>ÞÊ >ÛiÊ>ÃÊviÜÊ>ÃÊÌ ÀiiÊiLiÀð UÊ/ÜÊVÕ«iÃÊÜÌ Ê>ÊÃÌÀ}ÊÌiÀiÃÌÊÊÃÃÃÊV>ÊvÀÊÌ iÊVÀiÊvÊÞÕÀÊÌi>° UÊÊ1ÃÕ>Þ]ÊÌ iÊ>À}iÀÊÌ iÊV ÕÀV ]ÊÌ iÊ>À}iÀÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Êii`ÃÊÌÊLi°ÊÜ iÛiÀ]ÊÞÕÊÜÊw`ÊÌ >ÌÊÌ iÊ>À}iÀÊÌ iÊ}ÀÕ«]ÊÌ iÊÀiÊ`vwVÕÌÊÌÊÃÊÌÊw`Ê>ÊÌiÊÜ iÊ iÛiÀÞiÊV>ÊiiÌ° UÊÊÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÌ ÊvÕÀÊÌÊÃÝÊiLiÀÃÊÃʵÕÌiÊ>>}i>Li°ÊvÊÞÕÊV ÃiÊ ÌÊ >ÛiÊ>Ê>À}iÀÊ}ÀÕ«]ÊVÃ`iÀÊ>}Ê>Ê ÃÃÃÊÜ>ÀiiÃÃÊ ÝiVÕÌÛiÊ/i>ÊÌÊV`ÕVÌÊ Ì iÊÌ ÞÊLÕÃiÃÃÊ>`ÊiiÌÊÜÌ ÊÌ iÊvÕÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê>ÃÊii`i`ÊvÀÊ«> }ÊÌ iÊÃÃÃÊVÛiÌÊ>`ÊÌ iÀÊ>VÌÛÌiÃ°Ê UÊÊ Ã`iÀÊ>Ã}ÊÀi«ÀiÃiÌ>ÌÛiÃÊvÊÛ>ÀÕÃÊ`i«>ÀÌiÌÃÊÊÌ iÊV ÕÀV Ê ÕÃV]Ê ÀÃÌ>Ê `ÕV>Ì]Ê-iÀÊ`ÕÌÃ]Ê`ÕÌÃ]Ê-}iÃ]Ê7i½ÃÊ ÃÌÀiÃ]Ê i½ÃÊ ÃÌÀiÃ]Ê9ÕÌ Ê >`Ê `Ài®ÊÌÊÃiÀÛiÊ>ÃÊiLiÀÃÊvÊÌ iÊvÕÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>° 7 >ÌÊ- Õ`Ê iÊ/ iÊ+Õ>wV>ÌÃÊÀÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê iLiÀö UÊ/ iÞÊÕÃÌÊLiÊ>VÌÛiÊiLiÀÃÊÊÌ iÊV>Ê>ÃÃiLÞ° UÊ/ iÞÊÕÃÌÊ`iÃÌÀ>ÌiÊ>ÊV«iÀ>ÌÛiÊëÀÌ]ÊÜ}ÊÌÊvÜÊ>ÃÊÜiÊ>ÃÊi>`° UÊÌÊi>ÃÌÊiÊiLiÀÊà Õ`Ê`iÃÌÀ>ÌiÊÀ}>â>Ì>Ê>LÌÞ°Ê UÊ/ iÞÊÕÃÌÊLiÊv>Ì vÕÊÊV ÕÀV Ê>ÌÌi`>ViÊ>`ÊÌÌ }°ÊÊ UÊÊ/ iÞÊÕÃÌÊLiÊÜ}ÊÌÊ`iÛÌiÊ>ÊÕÊvÊÃÝÊÌÊi} ÌÊ ÕÀÃÊvÊÌ iÀÊÌiÊi>V ÊÌ Ê ÌÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê`ÕÌið UÊ}iÊà Õ`ÊÌÊLiÊ>Êv>VÌÀÊvÊ>ÊÌ iÀÊÀiµÕÀiiÌÃÊ>ÀiÊiÌ° UÊ-}iÃÊà Õ`ÊLiÊÀi«ÀiÃiÌi`° UÊÊ >ÀÀi`ÊiLiÀÃÊ>ÀiÊÀiÊivviVÌÛiÊÜ iÊÌ iÞÊÃiÀÛiÊÜÌ ÊÌ iÀÊëÕÃiÃ]Ê>}ÊÌ iÊ>Ê Ìi>ÊÜÌ Ê>ÊÌi>° UÊ Ì ÊÌ iÊ«>ÃÌÀÊ>`ÊÌ iÊV ÕÀV ÊL>À`ÊÕÃÌÊÀiVi`ÊÌ i° UÊ/ iÊ«>ÃÌÀÊà Õ`ÊLiÊ>ÊiLiÀ° UÊÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊiLiÀÃÊÕÃÌÊ>viÃÌÊ>ÊÛiÊvÀÊÌ iÊÃÌ]Ê`ÀÛ}ÊÌ iÊÊÌ iÀÊ «>ÃÃÊvÀÊÀi>V }ÊÌ iÊÜ iÊÜÀ`°Ê/ iÊ`i«Ì ÊvÊÌ ÃÊÛiÊÃÊ`iÃÌÀ>Ìi`ÊLÞÊÌ iÀÊ v>Ì vÕiÃÃÊÌÊ«À>ÞÊvÀÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊ}iiÀÕÃÊÌ ÞÊv>Ì Ê«ÀÃiÊ}Û}°Ê Ê iÊà Õ`Ê >ÛiÊÌ iÊ«ÀÛi}iÊvÊ>}Ê`iVÃÃÊVViÀ}ÊÌ iÊ`ÃLÕÀÃiiÌÊvÊÃÃÃÊ vÕ`ÃÊvÊ iÊÀÊà iÊÃÊÌÊ>Ê}iiÀÕÃÊ}ÛiÀÊÌÊÌ >ÌÊvÕ`°Ê £Î ÜÊ- Õ`Ê/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê iÊ Ãi¶ UÊ-iÊV ÕÀV iÃÊiiVÌÊÌi>ÊiLiÀÃ°Ê UÊ"Ì iÀÃÊ>VVi«ÌÊÛÕÌiiÀÊiLiÀð UÊÊÃiÊV ÕÀV iÃ]ÊÌ iÊV ÕÀV ÊL>À`Ê>««ÌÃÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊiLiÀÃ°Ê UÊÊ/ iÊÀiÊ«ÀiviÀ>LiÊiÌ `ÊvÊÃiiVÌ]Ê ÜiÛiÀ]ÊÃiiÃÊÌÊLiÊÌ iÊ>ÌÊvÊiÜÊ iLiÀÃÊLÞÊÌ iÊ«>ÃÌÀÊ>`ÊÌ iÊVÕÀÀiÌÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>]ÊÜÌ ÊÀ>ÌwV>ÌÊLÞÊÌ iÊ V ÕÀV ÊL>À`° ÜÊ }Ê- Õ`Ê >V Ê iLiÀÊ-iÀÛi¶ UÊ"iÊÞi>ÀÊ>ÞÊLiÊÌÊLÀiv° UÊÊÊÌiÀÊvÊÌÜÊÌÊÌ ÀiiÊÞi>ÀÃÊÃÊÀiÊivviVÌÛi]ÊÜÌ ÊÌ iÊ«ÃÃLÌÞÊvÊÃÕVViÃÃÛiÊÌiÀÃÊvÊ Ài>Ìi`ÊLÞÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê>`ÊÌ iÊV ÕÀV ÊL>À`]ÊÊ UÊ/iÀÃÊà Õ`ÊLiÊÃÌ>}}iÀi`ÊÃÊÌ >ÌÊiÝ«iÀiVi`ÊiLiÀÃÊ>ÀiÊ>Ü>ÞÃÊÛÛi`°Ê UÊÊ >ÞÊV ÕÀV iÃÊ >ÛiÊ>ÊÃÌ>`}Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>]ÊÜ V Êi>ÃÊÌ >ÌÊiLiÀÃÊ ÃiÀÛiÊÜÌ ÕÌÊ>ÊÌiÊÌ°Ê/ ÃÊ >ÃÊÌ iÊ>`Û>Ì>}iÊvÊ>Ü>ÞÃÊ >Û}ÊiÝ«iÀiVi`Ê«i«iÊÊ Ì iÊÌi>°Ê iÊV>ÀivÕ]Ê ÜiÛiÀ]ÊÌÊiÃÕÀiÊÌ >ÌÊiÜÊ>`ÊÞÕ}iÀÊiLiÀÃÊ>ÀiÊÌÊiÝVÕ`i`Ê vÀÊ«>ÀÌV«>ÌÊÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>° £{ 0ART 0REPARING A -ISSIONS 3TRATEGY Ài>Ì}Ê ÃÃÃÊ*VÞ 7 ÞÊ Ài>ÌiÊÊ ÃÃÃÊ*VÞ¶ UÊÊ/ÊiÃÕÀiÊÌ >ÌÊÌ iÊÃÃÃÊÕÌÀi>V ÊvÊÌ iÊV>ÊV}Ài}>ÌÊÃÊ}ÛiÊÌ«Ê«ÀÀÌÞÊÊ «À>ÞiÀ]Êw>V>ÊÃÕ««ÀÌÊ>`Êi`ÕV>ÌÊÊiÛiÀÞÊ`i«>ÀÌiÌÊvÊÌ iÊV ÕÀV Ê>ÃÊÌ iÊV}Ài}> ÌÊÃiiÃÊÌÊLiÞÊÌ iÊÀi>ÌÊ Ãð UÊÊ/Ê>ÃÃÃÌÊÊ«ÀÛ`}Ê>ÊVÀ`>Ìi`ÊÃÃÃÊivvÀÌÊÌ >ÌÊÜÊLiÊÕÌÕ>ÞÊLiiwV>ÊÌÊLÌ Ê Ì iÊV>ÊV}Ài}>ÌÊ>ÃÊÜiÊ>ÃÊÌÊÃÃÃÊÕÌÀi>V ið UÊÊ/Ê`iÛi«Ê>`Ê>Ì>Ê>ÊVi>ÀÊÛÃÊvÊ«ÕÀ«ÃiÊ>`Ê >ÀÞÊvÊivvÀÌÊÊ>Ê>VÌÛÌiÃÊ Ì >ÌÊÀi>ÌiÊÌÊÃÃÃÊÊÌ iÊV>ÊV}Ài}>Ì° UÊÊ/Ê}Õ`iÊÊ>}ÊÜÃiÊ`iVÃÃÊÌ >ÌÊ>vviVÌÊÃÃÃÊÊ>Ê>iÀÊÌ >ÌÊÃÊVÃÃÌiÌÊ>`Ê ÃÞÃÌi>ÌVÊÊ>ÌÕÀi° UÊ/Ê>Û`Ê>}Ê«ÀÌ>ÌÊ`iVÃÃÊÃiÞÊÊÌ iÊL>ÃÃÊvÊiÌ° UÊ/ÊiÃÕÀiÊÌ >ÌÊÃÃÃÊvÕ`ÃÊ>ÀiÊ>`ÃÌiÀi`ÊivviVÌÛiÞÊ>`Êv>Ì vÕÞ° UÊÊ/ÊvÀÊ>`ÊiµÕ«ÊiLiÀÃÊvÊÌ iÊV}Ài}>Ì]Ê i«}ÊÌ iÊÕ`iÀÃÌ>`ÊÌ iÊ«À Ì>ViÊvÊÃÃÃÊ>`ÊÌ iÀÊ«>ÀÌV«>ÌÊÊÌÃÊÕÌÀi>V ÊÜÌ ÊÌ iÊV>ÊV}Ài}>Ì° UÊ/Ê>Ì>ÊÌ iÊ } iÃÌÊiÛiÊvÊ>VVÕÌ>LÌÞÊÊiÛiÀÞÊ>ëiVÌÊvÊÃÃð UÊ/Ê«ÀÛ`iÊ>Êi>ÃÊvÊVÕV>ÌÊÜÌ ÊÃÃ>ÀiÃÊÀi}>À`}ÊÃÃÃÊ«ÀiVÌÃ°Ê 7 >ÌÊÃÊ>Ê >ÃVÊ ÃÃÃÊ* ë Þ¶ iwÌÊvÊ ÃÃÃ Ê ÃÃÃÊÃÊ>ÞÊi`i>ÛÀÊÕÌÃ`iÊÌ iÊV>ÊV}Ài}>ÌÊÌÊ>ÞÊVÕÌÕÀ>ÊÀÊÃÕLVÕÌÕÀ>Ê }ÀÕ«]ÊLÌ ÊÊÌ iÊ1Ìi`Ê-Ì>ÌiÃÊ>`Ê>LÀ>`]ÊÌÊvÕwÊÌ iÊÀi>ÌÊ ÃÃÊvÊ ÀÃÌÊ Ü iÀiÛiÀÊ>`ÊÜ iiÛiÀÊ«ÃÃLi°Ê/ iÊ}>ÊvÊÃÃÃÊÕÌÀi>V ÊÃÊÌÊ>iÊ`ÃV«iÃ]ÊÌÀ>Ê ÃÌiÀÃÊ>`ÊÃÃ>ÀiÃ]Ê«>ÌÊV ÕÀV iÃÊ>`ÊÀi>ÌiÊÌÊÌ iÊÜ iÊii`ÊvÊ>`]ÊLÌ Ê Ã«ÀÌÕ>ÞÊ>`Ê« ÞÃV>Þ]Ê>ÃÊiÝ«ÀiÃÃi`ÊÊÌ iÊvÕÀv`Ê«ÕÀ«ÃiÊvÊÜÀ`ÊÃÃÃ\Ê,i>V }]Ê*>Ì}]Ê/À>}Ê>`Ê/ÕV }° -VÀ«ÌÕÀ>Ê*ÕÀ«ÃiÊvÊ ÃÃÃÊÛÛiiÌ UÊÊ/ÊLiÞÊÌ iÊwÛi`iÃ>ÊV>`ÊvÊ ÀÃÌÊÌÊiÛiÀÞÊLiiÛiÀÊ >ÌÌ iÜÊÓn\£ÓäÆÊÊ >ÀÊ£È\£xÆÊ ÕiÊÓ{\{Ç{nÆÊ ÊÓä\Ó£Ê>`ÊVÌÃÊ£\n®° UÊÊ/ÊvviÀÊÌÊ«i«iÊÌ iÊÃ>Û}ÊÜi`}iÊvÊ`ÊÊÌ iÊVÌiÝÌÊvÊviÊÊÃÊ-«ÀÌÊ>`Ê ÌÀÕÌ ÊÜÌ ÊÌ iÊÌiÌÊvÊ«iÀÃÕ>`}ÊÌ iÊÌÊLiViÊ`ÃV«iÃÊvÊ ÀÃÌÊ ÊÎ\£ÈÆÊÈ\ÈÎÆÊÊ ,>ÃÊ£ä\£Î£x®°Ê UÊÊ/ÊLiViÊ«>ÀÌiÀÃÊÜÌ ÊÃÃ>ÀiÃÊ>`Êà >ÀiÊÌ iÊÃ>iÊÀiÜ>À`Ê >ÌÌ iÜÊ£ä\{£ÆÊÊ ÎÊ Ên®° £x ,iëÃLÌiÃÊ>`Ê>ÃÊvÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i> >ÞÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÃÊÜÊLiÊV >À}i`ÊÜÌ ÊÌ iÊÀiëÃLÌÞÊvÊVÀ`>Ì}Ê >VÌÛÌiÃÊvÀÊV>ÊÕÌÀi>V ]Ê1°-°ÊÃÃÃÊ>`ÊÜÀ`ÊÃÃðÊÌ Õ} ÊÌ ÃÊ>Õ>Ê ÃÊÜÀÌÌiÊÜÌ ÊÜÀ`ÊÃÃÃÊÊvVÕÃ]ÊÃÌÊvÊÌ iÊÃÕ}}iÃÌÃÊ>ÀiÊÛ>`ÊvÀÊV>Ê>`Ê1°-°Ê ÃÃðÊvÊÃiÊÃÕ}}iÃÌÃÊ>ÀiÊÌÊ>««V>Li]ÊVÀi>ÌiÊ>Ê«VÞÊÌ >ÌÊwÌÃÊÌ iÊÃÌÕ>Ì°Ê Ì>VÌÊ ÞÕÀÊ`ÃÌÀVÌÊvwViÊvÀÊ>ÃÃÃÌ>ViÊÊÌ ÃiÊ>ÌÌiÀð ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê iLiÀÃÊ7Ê iÊ,iëÃLiÊ/o Ê £°ÊÊÊ-ÌÕ`ÞÊÃÃiLiÃÊvÊ`ÊÃÃÃÊ« ë ÞÊ>`Ê«ÀVi`ÕÀiÃÊÌÊ}>ÊÜi`}iÊ>LÕÌÊ 1°-°Ê>`ÊÜÀ`ÊÃÃð Ê Ó°ÊÊÊ-iVÕÀiÊ>ÃÊÕV ÊvÀ>ÌÊ>ÃÊ«ÃÃLiÊ>LÕÌÊÃÃÃÊvÀÊLÀV ÕÀiÃ]ÊLiÌÃ]Ê >Õ>Ã]ÊÛ`iÃ]Ê 6 Ã]ÊiÌV°]ÊÌÊ i«ÊÌi>ÊiLiÀÃÊÕ`iÀÃÌ>`ÊÌ iÊ« ë ÞÊvÊà ÃÃÊ>`ÊÌ iÊ«iÀ>ÌÊvÊÃÃiLiÃÊvÊ`Ê1°-°Ê>`Ê7À`Ê ÃÃð Ê Î°ÊÊÊ iiÌÊÌ ÞÊÀÊ>ÃÊvÌiÊ>ÃÊii`i`®ÊÌÊvÕwÊÌ iÊÌi>½ÃÊÀiëÃLÌiÃÊ>`Ê}>ðÊÊ Ê {°ÊÊÊ*Ài«>ÀiÊ>Ê>Õ>ÊÃÃÃÊLÕ`}iÌÊ>`Ê>`ÃÌiÀÊ>ÊÃÃÃÊvÕ`ÃÊÜ iÊLi}ÊÊ >VVÕÌ>LiÊÌÊÌ iÊ«>ÃÌÀÊ>`ÊV ÕÀV ÊL>À`° Ê x°ÊÊÊ >iÊVÌiÌÃÊvÀÊÌ iÊÃÕ««ÀÌÊvÊÃÃ>ÀiÃÊ>`ÊÃÃÃÊ«ÀiVÌÃÊ>`Ê>Ì>Ê >VVÕÀ>ÌiÊÀiVÀ`ð Ê È°ÊÊÊ,iÛiÜÊ>Õ>ÞÊÌ iÊÃÕ««ÀÌÊ}ÛiÊÌÊÃÃ>ÀiÃÊ>`Ê>iÊV >}iÃÊ>ÃÊiViÃÃ>ÀÞ°Ê Ê Ç°ÊÊÊ««ÌÊ>ÊVÀÀië`iViÊÃiVÀiÌ>ÀÞÊÌÊVÕV>ÌiÊÜÌ ÊÃÃ>ÀiÃÊÊÌ iÊÃÕ««ÀÌÊ ÃÌÊ>`Êà >ÀiÊVÀÀië`iViÊvÀÊÌ iÊÃÃÊwi`ÊÜÌ ÊÌ iÊV}Ài}>ÌÊÜ iÊÊ >««À«À>Ìi° Ê n°ÊÊÊ >Ì>Ê>ÊÃÃÃÊLÕiÌÊL>À`° Ê °ÊÊÊ iÃÃÊÃÃ>ÀiÃÊÜÌ ÊV>À`ÃÊ>`Ê}vÌÃÊÊÌ iÀÊLÀÌ `>ÞÃ]Ê>ÛiÀÃ>ÀiÃ]Ê>`Ê ÀÃÌ>Ã°Ê "vviÀ}ÃÊÃiÌÊvÀÊÌ ÃÊ«ÕÀ«ÃiÊà Õ`ÊLiÊ>Ài`ʺëiV>«iÀÃ>°» Ê £ä°ÊÊÊ iÊ>Û>>LiÊÌÊ>ÃÃÃÌÊÌ iÊ«>ÃÌÀÊÜÌ ÊÃV i`Õ}ÊÀÊiÌiÀÌ>}ÊÃÃ>ÀÞÊëi>iÀÃÊvÊ ii`i`° Ê ££°ÊÊÊ1`iÀÃÌ>`ÊÌ iÊv>Ì Ê«ÀÃiÊVVi«ÌÊ>`ÊLiÊ>LiÊÌÊiÝ«>ÊÌ° Ê £Ó°ÊÊÊ iÊÀiëÃLiÊvÀÊ«>}Ê>`ÊV`ÕVÌ}Ê>Ê>Õ>ÊÃÃÃÊVÛiÌÊ>`ÊÀiViÛ }Êv>Ì Ê«ÀÃið Ê £Î°ÊÊÊ*>ÊÌ iÀÊÃÃÃÊi« >ÃiÃÊ>ÃÊii`i`° Ê £{°ÊÊÊ iÊÀiëÃLiÊvÀÊ«ÀiÃiÌ}Ê>ʺ7`ÜÊÊÌ iÊ7À`»ÊÃi}iÌÊi>V ÊÌ ÊÌÊ«À ÌiÊÃÃÃÊÊ>ÊÀ}ÊÜÀà «ÊÃiÀÛViÊÊ ÃÃÃÊ-Õ`>Þ° Ê £x°ÊÊÊ Ài>ÌiÊÛ>ÌÛiÊiÌ `ÃÊÌÊii«ÊÃÃÃÊLivÀiÊÌ iÊV}Ài}>Ì° Ê £È°ÊÊÊ-ÕLÃVÀLiÊÌÊÌ iÊÜÀ`ÊÃÃÃÊÛ`iÊ>}>âi°Ê/ iÊÛ`iÊÀÊ 6 ÊÃÊ>i`ÊÌ ÞÊ >`ÊVÕ`iÃÊÌ ÀiiÊÌÊvÕÀÕÌiÊÃi}iÌÃÊLÌ ÊÊ }à Ê>`Ê-«>à ®Ê } } Ì}Ê Û>ÀÕÃÊÃÃ>ÀÞÊÃÌÀiÃÊ>`ÊVÕÌÀiÃ°Ê >V ÊÛ`iÊÀÊ 6 ÊVÌ>ÃÊ>ÊÃi}iÌÊvÀ\ >°Ê`ÕÌÃÊqÊ iÜà Ài> L°Ê9ÕÌ ÊqÊ7À`Ê i>Ì V°Ê `ÀiÊqÊÊÎÈä Ê £Ç°ÊÊÊ VÕÀ>}iÊÃÃÃÀi>Ìi`Ê>VÌÛÌiÃÊÊ>Ê`i«>ÀÌiÌÃÊvÊÌ iÊV ÕÀV ° £È Ê £n°ÊÊÊ*ÀÛ`iÊ>`iµÕ>ÌiÊ««ÀÌÕÌÞÊvÀÊiÛiÀÞÊLiiÛiÀÊÌÊLiÞÊÌ iÊÀi>ÌÊ ÃðÊ/ ÃÊÃÊ >ÊÌ«Ê«ÀÀÌÞt Ê £°ÊÊÊÀÊ>ÊÀiÊ`iÌ>i`ÊÃÌ]ÊÃiiÊ ÕÌiÃÊvÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÊ««i`ÝÊ£Ê Ê«>}iÊnÓ°® ÃÌ>Là }Ê>ÃÊÀÊ9ÕÀÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê ÕÊ>ÞÊÌÊLiÊ>LiÊÌÊ`ÊiÛiÀÞÌ }Ê>ÌÊiÊÌi]ÊLÕÌÊÞÕÊV>ÊÃiÌÊ}>ÃÊvÀÊÌ iÊvÕÌÕÀi°Ê 9 ½ÌÊLiÊÌi`ÊLÞÊÜ >ÌÊÞÕÊÃii]Ê>`Ê`½ÌÊ}ÛiÊÕ«°Ê/ ÃÊÃÊ`½ÃÊLÕÃiÃÃ]Ê>`ÊÞÕÊ>ÀiÊ ÃÊV `°ÊiÊÜ>ÌÃÊÞÕÊÌÊÃÕVVii`ÊiÛiÊÀiÊÌ >ÊÞÕÊ`t Ê £°Ê Ài>ÌiÊ7À`Ê6ÃÊqÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>½ÃÊ}>ÃÊvÀÊÜÀ`ÊiÛ>}iâ> ÌÊ>Àio >°Ê/Êii«ÊÃÃÃÊLivÀiÊÌ iÊV}Ài}>ÌÊÊ>ÊVÌÕ}ÊL>Ãð L°Ê/ÊVÀi>ÌiÊ>Ê>Ü>ÀiiÃÃÊvÊÌ iÊÃÌiÃÃÊvÊ>Ê>`ÊÌ iÊÛ>ÕiÊvÊi>V ÊÃÕ° V°Ê/ÊÊ i«ÊiÛiÀÞÊLiiÛiÀÊÕ`iÀÃÌ>`Ê ÃÊÀÊ iÀÊ«iÀÃ>ÊL}>ÌÊÌÊLiÞÊÌ iÊV >`ÊvÊ ÀÃÌÊiÝ«ÀiÃÃi`ÊÊÌ iÊÀi>ÌÊ ÃÃÊ >ÀÊ£È\£x®°Ê `°ÊÊ/ÊVÀi>ÌiÊÌ iÊ«ÃÃLÌÞÊvÀÊiÛiÀÞÊiLiÀÊvÊÌ iÊV}Ài}>ÌÊÌÊLiÞÊ ÀÃ̽ÃÊV >`ÊLÞÊ«À>Þ}]Ê}Û}Ê>`Ê}}° Ê Ó°Ê*ÀÌiÊÌiÀViÃÃÀÞÊ*À>ÞiÀÊÀÊ7À`Ê ii`ÃÊqÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜo >°Ê VÕÀ>}iÊ«i«iÊÌÊ«À>ÞÊvÀÊÃÃ>ÀiÃÊ>`ÊÃÃÃÊii`ÃÊ`>Þ° L°Ê `ÕVÌÊ«À>ÞiÀÊvÀÊÃÃÃÊÊÀi}Õ>ÀÊÃiÀÛViÃ]ÊëiV>ÊiiÌ}ÃÊ>`Ê«À>ÞiÀÊ}Àիð V°Ê*ÕLVâiÊ>`ÉÀÊ>ÕViÊëiV>ÊÃÃÃÊ«À>ÞiÀÊii`ÃÊÊÌ iÊÜiiÞÊLÕiÌ° `°Ê*ÃÌÊÃÃÃÊ«À>ÞiÀÊii`ÃÊÊÌ iÊÃÃÃÊLÕiÌÊL>À`° i°ÊÊÌ>ÌiÊ>Ê>`«ÌÊ«À}À>ÊÌÊiVÕÀ>}iÊÃ>Ê}ÀÕ«ÃÊ>`Êv>iÃÊÌÊvVÕÃÊÊiÊ ÀÊÀiÊÃÃ>ÀÞÊv>iÃ]ÊVViÀ}ÊÌ iÃiÛiÃÊÜÌ ÊÌ iÀÊëÀÌÕ>]Ê« ÞÃV>Ê>`Ê iÌ>Êii`ð Ê Î°Ê"À}>âiÊ ÃÃÃÊ ÛiÌÃÊqÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜo >°ÊÊ `ÕVÌÊ>ÊÕÊvÊiÊÃÃÃÊVÛiÌÊi>V ÊÞi>À°Ê"À`iÀÊ/ iÊ Õi«ÀÌ]Ê ÛÕiÊÓ]ʺ Õ`}Ê ÃÃÃÊ"Li`iViÊ7Ì ÊÊ ÃÃÃÊ ÛiÌ»ÊvÀÊ>Ê`i Ì>i`Ê}Õ`iÊvÀÊ«>}Ê>ÊÃÕVViÃÃvÕÊVÛiÌ°® L°ÊÛÌiÊ>Êëi>iÀÊiÝ«iÀiVi`ÊÊÀiViÛ}Êv>Ì Ê«ÀÃið V°ÊÊÛiÊ««ÀÌÕÌÞÊ`ÕÀ}ÊÌ iÊVÛiÌÊvÀÊiÛiÀÞÊ`Û`Õ>ÊÌÊ>iÊ>Ê«iÀÃ>Êv>Ì Ê «ÀÃiÊvÀÊÃÃð Ê {°Ê*>ÀÌV«>ÌiÊÊÌ iÊ Ì ÞÊ ÃÃÃÊ-Õ`>ÞÊqÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜo >°ÊÊ*>Êà ÀÌÊLÕÌÊivviVÌÛiÊÃÃÃÊ«ÀiÃiÌ>ÌÃÊvÀÊÌ iÊV}Ài}>ÌÊ`ÕÀ}ÊÌ iÊÀ }ÊÜÀà «ÊÃiÀÛVi°Ê"À`iÀÊ/ iÊ Õi«ÀÌ]ÊÛÕiÊÎ]ʺ Õ`}Ê ÃÃÃÊ6Ão Ì ÊLÞÊ Ì »ÊvÀÊ>ÃÃÃÌ>ViÊÊ«>}ÊÃÃÃÊ-Õ`>ÞÊ«ÀiÃiÌ>ÌÃÊvÀÊÌ iÊ Ü iÊÞi>À°® L°ÊÊ1ÃiÊÌiÃÌiÃ]ÊÃÃ>ÀÞÊiÌÌiÀÃÊ>`ÊÛ`iÊ>ÌiÀ>ÃÊ«ÀÛ`i`ÊLÞÊÜÀ`ÊÃÃð V°ÊÊ VÕÀ>}iÊVÃÃÌiVÞÊÊv>Ì Ê«ÀÃiÊ}Û}ÊLÞÊvÀ}Ê>`ÊëÀ}ÊÌ iÊV}Ài }>ÌÊÜÌ Ê>Ê>Û>>LiÊÌð £Ç Ê x°ÊÊ*>Ê- ÀÌ/iÀÊ ÃÃÃÊ/À«ÃÊqÊ ÕiÀÕÃÊ««ÀÌÕÌiÃÊ>ÀiÊ>Û>>LiÊvÀÊiLiÀÃÊvÊ Ì iÊV}Ài}>ÌÊÌÊLiÊÛÛi`ÊÊ >`ÃÊiÝ«iÀiViÊÊÃÃÃ]ÊLÌ ÊÊÌ iÊ1Ìi`Ê -Ì>ÌiÃÊ>`Ê>LÀ>`°Ê/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜo >°ÊÊ ÃÌ>Là ÊVÌ>VÌÊÜÌ Ê`i«>ÀÌiÌÃÊÜÌ ÊÌ iÊÃÃiLiÃÊvÊ`ÊÌ >ÌÊ>ÀiÊÀië ÃLiÊvÀÊëÃÀ}Êà ÀÌÌiÀÊÃÃÃÊÌÀ«Ã°Ê/ iÃiÊÜÊVÕ`io £®ÊÊ ÊqÊ-«ÃÀi`ÊLÞÊÌ iÊ>Ì>Ê9ÕÌ Ê i«>ÀÌiÌ]ÊÌ ÃÊ«À}À>ÃÊ}ÛiÃÊ« «ÀÌÕÌÞÊvÀÊ Õ`Ài`ÃÊvÊÞÕ}Ê«i«iÊÌÊiÝ«iÀiViÊÃÃÃÊwÀÃÌ >`° Ó®ÊÊ *-Ê Õ`iÀÃÊqÊ ÃÌÀÕVÌÊÌi>ÃÊ i«ÊLÕ`Êii`i`Êv>VÌiÃÊvÀÊÌ iÊiÝ«> ÃÊvÊÌ iÊÜÀ° ήÊÊi>Ì >ÀiÊ ÃÌÀiÃÊqÊÛiÃÊ««ÀÌÕÌÞÊvÀÊ i>Ì V>ÀiÊ«ÀviÃÃÃÊÌÊÕÃiÊ Ì iÀÊ}vÌÃÊÌÊvÕÀÌ iÀÊÌ iÊÜÀÊvÊ`½ÃÊ}`° {®ÊÊ ÊvÊ«iÊqÊ/i>ÃÊ`ÃÌÀLÕÌiÊ>ÊëiV>Ê LiÊ«ÀiÃiÌ>ÌÊÌÊÃV V `ÀiÊ ÊÌ iÊ ÃÌÊVÕÌÀÞ°ÊÊ L°Ê VÕÀ>}iÊiLiÀÃÊvÊÌ iÊV}Ài}>ÌÊÌÊ«>ÀÌV«>ÌiÊÊà ÀÌÌiÀÊÌÀ«Ã° V°Ê `ÀÃiÊÛÕÌiiÀÃÊ>`Ê>ÌV ÊÌ iÊÌÊ>««À«À>ÌiÊ«ÀiVÌð `°ÊÊ VÕÀ>}iÊiÛ>}iÃÌVÊÕÌÀi>V Ê«À}À>ÃÊÃÕV Ê>ÃÊ Ê>`Ê ÊvÊ«i®Ê`ÕÀ}Ê `>ÞÃ]ÊÛ>V>ÌÊÀÊÌ iÀÊVÛiiÌÊÌið i°ÊÊ *-Ê ÃÌÀÕVÌÉ*À>ÞiÀÊ/>ÃÊÀViÊ/i>ÃÊà Õ`ÊLiÊ}ÛiÊ } Ê«ÀÀÌÞÊLiV>ÕÃiÊ vÊÌ iÊ>À}iÊÕLiÀÃÊvÊ«>ÀÌV«>ÌÃÊÛÛi`°ÊÊ Ê È°ÊÊ >``>ÌiÊ-iiVÌÊqÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÊ i«ÊÃiiVÌÊV>``>ÌiÃÊvÀÊ Ã ÀÌÌiÀÊÃiÀÛViÊÜ ÊiiÌÊÌ iÃiÊVÀÌiÀ>o >°ÊÊÃViÀiÊÌiÀiÃÌÊÊ>`ÊVÌiÌÊÌÊÜÀ`ÊÃÃð L°Ê>ÞÊÃÕ««ÀÌÊÀÊVÃiÌÊ>ÃÊ>««V>Li° V°ÊÊ*ÀiÛÕÃÊÛÛiiÌÊÊÃÃÃÊ«À}À>ÃÊÀÊÌ iÀÊÃÃÃÀi>Ìi`Ê>VÌÛÌiÃÊ>`iÊ >Û>>LiÊÌ ÀÕ} ÊÌ iÊV ÕÀV ° `°Ê>Ì vÕiÃÃÊ>`ÊÀiëÃLÌÞÊÊÃiÀÛ}° i°ÊÊVÌÛiÊiLiÀà «ÊÊÌ iÊV ÕÀV ]ÊÜ V ÊVÕ`iÃÊv>Ì vÕÊ>ÌÌi`>Vi]ÊÃÌiÜ>À`à «Ê ÊÌÌ }Ê>`Ê>ÊÀi}Õ>ÀÊVÌiÌÊÌÊÃÕ««ÀÌÊÃÃÃÊÌ ÀÕ} Ê>ÊÌ ÞÊv>Ì Ê «ÀÃi° v°ÊÊvwÀ>ÌÊvÊÌ iÊ«>ÃÌÀ]ÊvwV>ÊL>À`Ê>`Ê>ÞÊÌ iÀÊi>`iÀÃÊÜ Ê >ÛiÊÀiëÃL ÌÞÊvÀÊÌ iÊëÀÌÕ>ÊÛiÀÃ} ÌÊvÊÌ iÊ`Û`Õ>° £n 0ART 0UTTING 9OUR 0LAN )NTO !CTION -iÌÌ}ÊÌ iÊ}i`>Ê ÃiÊÊi>`iÀà «ÊÜÊ ÜÊ«ÀÌ>ÌÊÌÊÃÊÌÊÜÃiÞÊÕÃiÊÛÕÌiiÀýÊÌiÊ>`ÊiiÀ}Þ°Ê // >ÌÊÃÊÜ ÞÊÌÊÃÊVÀÌV>ÊÌÊ«>ÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê>}i`>ÊV>ÀivÕÞ°Ê/ iÊ ÌÛiÊÃÊÌÜv`\Ê£®Ê/ÊÛiÃÌÊÌ iÊÌiÊvÊÌi>ÊiLiÀÃÊV>ÀivÕÞ]Ê>`ÊÓ®Ê/Ê>ÝâiÊivvÀÌÃÊ ÌÊ i«ÊiÛ>}iâiÊÌ iÊÜÀ`° / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊÌÊÕÃÌÊ>Ì iÀÊVÌÌii°Ê/ ÃÊÌi>ÊÜÊi>`ÊÌ iÊV }Ài}>ÌÊÌÊLi`iViÊÌÊ ÀÃ̽ÃÊV>`ÊÌÊÀi>V ÊÌ iÊÜ iÊÜÀ`ÊÜÌ ÊÌ iÊ}ëi° ÊÃÕÀÛiÞÊvÊÃÃÃÊi>`iÀà «ÊÊÃiÛiÀ>ÊV ÕÀV iÃÊÜÌ ÊÕÌÃÌ>`}ÊÃÃÃÊÕÌÀi>V iÃÊ ÀiÛi>i`ÊÃiÛiÀ>ÊÃÕ}}iÃÌÃÊvÀÊÃiÌÌ}Ê>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>½ÃÊÌ ÞÊ>}i`>°ÊÊÃ> «}ÊvÊÃÕ}}iÃÌÃÊVÕ`iÊÌ iÃiÊÌ«VÃ\Ê ->«iÊ Ì ÞÊ}i`> Ê £°Ê"«i}Ê«À>ÞiÀ Ê Ó°ÊÊ,iÛiÜÊÌ iÊÌ ÞÊ ÃÃÃÊ7À`ÊiÜÃÊÛ`iÊqÊ7 V ÊÃi}iÌÊÜÊLiÊÕÃi`ÊÊ Ã ÃÃÊ-Õ`>Þ¶Ê/ iÊ 6 ÊVÌ>ÃÊV«ÃÊvÀÊ>`ÕÌÃÊ iÜÃLÀi>®]ÊÞÕÌ Ê7À` i>Ì®]Ê>`Ê V `ÀiÊÊÎÈä®° Ê Î°ÊÊ ÃÌÊÃÃ>ÀÞÊVÀÀië`iViÊÀiViÛi`Ê`ÕÀ}ÊÌ iÊÌ °Ê Ê {°ÊÊ,iÛiÜÊÌ iÊiÜÃiÌÌiÀÃ]ÊvVÕÃ}ÊÊÌiÃÊvÊëiV>ÊÌiÀiÃÌÊÃÕV Ê>ÃÊ >°ÊÊV >}iÊvÊÃÌ>ÌÕÃÊ L°ÊÊV >}iÊvÊwi`Ê V°ÊÊV >}iÊvÊÃÌÀÞÊ `°Ê,i«ÀÌÃÊvÊÃÌÀÞ Ê x°ÊÊ*À>ÞÊvÀÊÃÃ>ÀÞÊii`ÃÊ>ÃÊiÝ«ÀiÃÃi`ÊÊÌ iÊVÀÀië`iViÊÀiViÛi`°ÊÊÃÌÊvÊÌ iÃiÊ «À>ÞiÀÊii`ÃÊà Õ`ÊLiÊ}ÛiÊÌÊi>V ÊL>À`ÊiLiÀÊ>`ÊÌÊÛÕÌiiÀÊ«À>ÞiÀÊ«>ÀÌiÀð Ê È°ÊÊ,iÛiÜÊÌ iÊw>V>ÊÀi«ÀÌÊ>`Êi>ÃÕÀiÊ>VÌÕ>ÊÀiVi«ÌÃÊ>}>ÃÌÊv>Ì Ê«ÀÃiÃÊ>`iÊ `ÕÀ}ÊÌ iÊ>Õ>ÊVÛiÌ° Ê Ç°Ê>V>Ê>««i>à >°Ê ÃÃ>ÀiÃÊÌÊVÃ`iÀÊvÀÊÃÕ««ÀÌ L°Ê ÃÃ>ÀiÃÊÌÊÀiViÛiÊ>ÊVÀi>ÃiÊÊÃÕ««ÀÌ V°Ê««i>ÃÊvÀÊV>à Ê>ÃÃÃÌ>Vi `°Ê iÌiÀiÊ>ÕÌÊvÊVÌiÌÊvÀÊÃÃÃÊÃiÀÛViÊ>ÌÊ`ÃÌÀVÌÊVÕV Ê n°Ê,iÛiÜÊ«>ÃÊvÀÊÃÃÃÊÌÀ«Ã Ê °Ê,iÛiÜÊ«>ÃÊvÀÊiÝÌÊVÛiÌ >°Ê >Ìià L°Ê/ ii £ V°ÊVÌÛÌiÃÊqÊ-Õ`>ÞÊ-V ÊV>ÃÃiÃ]ÊV `Ài½ÃÊV ÕÀV ]ÊiÌV°Ê `°Ê >ÌiÀ>ÃÊii`i` i°Ê-«i>iÀÃ Ê £ä°Ê,iÛiÜÊÃÌÊvÊÕ«V}ÊÃÃ>ÀÞÊëi>iÀÃ Ê ££°Ê-iÌÊ`>ÌiÊ>`Ê«>ViÊvÀÊiÝÌÊÌ ½ÃÊiiÌ} Ê £Ó°Ê ÃÃÃÊÊ«À>ÞiÀ ii«}Ê>Ê,iVÀ`ÊvÊ ÃÃ>ÀiÃÊÌ iÊ ÕÀV Ê-Õ««ÀÌà >ÞÊÌiÃ]Ê>ÊV >}iÊvÊ«>ÃÌÀÃÊÀÊV ÕÀV ÊÌÀi>ÃÕÀiÀÃÊÀiÃÕÌÃÊÊÃÌÊÀÊë>Vi`ÊvÀ >ÌÊ>LÕÌÊÃÃÃÊVÌiÌðÊÌ Õ} ÊÕÌiÌ>]ÊÌ ÃÊÃÌÕ>ÌÊÀiÃÕÌÃÊÊ VvÕÃÊVViÀ}ÊV>ÊV ÕÀV Êw>ViÃÊ>`ÊV>ÊÀiÃÕÌÊÊ >À`à «ÊvÀÊÃÃ>ÀiÃÊÜ ÃiÊ ÃÕ««ÀÌÊ>ÞÊÃÕvviÀÊ>ÃÊ>ÊÀiÃÕÌ° -VÀ«ÌÕÀiÊÌi>V iÃÊ}`ÊÃÌiÜ>À`à «ÊvÀÊiÛiÀÞÊLiiÛiÀ°ÊvÊÌ ÃÊ«ÀV«iÊÃÊÌÀÕiÊvÀÊÌ iÊ` Û`Õ>]ÊÌÊÃÊiÛiÊÀiÊ>««V>LiÊvÀÊÌ iÊV ÕÀV tÊ-ÕV ÊVVÕÀÀiViÃÊV>ÊLiÊ«ÀiÛiÌi`ÊëÞÊLÞÊ >Ì>}Ê>Ê>VÌÛiÊÃÌÊvÊÌ iÊÃÃ>ÀiÃÊÀiViÛ}ÊÌ ÞÊÃÕ««ÀÌÊvÀÊÌ iÊV ÕÀV ° vÊÞÕÊ`ÊÌÊ >ÛiÊ>Ê«iÀ>iÌÊÀiVÀ`ÊvÊÌ iÃiÊL}>ÌÃ]ÊÌ iÊ ÃÃ>ÀÞÊ Õ`}iÌÊ,iÛiÜÊ Ê«>}iÃÊÓÓÊÜÊÃiÀÛiÊÞÕÊÜi°Ê ÌiÀÊÌ iÊ>iÃÊvÊÊÃÃ>ÀiÃÊÃÕ««ÀÌi`ÊLÞÊÌ iÊV ÕÀV ]Ê Ü iÊÌ iÊVÌiÌÊÜ>ÃÊ>`i]ÊÌ iÊ>ÕÌÊvÊÌ iÊVÌiÌ]Ê>ÞÊ«>ÃÊÌÊVÀi>ÃiÊÌ iÊ ÃÕ««ÀÌ]Ê>`ÊÌ iÊ>ÕÌÊvÊÌ iÊiÜÊVÌiÌ]ÊVÕ`}ÊÌ iÊVÀi>Ãi° iÌÌ}ÊÌÊ ÜÊÌ iÊ ÃÃ>Àià ÀiÊÌ iÊÃÃ>ÀiÃÊÞÕÀÊV ÕÀV ÊÃÕ««ÀÌÃÊÞÕÀÊ«>ÀÌiÀÃ¶Ê ÊÞÕÊVÃ`iÀÊÌ iÊ>ÃÊ>Ê iÝÌiÃÊvÊÌ iÊV>ÊV ÕÀV ½ÃÊÃÌÀÞ¶ÊvÊÌ iÊ>ÃÜiÀÊÃʺÞiÃ]»Ê>iÊÌ iÊivvÀÌÊÌÊ}iÌÊÌÊ ÜÊÌ i°Ê/ iÊV ÕÀV Ê>ÞÊÃi`ÊÌ iÊÌ ÞÊvviÀ}Ã]ÊLÕÌÊLiiÛiÀÃÊV>½ÌÊivviVÌÛiÞÊ«À>ÞÊ vÀÊÌ iÊÀÊÀiiLiÀÊÌ iÊÜÌ Ê`Ê}iÃÌÕÀiÃÊÊëiV>ÊVV>ÃÃÊvÊÌ iÞÊÜÊÌ }Ê >LÕÌÊÌ i°Ê "iÊvÊÌ iÊwÀÃÌÊÌiÃÊÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>½ÃÊ«ÀÀÌÞÊÃÌÊÃÊÌÊLiViÊv>>ÀÊ ÜÌ ÊÌ iÊÃÃ>ÀiÃÊÌ iÊV ÕÀV ÊVÕÀÀiÌÞÊÃÕ««ÀÌðÊ*>}iÃÊÓ{Ê«ÀÛ`iÃÊ>Ê«>ViÊÌÊÀiVÀ`ÊÌ iÊ ii`i`ÊvÀ>Ì°Ê >ÊÌ iÊÜÀ`ÊÃÃÃÊvwViÊÌÊÀiµÕiÃÌÊ>ʺÃ}wV>ÌÊiÛiÌÃÊÃÌ»ÊvÀÊ>Ê Ì iÊÊÃÃ>ÀiÃÊÊÞÕÀÊÃÕ««ÀÌÊÃÌ° "ViÊÞÕÊ >ÛiÊV«iÌi`ÊÌ iÊvÀ>ÌÊà iiÌÃ]Ê>iÊViÀÌ>ÊÌ >ÌÊi>V ÊÌi>ÊiLiÀÊ >ÃÊ >ÊV«Þ°Ê VÕÀ>}iÊ}ÀÕ«ÃÊÜÌ ÊÌ iÊV}Ài}>ÌÊÌÊ>`«ÌÊ>ÊÃÃ>ÀÞÊv>ÞÊÀÊ>Ê Ê ÃÃ>ÀÞÊ`®ÊÌÊÀiiLiÀÊÊLÀÌ `>ÞÃÊ>`Ê>ÌÊ ÀÃÌ>ÃÌi° 7Ì ÊÌ ÃÊvÀ>Ì]ÊÌ iÊV ÕÀV ÊÜÊLiÊ«Ài«>Ài`ÊÌÊÃÕ««ÀÌÊÌÃÊÃÃ>ÀÞÊ«>ÀÌiÀÃÊÊ Ì ÀiiÊ«ÀÌ>ÌÊÜ>ÞÃ\Ê«À>ÞiÀ]Êw>ViÃÊ>`ÊëiV>ÊVV>Ãð Û>Õ>Ì}Ê ÕÀÀiÌÊ ÃÃÃÊ*ÌiÌ> Ìi>ÊV>½ÌÊÜÊÜ iÀiÊÌÊÃÊ i>`i`ÊÕÌÊÌÊÜÃÊÌÃÊVÕÀÀiÌÊ«ÃÌ°ÊiÃÕÃÊÃ>`]ʺ-Õ« Ê«ÃiÊiÊvÊÞÕÊÜ>ÌÃÊÌÊLÕ`Ê>ÊÌÜiÀ°Ê7Ê iÊÌÊwÀÃÌÊÃÌÊ`ÜÊ>`ÊiÃÌ>ÌiÊÌ iÊVÃÌÊ ÌÊÃiiÊvÊ iÊ >ÃÊiÕ} ÊiÞÊÌÊV«iÌiÊ̶»Ê ÕiÊ£{\Ón]Ê 6®°Ê/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ /i>Êii`ÃÊÌÊiÛ>Õ>ÌiÊÌÊÞÊÜ >ÌÊÌ iÊV ÕÀV ÊÃÊVÕÀÀiÌÞÊ`}]ÊLÕÌÊ>ÃÊÌÃÊ«ÌiÌ>ÊvÀÊ Óä Ì iÊvÕÌÕÀi°Ê ÃÌÊV}Ài}>ÌÃÊ>ÀiÊV>«>LiÊvÊv>ÀÊÀiÊÌ >ÊÌ iÞÊVÕÀÀiÌÞÊ>ÀiÊ`}ÊvÀÊà ÃðÊvÊi>`iÀÃÊ`½ÌÊVÀi>ÌiÊ>ÊÛÃ]ÊÌ iÊV}Ài}>ÌÊÜÊiÛiÀÊV>ÌV Ê>ÊÛÃt *>}iÊÓÇÊÃÊ>Ê}Õ`iÊÌÊiÛ>Õ>Ì}ÊÜ iÀiÊ>ÊV ÕÀV ÊVÕÀÀiÌÞÊÃÊpÊLÌ ÊÊÌÃÊÃÃÃÊL}>ÌÃÊ >`ÊÌÃÊÃÃÃÊVi°Ê"ViÊÌ ÃÊÃÊiÃÌ>Là i`]ÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊV>ÊLi}ÊVÀi>Ì }Ê}>ÃÊvÀÊÌ iÊiÝÌÊÞi>À°Ê Ã`iÀÊÌ iÊ«ÌiÌ>ÊÃÃÃÊViÊvÀÊi>V Ê`i«>ÀÌiÌÊÊÌ iÊ V ÕÀV °ÊvÊÌ iÊV ÕÀV ÊÃÊÌÊVÕÀÀiÌÞÊV`ÕVÌ}Ê>Ê>Õ>ÊÃÃÃÊVÛiÌ]ÊÃiÌÊ>Ê`>ÌiÊvÀÊ>Ê VÛiÌÊÌ ÃÊÞi>À°Ê Ý«iÀiViÊ >ÃÊà ÜÊÌ >ÌÊÃÌÊV ÕÀV iÃÊÀiÊÌ >Ê`ÕLiÊÌ iÀÊÃÃÃÊ }Û}Ê`ÕÀ}ÊÌ iÊÞi>ÀÊ>vÌiÀÊÌ iÀÊwÀÃÌÊVÛiÌtÊÊVÛiÌÊÜÊÀiÛÕÌâiÊ>ÊV ÕÀV ½ÃÊ}Û }]ÊVÀi>ÌiÊÛÃÊÊÌ iÊ i>ÀÌÃÊvÊ«i«iÊ>`ÊLÀ}ÊÌ iÊÌÊLi`iViÊÌÊ ÀÃ̽ÃÊV>`ÊÌÊ Ì>iÊÌ iÊ}ëiÊÌÊÌ iÊÜ iÊÜÀ`°ÊÀÊ>ÊÃÌi«LÞÃÌi«Ê}Õ`iÊÌÊV`ÕVÌ}Ê>ÊÃÕVViÃÃvÕÊÃÃÃÊ VÛiÌ]ÊÀ`iÀÊ/ iÊ Õi«ÀÌ]ÊÛÕiÊÓ]ʺ Õ`}Ê ÃÃÃÊ-Õ««ÀÌÊ/ ÀÕ} Ê>ÊÕ>Ê ÃÃÃÊ ÛiÌ°» Ài>Ì}Ê>ÊÕ>Ê ÃÃÃÊ Õ`}iÌ ÜÊÌ >ÌÊÌ iÊÌi>Ê >ÃÊ>ÊVi>ÀiÀÊ«VÌÕÀiÊvÊÌ iÊV ÕÀV ½ÃÊ«ÌiÌ>]ÊiÃÌ>Là Ê>Ê>Õ>Êà ÃÃÊLÕ`}iÌ°Ê/Ê>iÊÃÕÀiÊÌ }ÊÃÊÛiÀi`]ÊVÃ`iÀÊÌ iÃiÊV>Ìi}ÀiÃ\Ê7À`Ê Ã ÃÃ]Ê1°-°Ê ÃÃÃ]ÊLiiÛiViÃ]Ê`ÃÌÀVÌÊÃÕ««ÀÌÊ>`ÊÌ iÀÊÕÌÀi>V iðÊ/ iÊÕ>Ê ÃÃÃÊ Õ`}iÌÊ7ÀÊ- iiÌÃÊÊ«>}iÃÊÓnÊ>`ÊÓÊÜÊ}Õ`iÊÞÕÊÌ ÀÕ} ÊÌ iÊ«ÀViÃð "ÊÌ iÊiÃÊ`V>Ìi`]ÊiÌiÀÊÌ iÊ>iÃÊvÊÌ iÊÜÀ`Ê>`Ê1°-°ÊÃÃ>ÀiÃÊÌ iÊV ÕÀV ÊVÕÀÀiÌÞÊ ÃÕ««ÀÌÃ°Ê iVÊÌ iÊÌ iÀÊÃÌÀiÃÊÌÊÜ V ÊvÕ`ÃÊ>ÀiÊ}ÛiÊ>`ÊiÌiÀÊÌ iÊ>ÕÌÊvÊi>V ÊV ÌiÌ°ÊÊÌ iÊ«ÀiVÌi`Ê}Û}ÊVÕ]ÊiÌiÀÊÌ iÊ>ÕÌÊ«ÀiVÌi`ÊvÀÊi>V ÊÃÃ>ÀÞÊ>`Ê ÃÌÀÞÊ`ÕÀ}ÊÌ iÊV}ÊÞi>À°Ê/Ì>ÊLÌ ÊVÕÃÊÌÊw`ÊÌ iÊV ÕÀV ½ÃÊVÕÀÀiÌÊ>`Ê«ÀiVÌi`Ê }Û}ÊpÊÌ iÀÜÃiÊÜÊ>ÃÊ>Ê>Õ>ÊÃÃÃÊLÕ`}iÌ° iÌiÀ}Ê7 V Ê ÃÃ>ÀiÃÊÌÊ-Õ««ÀÌ `}ÊÃÃ>ÀiÃÊÌÊViÊÌÊÞÕÀÊV ÕÀV ÊÌÊÃVÌÊw>ViÃÊÃÊÌÊ>Ê`vwVÕÌÊÌ>Ã°Ê ÃÌÊiÛiÀÞÊV ÕÀV ÊÃÊVÌ>VÌi`ÊLÞÊÃÃ>ÀiÃÊ>««ÀÛi`ÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê >`Ê1°-°Ê ÃÃð vÊÞÕÀÊV ÕÀV ÊV>½ÌÊÃÕ««ÀÌÊiÛiÀÞÊÃÃiLiÃÊvÊ`ÊÃÃ>ÀÞÊÜ ÊÀiµÕiÃÌÃÊ>ÊÌ ÞÊV ÌiÌ]Ê ÜÊà Õ`ÊÞÕÊ`iÌiÀiÊÜ Ê}iÌÃÊw>V>Ê i«¶Ê Ã`iÀÊÌ iÃiʵÕiÃÌÃÊÊÃiÌÌ}Ê«VÞÊvÀÊ ÃÃ>ÀÞÊÃÕ««ÀÌÊvÀÊÌ iÊV}Ài}>Ì° UÊ7ÊÜiÊ}ÛiÊ«ÀÀÌÞÊÌÊÃÃ>ÀiÃÊvÀÊÕÀÊÜÊ`ÃÌÀV̶Ê/ ÃÊÃÊ«ÀÌ>Ìt UÊÜÊ>ÞÊÃÃ>ÀiÃÊV>ÊÜiÊÃÕ««ÀÌÊÌ Þ¶ UÊÊ7 >ÌÊÜÊLiÊÌ iÊ>ÕÌÊvÊÌ iÊÌ ÞÊVÌiÌÊÌÊÌ iÊÃÃ>ÀiÃÊÜiÊV ÃiÊÌÊÃÕ« «À̶Ê/ iÊ>ÛiÀ>}iÊ«i`}iÊÃÊ>LÕÌÊfxΰ® UÊ7ÊÜiÊVÃ`iÀÊÃÕ««ÀÌ}ÊÃÃ>ÀiÃÊvÀÊÌ iÀÊ`ÃÌÀVÌÃ¶Ê UÊÊvÊÃ]ÊÜÊÜiÊ}ÛiÊÌ iÊÌ iÊÃ>iÊ>ÕÌ]ÊÀÊÜÊÜiÊ}ÛiÊÀiÊÌÊÃÃ>ÀiÃÊvÀÊÊ ÕÀÊ`ÃÌÀV̶ UÊ7ÊÜiÊÌÀÞÊÌÊL>>ViÊÀi«ÀiÃiÌ>ÌÊvÀÊi>V ÊÀi}ÊvÊÌ iÊÜÀ`¶ UÊ ÊÜiÊÜ>ÌÊÌÊL>>ViÊÕÀÊÃÕ««ÀÌÊvÀÊÛ>ÀÕÃÊÌÞ«iÃÊvÊÃÌÀiö UÊ7ÊÜiÊ«ÕÌÊ«ÀÀÌÞÊÊÕÀ}iÌÊii`ÃÊÀ>Ì iÀÊÌ >ÊL>>Vi¶ vÌiÀÊ«ÀÀÌiÃÊ>ÀiÊÃiÌÊvÀÊÃÃ>ÀÞÊÃÕ««ÀÌ]Ê>iÊ«À>ÞiÀÊÌ iÊ`iV`}Êv>VÌÀ°ÊÜ>ÞÃÊ>ÃÊÌ iÊ µÕiÃÌ]ʺ7 >ÌÊÃÊÌ iÊÞÊ-«ÀÌÊÃ>Þ}ÊÌ >ÌÊÜiÊà Õ`Ê`Ê>LÕÌÊÃÕ««ÀÌ}ÊÌ ÃÊÃÃ>ÀÞ¶» Ó£ ÕÌ VÀi>Ãi`Ê ÌiÌ ÕÌ ÕÀÀiÌÊ ÌiÌ Ì>à 2EVIEW 7>ÃÊ >`i >ÌiÊ ÌiÌ "UDGET i` ÃÃ}i` -ISSIONARY >i ÃÃ>ÀÞ ÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊ/ ÓÓ ÕÌ VÀi>Ãi`Ê ÌiÌ ÕÌ ÕÀÀiÌÊ ÌiÌ Ì>à 2EVIEW 7>ÃÊ >`i >ÌiÊ ÌiÌ "UDGET i` ÃÃ}i` -ISSIONARY >i ÃÃ>ÀÞ ÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊ/ ÓÎ vÀ>ÌÊLÕÌÊ"ÕÀÊ ÃÃ>ÀÞÊ*>ÀÌiÀà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà Ó{ ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà Óx ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÃÃ>ÀÞ½ÃÊ >i ÀÌ `>Þ ÛiÀÃ>ÀÞ ÕÌÊvÊ Ì ÞÊ-Õ««ÀÌ -«ÕÃi ÀÌ `>Þ i` >Ê``ÀiÃà `Ài ÀÌ `>Þî }i >}Ê``ÀiÃà ÓÈ ÃÃ>ÀÞÊÛ}ÊpÊ Û>Õ>ÌÊ`Ê>à 7 >ÌÊÃÊÕÀÊ>ÛiÀ>}iÊÌ ÞÊViÊvÀÊÃÃöÊÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ 7 >ÌÊÃÊÕÀÊÌÌ>ÊÌ ÞÊVÌiÌÊÌÊÃÃöÊÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÜÊ>ÞÊv>ÞÊÕÌÃÊ>ÌÌi`ÊÕÀÊV ÕÀV ¶ÊÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÜÊ>ÞÊÕÌÃÊÀi}Õ>ÀÞÊÃÕ««ÀÌÊÃÃöÊÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÜÊÕV Ê``ÊÌ iÊV ÕÀV Ê}ÛiÊÌÊÃÃÃÊ>ÃÌÊÞi>À¶ÊfÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ 7 >ÌÊÜ>ÃÊÌ iÊ>ÛiÀ>}iÊÃÃÃÊ}Û}Ê«iÀÊv>ÞÊÕÌÊ>ÃÌÊÞi>À¶ÊfÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê Û`iÊÌ iÊÌÌ>Ê>Õ>ÊÃÃÃÊ}Û}ÊLÞÊÌ iÊÕLiÀÊvÊv>ÞÊÕÌÃÊ>ÌÌi`}ÊÞÕÀÊV ÕÀV ÊÌÊw`ÊÌ iÊ >ÛiÀ>}iÊ>Õ>Ê}Û}Ê«iÀÊÕÌ°® 7 >ÌÊÃÊÕÀÊ}>ÊvÀÊÃÃÃÊvÀÊiÝÌÊÞi>À¶Ê Ào >Ì Ê«ÀÃiÊ}Û}Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ iiÀ>ÊvÕ`ÊÌÀ>ÃviÀÊÌÊÌ iÊÃÃÃÊvÕ`Êooooooooo°Ê°°ÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÞÃÊ>`ÊÀÃÊ ÃÃ>ÀÞÊ ÀÕÃ>`iÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ -«ii`ÊÌ iÊ } ÌÊ9ÕÌ ®Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ 7i½ÃÊ ÃÌÀiÃÊÃÃÃÊ«ÀiVÌÃÊ°°°°°°°°°°oooooooo°Ê°°ÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ } ÌÊvÀÊÌ iÊ ÃÌÊ i½ÃÊ ÃÌÀiîʰ°°°°°°°°°° oooooooo°Ê°°ÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÌV«>Ìi`ÊÃÃÃÊViÊvÀÊiÝÌÊÞi>ÀÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°ÊfÊÊÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÊ >ÊÜiÊ>iÊ>ÊVÃÌvÛ}ÊVÀi>ÃiÊÌÊÌ iÊÃÃ>ÀiÃÊÜiÊVÕÀÀiÌÞÊÃÕ««À̶ÊÊÚÚÚÚÚÚÚÚÚÚÚ vÊÃ]Ê ÜÊÕV ¶ÊÊÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ 7 V ÊÃÃ>ÀiÃÊV>ÊLiÊ>``i`ÊvÀÊÌ ÞÊÃÕ««À̶ Ê Ê >iÊ ÊÊÊÊÊÕÌÊÊ Ê ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ 7 >ÌÊÃÃÃÊ«ÀiVÌÃÊV>ÊLiÊ>``i`ÊiÝÌÊÞi>À¶ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ ÓÇ Õ>Ê ÃÃÃÊ Õ`}iÌÊ7ÀÊ- iiÌÊÀÊÓäÚÚÚÚ 7ORLD -ISSIONS AND !UXILIARIES Ê ÃÃ>ÀiÃÊÊ Ê ÜÊÛ}ÊÊ*ÀiVÌi`ÊÛ} ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÃÃÃÊ ÛiÌÊÕ`Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ 6ÃÌ}Ê ÃÃ>ÀÞÊÕ`Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ -i`iÀÃÊÕ`ÊÌÊ>ÃÃÃÌÊV>``>ÌiÊÃÃ>Àiîʰ°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ 7 Ê`ÃÌÀ>ÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ,iivÊ*ÀiVÌÃÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÀÃÌ>ÃÊ>`Ê-«iV>Ê"vviÀ}ÃÊvÀÊ ÃÃ>ÀiÃÊ°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ *ÀiVÌÊÕ`ÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÃÃ>ÀÞÊÃÃV>ÌiÃÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê `Ài®ÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ -«ii`ÊÌ iÊ } ÌÊ9ÕÌ ®Ê°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê9ÕÌ ®ÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ 7i½ÃÊ ÃÌÀiÃÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ } ÌÊvÀÊÌ iÊ ÃÌÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ón .ATIONAL 53 -ISSIONS Ê ÃÃ>ÀiÃÊÊ Ê ÜÊÛ}ÊÊ*ÀiVÌi`ÊÛ} ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ 1- Ê`ÃÌÀ>ÌÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ -iÀÛVii½ÃÊ ÃÌÀÞÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÃÃiLiÃÊvÊ`Ê i}iÃÊ>`Ê1ÛiÀÃÌiÃÊ°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ >Ì>Ê/iiÊ >i}iÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ iÀ ÌÞÊ ÃÌÀiÃÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ iÜÊ ÕÀV Ê Û>}iÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÌiÀVÕÌÕÀ>Ê ÃÌÀiÃÊ Ã>Li`]Ê Ì V]ÊiÌV°®Ê°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ "ENEVOLENCES }i`Ê ÃÌiÀÃÊÃÃÃÌ>ViÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ VÀiÃÌÊ `Ài½ÃÊiÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ } >`ÃÊ `Ê*>ViiÌÊ-iÀÛViÊ`«Ìîʰ°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ã>ÃÌiÀÊ,iivÊ1°-°®ÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ $ISTRICT -INISTERS `ÃÌÀ>ÌÊÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÃÌÀVÌÊiÊ ÃÃÃÊ°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ i«>ÀÌiÌ>Ê ÀÃÌ>Ê `ÕV>Ì]Ê9ÕÌ ]ÊiÌV°®Ê°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ /THER ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ ÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê°°°°°°°°°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê 4OTALÊ°°°°°°°°°Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ê ÊÚÚÚÚÚÚÚÚÚÚÚÚÚ Ó V>Ê ÕÀV Ê ÃÌÀiÃÊ7Ì Ê>Ê ÃÃÃÊVÕà #HILDREN ÞÃÊ>`ÊÀÃÊ ÃÃ>ÀÞÊ ÀÕÃ>`iÊ ® ]ÊvÀ>ÞÊ>ÕV i`ÊÊ£{]ÊÃÊÌ iÊÃÃÃÊi`ÕV>ÌÊ>`ÊvÕ`À>Ã}Êi« >ÃÃÊ vÀÊV `ÀiÊÊÌ iÊÃÃiLiÃÊvÊ`°Ê ÞÃÊ>`Ê}ÀÃÊÊV>ÊV ÕÀV iÃÊV>Êi>ÀÊ>LÕÌÊ>`ÊLiÊ ÛÛi`ÊÊvÀi}ÊÃÃÃÊÕÌÀi>V ÊÌ ÀÕ} Ê«>ÀÌV«>ÌÊÊ °Ê ÊLÕÞÃÊ LiÃ]Ê Þ>Ã]ÊÌiÝÌLÃ]ÊVÀÀië`iViÊVÕÀÃiÃ]ÊV>ÃÃiÌÌiÃÊvÀÊÀ>`ÊLÀ>` V>ÃÌÃ]ÊÛ`iÌ>«iÃÊvÀÊV `Ài½ÃÊÌiiÛÃÊ«À}À>Ã]Ê-Õ`>ÞÊ-V ÊÌiÀ>ÌÕÀi]Êy>iÊ}À>« Ê >ÌiÀ>ÃÊ>`Ê«Õ««iÌÃ°Ê Ê >ÃÊvÕ`i`ÊiÝ«iÃÛiÊÌÀ>Ã>ÌÊ«ÀiVÌÃ]ÊÀiÃÕÌ}ÊÊ>}Ê -VÀ«ÌÕÀiÊ>Û>>LiÊÊ>}Õ>}iÃÊvÊ«i«iÊÜ Ê>ÀiÊÕÀi>V i`ÊÜÌ ÊÌ iÊ}ëi°Ê Ê«ÀÛ`iÃÊ >ÞÊiÜÊÛiÀÃi>ÃÊ LiÊÃV ÃÊÜÌ Ê>ÊiÌÀiÊVÀiÊVÕÀÀVÕÕÊÀiviÀiViÊLÀ>ÀÞÊ>`ÊÌÃÊwÀÃÌÊ ÌiÝÌLð Ê>``ÌÊÌÊÃÕ««Þ}ÊiÛ>}iÃÊ>`Ê ÀÃÌ>Êi`ÕV>ÌÊÌiÀ>ÌÕÀiÊvÀÊÕÌÀi>V iÃÊ >ÀÕ`ÊÌ iÊÜÀ`]Ê ÊiiÌÃÊÌ iÊii`ÃÊvÊV `ÀiÊÜ Ê«>ÀÌV«>ÌiÊÊÌ iÊ Ê«À}À>°Ê / iÃiÊV `ÀiÊ}ÀÜÊÌÊÕ`iÀÃÌ>`ÊÃÃÃ]Ê`iÌvÞÊÜÌ ÊÌ iÊÜÀÊvÊÃÃ>ÀiÃÊ>`Ê`i Ûi«Ê>ÊviÌiÊLÕÀ`iÊvÀÊÃÃÃÊÌ >ÌÊÃÊ`iÃÌÀ>Ìi`ÊÊ}Û}Ê>`Ê«À>Þ}° ÛiÀÞÊÌ ÊÊ Ê-Õ`>Þ]ÊV `ÀiÊLÀ}ÊÌ iÀÊ Õ``ÞÊ >ÀÀiÊvviÀ}ÊL>Ã]Ê i>ÀÊ>Ê ÃÃÃÊÃÌÀÞÊÀÊ«Õ««iÌÊÃÌ]Êi>ÀÊ>LÕÌÊ>ÊVÕÌÀÞÊ>`ÊÌÃÊÃÃ>ÀiÃ]Ê«À>ÞÊvÀÊÃÃÃÊ ii`ÃÊ>`ÊiÞÊÌ iÀÊÃÃÃÊi`ÕV>ÌÊ>VÌÛÌiÃ°Ê Õ``ÞÊ >ÀÀi]ÊÌ iÊÌÀ>`Ì>Ê Ê V >À>VÌiÀ]ÊÌiÃÊV `ÀiÊ>LÕÌÊÃÃÃÊ>`Ê«ÀÌiÃÊv>Ì vÕiÃÃÊÊ}Û}°Ê/ ÀÕ} ÊÌ iÊÞi>ÀÃÊ ÌÜÊÌ iÀÊvÀi`ÃÊ >ÛiÊLiiÊ>``i`°Ê*iVÊ*>ÊiVÕÀ>}iÃÊV `ÀiÊÌÊ i«ÊëiVwVÊÃÃ>ÀiÃÊ LÞÊ«À>Þ}ÊvÀÊÌ iÊ>`ÊÜÀÌ}ÊiÌÌiÀÃÊvÊiVÕÀ>}iiÌ]Ê>`Ê7iÌ i7À`ÊÌiÃÊV `ÀiÊ >LÕÌÊ«i«iÊÊÛ>ÀÕÃÊVÕÌÀiÃÊ>`ÊVÕV>ÌiÃÊ`½ÃÊ i>ÀÌÊvÊÛiÊvÀÊÌ iÊÜÀ`° / ÀÕ} ÊÌ iÊ Ê«À}À>]ÊV `ÀiÊÀiViÛiÊÌ iÊ««ÀÌÕÌÞÊÌÊ>VVi«ÌÊ>`Ê>VÌÊÕ«ÊÌ iÊ Ài>ÌÊ Ãð ÞÊV>ÊV ÕÀV ÊÌiÀiÃÌi`ÊÊ«iiÌ}Ê Êà Õ`ÊV>Ê{£Ç®ÊnÈÓÓÇn£]ÊiÝÌiÃÊ {ää]ÊÀÊ}ÊÌÊÜÜÜ°L}V°>}°À}Ê>`ÊÀiµÕiÃÌÊÜÊ Ê9ÕÊ-Ì>ÀÌÊ>Ê Ê*À}À>¶ 9OUTH -«ii`ÊÌ iÊ } ÌÊ-/ ® -«ii`ÊÌ iÊ } Ì]ÊëÃÀi`ÊLÞÊÌ iÊÃÃiLiÃÊvÊ`Ê9ÕÌ Ê i«>ÀÌiÌ]ÊÃÊÌ iÊÞÕÌ Ì>Ìi`ÊÃÌÀÞÊÌ >ÌÊ«ÀÛ`iÃÊÌÀ>ëÀÌ>ÌÊ>`ÊVÕV>ÌÊiµÕ«iÌÊÌÊÃÃ>ÀiÃÊ >ÀÕ`ÊÌ iÊÜÀ`°Ê ÞÊÀ>Ã}ÊvÕ`ÃÊÌÊ«ÕÀV >ÃiÊiµÕ«iÌ]ÊÃÃiLiÃÊvÊ`ÊÞÕÌ Ê >ÛiÊ >`iÊ-/ ÊiÊvÊÌ iÊÃÌÊivviVÌÛiÊÃÃÃÊ«À}À>ÃÊÊÌ iÊÜÀ`°Ê-ViÊÌ iÊ«À}À>½ÃÊ Vi«ÌÊÊ£{{]ÊÃÃiLiÃÊvÊ`ÊÞÕÌ Ê >ÛiÊÀ>Ãi`ÊÀiÊÌ >Êf£nxÊ° -/ ÊÜÀÃÊLiV>ÕÃiÊÃÃiLiÃÊvÊ`ÊÞÕÌ Ê>VÀÃÃÊÌ iÊ1Ìi`Ê-Ì>ÌiÃÊ>ÀiÊÌiÀiÃÌi`ÊÊÃii }ÊÌÊÜÀ°Ê/ iÞÊ >ÛiÊ>VVi«Ìi`ÊÌ iÊÀiëÃLÌÞÊvÀÊÛÕÌ>ÀÞÊÀ>Ã}ÊvÕ`ÃÊÌÊ«ÕÀV >ÃiÊ ÌÀ>ëÀÌ>Ì]Ê«ÀÌ}Ê>`ÊVÕV>ÌÃÊiµÕ«iÌÊvÀÊÃÃ>ÀiÃÊÊiÛiÀÞÊVÌiÌ°Ê / iÀÊÃ>VÀwV>ÊvviÀ}ÃÊ>ÃÃÃÌÊÃÃ>ÀiÃÊÊÀi>V }ÊÌ iÊÃÌÊÜÌ ÊÌ iÊ}ëi° -/ Ê >ÃÊ«ÀÛ`i`ÊiµÕ«iÌÊvÀÊÃÃÃÊÕÌÀi>V iÃÊÊÀiÊÌ >ÊÓääÊVÕÌÀiÃÊ>`ÊÌiÀ ÀÌÀiÃ]Ê>ÃÃÃÌ}Ê>ÃÌÊÓ]äääÊÃÃ>ÀiÃ]ÊiÜÊV ÕÀV iÃ]Ê/iiÊ >i}iÊViÌiÀÃ]ÊÌiÀ> Ì>ÊÃÌÀiÃÊ>`ÊÛiÀÃi>ÃÊ LiÊÃV ð Îä >V ÊÞi>ÀÊÊ-«ii`ÊÌ iÊ } ÌÊ >Þ]ÊÌ iÊÌ À`Ê-Õ`>ÞÊÊ"VÌLiÀ]ÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊ >ÀiÊ>Ãi`ÊÌÊÌ>iÊ>ÊëiV>ÊvviÀ}ÊvÀÊ-/ °Ê7À`Ê ÃÌÀiÃÊVÀi`ÌÊÃÊ}ÛiÊÌÊi>V ÊV ÕÀV É `ÀÊÜ ÊVÌÀLÕÌiÃÊÌÊ-/ °Ê"vviÀ}ÃÊÕÃÌÊLiÊÀiViÛi`ÊÊÀÊLivÀiÊ iViLiÀÊΣÊÌÊÀi ViÛiÊVÀi`ÌÊvÀÊÌ iÊVÕÀÀiÌÊV>i`>ÀÊÞi>À° ÞÊV ÕÀV ÊÞÕÌ Ê}ÀÕ«ÊÌiÀiÃÌi`ÊÊLiV}ÊÛÛi`ÊÊ>ÊÜÀ`ÊÃÃÃÊÕÌÀi>V Ê Ì ÀÕ} Ê-/ Êà Õ`ÊV>Ê{£Ç®ÊnÈÓÓÇn£]ÊiÝÌiÃÊ{äÓ]ÊÀÊ}ÊÌÊÜÜÜ°ÞÕÌ °>}°À}° 7OMEN 7i½ÃÊ ÃÌÀià ÛiÀÞÊÞi>ÀÊÌ ÕÃ>`ÃÊvÊÃÃiLiÃÊvÊ`ÊÜiÊÊV>ÊV ÕÀV iÃÊ«>ÀÌV«>ÌiÊÊÌ iÊ> Ì>Ê7i½ÃÊ ÃÌÀiÃÊ«À}À>Ê>`ÊVÌÀLÕÌiÊÌÊÜÀ`Ü`iÊÃÃÃÊÕÌÀi>V iÃÊÌ ÀÕ} Ê Ì iÀÊÃÌÀÞÊÌÊÃÃ>Àið / iÀÊÃÕ««ÀÌÊvÊÃÃÃÊÃÊ>À}iÞÊÌ ÀÕ} ÊÛÛiiÌÊÊ>Ì>Ê7i½ÃÊ ÃÌÀiÃÊ «ÀiVÌÃpÌ iÊ`«ÌÊ*>]Ê ÌÌ>Ê > ÕÊÕ`Ê>`ÊÌ iÊ LÀ>ÀÞÊÕ`°Ê/ iÃiÊ«ÀiVÌÃÊ`vviÀÊ Ê`iÃ}Ê>`ÊiÌ `}Þ]ÊLÕÌÊÌ iÞÊV«iiÌÊiÊ>Ì iÀÊÊÌ iÀÊVÊ«ÕÀ«ÃiÊvÊ ÃÕ««ÀÌ}ÊÃÃð / iÊ`«ÌÊ*>ÊÃÊ>ÊvÀi`à «Ê«À}À>ÊÊÜ V Ê7i½ÃÊ ÃÌÀiÃÊ}ÀÕ«ÃÊ>`Ê Ã ÃiÌÌiÃÊVÕLÃÊ>`«ÌÊÃÃ>ÀÞÊv>iÃÊvÀÊÌ iÊV ÕÀV ½ÃÊ`ÃÌÀVÌ°Ê/ iÊ>`«Ì}Ê}ÀÕ«Ê>VVi«ÌÃÊ ÀiëÃLÌÞÊÌÊà >ÀiÊëiV>ÊVV>ÃÃ]ÊVViÀÃÊ>`Ê«iÀÃ>Êii`ÃÊvÊÌ iÊÃÃ>ÀÞÊÌ ÀÕ} Ê «À>ÞiÀ]ÊVÀÀië`iViÊ>`Ê}vÌðÊ/ iÊVÌiÌÊÃÊvÀÊiÊvÕÊÌiÀÊvÊÌ iÊÃÃ>ÀÞ½ÃÊ>« «ÌiÌ]ÊÕiÃÃÊÌ iÀÊ>ÀÀ>}iiÌÃÊ>ÀiÊ>`iÊLÞÊÌ iÊ`ÃÌÀVÌÊ7i½ÃÊ ÃÌÀiÃÊ`ÀiVÌÀ° / iÊ/ÕV ÊÌ iÊ7À`ÊÕ`ÊvÀiÀÞÊÌ iÊ ÌÌ>Ê > ÕÊÕ`®ÊÜ>ÃÊiÃÌ>Là i`ÊÊ£xÇÊÌÊ ÃÕ««ÞÊ`ÀÊiµÕ«iÌÊ>`ÊvÕÀà }ÃÊvÀÊvÀi}ÊÃÃ>ÀiÃ]Ê iÊÃÃ>ÀiÃÊ>`Ê >Ì>ÊLiiÛiViÊÃÌÌÕÌÃÊÜi`ÊLÞÊÌ iÊÃÃiLiÃÊvÊ`°Ê"vviÀ}ÃÊvÀÊÌ ÃÊvÕ`Ê>ÀiÊ Ì>iÊi>V ÊÞi>ÀÊÊ/ÕV ÊÌ iÊ7À`ÊÕ`Ê >Þ°Ê"vviÀ}ÃÊ>ÀiÊÃiÌÊÌÊÌ iÊ>Ì>Ê7i½ÃÊ ÃÌÀiÃÊ i«>ÀÌiÌÊÜ iÀiÊÌ iÞÊ>ÀiÊ i`ÊÊÀiÃiÀÛiÊÕÌÊÌ iÊi`ÊvÊÌ iÊÞi>ÀÊ>`ÊÌ iÊ`à ÌÀLÕÌi`°Ê}ÊÌiÃÊÌ >ÌÊ >ÛiÊLiiÊ«ÕÀV >Ãi`Ê>ÀiÊViÀV>ÃâiÊÌV iÊ>`Ê>Õ`ÀÞÊ >««>ViÃÆÊV>ÃÃÀ]Ê`}ÊÀÊ>`Ê`ÀÌÀÞÊvÕÀÌÕÀiÆÊ>`ÊvwViÊiµÕ«iÌ° / iÊ LÀ>ÀÞÊÕ`ÊÃÊ>Ê«ÀiVÌÊÌÊ«>ViÊÀi}ÕÃÊÀiviÀiViÊ>`ÊÃÌÕ`ÞÊLÃÊÊÌ iÊLÀ>ÀiÃÊvÊ ÜÀ`Ê>`Ê iÊÃÃÃÊ LiÊÃV ðÊ/ ÃÊvÕ`ÊÃÊÃÕ««ÀÌi`ÊvÀÊÌ iÊÃ>iÊvÊV>Vii`Ê«ÃÌ >}iÊÃÌ>«ÃÊ>`ÊVÌÀLÕÌðÊ7i½ÃÊ ÃÌÀiÃÊ}ÀÕ«ÃÊ>`ÊÌiÀiÃÌi`Ê`Û`Õ>ÃÊViVÌ]Ê «Ài«>Ài]ÊÃÀÌÊ>`ÊÃi`ÊÌ iÊÃÌ>«ÃÊÌÊÌ iÊ>Ì>Ê7i½ÃÊ ÃÌÀiÃÊ i«>ÀÌiÌÊvÀÊ>ÀiÌ }°Ê/ iÞÊ>ÃÊ>ÞÊV ÃiÊÌÊ>ÀiÌÊÌ iÊÃÌ>«ÃÊV>ÞÊÌ ÀÕ} ÊÃÌ>«Ê>`ÊVÊ`i>iÀÃÊ>`Ê Ãi`ÊÌ iÊ«ÀVii`ÃÊÌÊÌ iÊ>Ì>Ê`i«>ÀÌiÌ°Ê ÕÀV iÃÊÀiViÛiÊ7À`Ê ÃÌÀiÃÊVÀi`ÌÊvÀÊ vviÀ}ÃÊ}ÛiÊÌÊÌ iÊvÕ`°ÊÜiÛiÀ]ÊVÀi`ÌÊV>ÌÊLiÊ}ÛiÊvÀÊÃÌ>«ÃÊÌ >ÌÊ>ÀiÊ>ÀiÌi`ÊLÞÊ Ì iÊ>Ì>Ê7i½ÃÊ ÃÌÀiÃÊ i«>ÀÌiÌ° ÞÊV>ÊV ÕÀV ÊÌiÀiÃÌi`ÊÊÃÌ>ÀÌ}Ê>Ê7i½ÃÊ ÃÌÀiÃÊ}ÀÕ«]ÊÀÊ>ÞÊ7i½ÃÊ ÃÌÀiÃÊ}ÀÕ«ÊÌiÀiÃÌi`ÊÊÀiÊvÀ>ÌÊà Õ`ÊV>Ê{£Ç®ÊnÈÓÓÇn£ÊÀÊÛÃÌÊÌ iÊ7i½ÃÊ ÃÌÀiÃÊÀiÃÕÀViÊ«>}iÊ>`ÊiÊÃÌÀiÊ>ÌÊÜÜÜ°ÜiÃÃÌÀið>}°À}°Ê -EN i½ÃÊ ÃÌÀiÃÊÊ } ÌÊvÀÊÌ iÊ ÃÌÊ / ® ÛiÀÞÊÞi>ÀÊÌ ÕÃ>`ÃÊvÊiÊ«>ÀÌV«>ÌiÊÊÜÀ`ÊÃÃÃÊÕÌÀi>V ÊÌ ÀÕ} ÊÌ iÊ i½ÃÊ ÃÌÀiÃÊ«À}À>ÊvÊ } ÌÊvÀÊÌ iÊ ÃÌÊ / ®]ÊÌ iÊÃÃÃÊiÛ>}iÃÊ>ÀÊvÊÌ iÊ`i«>ÀÌ iÌÊÌ >ÌÊ«ÀÛ`iÃÊiÞÊvÀÊiÛ>}iÃÊÌiÀ>ÌÕÀi° Σ 7 iÊ>LÕÌÊxÊ«iÀViÌÊvÊ>Ê ÀÃÌ>ÊÌiÀ>ÌÕÀiÊÃÊ«ÀÌi`ÊvÀÊ«i«iÊÜ Ê >ÛiÊ>Ài>`ÞÊ>V Vi«Ìi`Ê ÀÃÌ]Ê / Ê«ÀÛ`iÃÊÌiÀ>ÌÕÀiÊvÀÊÕLiiÛiÀÃ°Ê ÌiÀ>ÌÕÀiÊÃÊiÊvÊÌ iÊÃÌÊ«ÜiÀvÕÊ iÛ>}iÃÊÌÃÊ>Û>>LiÊ>`ÊÃÊÛÌ>ÊÌÊÌ iÊÃÌÀÞÊvÊÜÀ`ÊÃÃ>ÀiÃÊÊëÀi>`}ÊÌ iÊ }ëiÊvÊiÃÕÃÊ ÀÃÌÊ>`ÊLÀ}}ÊiÜÊVÛiÀÌÃÊÌÊ° ÊÊ ÛiÀÞÊÞi>ÀÊÌ iÊÜÀ`ÊLiViÃÊÀiÊÌiÀ>Ìi°Ê ÊÊ ÌiÀ>ÌÕÀiÊÃÊÀi>`ÊÛiÀÊ>`ÊÛiÀÊ>}>°Ê ÊÊ ÌiÀ>ÌÕÀiÊÃÊÀi>`ÊLÞÊ«i«iÊÊ>ÊÜ>ÃÊvÊvi°Ê ÊÊÊ ÌiÀ>ÌÕÀiÊVÀÃÃiÃÊVÕÌÕÀ>ÊL>ÀÀiÀÃ]Ê}iÃÊÜ iÀiÊÃÃ>ÀiÃÊV>ÌÊ>`ÊÊ`iýÌÊii`Ê>Ê «>ÃëÀÌÊÀÊÛÃ>°Ê ÊÊ >V ÊÞi>ÀÊ«i«iÊ>ÊÛiÀÊÌ iÊÜÀ`Ê i>ÀÊ>LÕÌÊ ÀÃÌÊvÀÊÌ iÊwÀÃÌÊÌiÊÌ ÀÕ} ÊÌiÀ>ÌÕÀi° / Ê ÕVi iÊ«>ÀÌV«>Ì}ÊÊ / Ê>ÀiÊV>i`Ê ÕVi°Ê ÕViÊVÕ`iÊ ÀÃÌ>Ê>ÞiÊ >`ÊÃÌiÀÃÊÜ Ê >ÛiÊ>ÊLÕÀ`iÊvÀÊÃÃÃÊ>`ÊÜ ÊÕ`iÀÜÀÌiÊ / ½ÃÊ«iÀ>Ì>ÊiÝ«ià iðÊ/ ÕÃ>`ÃÊvÊ ÕViÊ>ÌÜ`iÊVÛiÀÊÌ iÊVÃÌÊvÊÌiÀ>ÌÕÀiÊvÕ`ÊÀ>Ã}ÊÃÊÌ >ÌÊ£ääÊ «iÀViÌÊvÊ>ÊiÃÊ}ÛiÊV>ÊLiÊÕÃi`ÊÌÊ«ÀÛ`iÊÌiÀ>ÌÕÀi°Ê ÕViÊÀi>V ÊÕÌÊÌÊiÊ>ÃÊ Ì iÞÊ i«ÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊ ÀÃÌ>ÊÜÀiÀÃÊëÀi>`ÊÌ iÊiÃÃ>}iÊvÊiÃÕÃÊ ÀÃÌ° / ÊÕÀÊ ÕVi / iÊ / ÊÕÀÊ ÕViÊ«À}À>]ÊëÃÀi`ÊLÞÊÌ iÊ>Ì>Ê,Þ>Ê,>}iÀÃÊ>`Ê / Ê vwViÃ]Ê}ÛiÃÊ,Þ>Ê,>}iÀÃÊ>Ê««ÀÌÕÌÞÊÌÊ«>ÀÌV«>ÌiÊÊ / Ê>`ÊÌÕV ÊÌ iÊÜÀ`ÊvÀÊ ÀÃÌ° /ÊLiÊi}LiÊÌÊLiViÊ>ÊÕÀÊ ÕV>]Ê>Ê,Þ>Ê,>}iÀÊÕÃÌÊ >ÛiÊi>Ài`Ê>Ê*iiÀÃÊ -iV`Ê >ÃÃÊÀ>Ì}Ê>`ÊLiÊ£ÇÊÞi>ÀÃÊ`ÊÀÊÞÕ}iÀ° / ÊÕÀÊ ÕViÊ>ÀiÊÛÌi`ÊÌÊ>ÌÌi`Ê / ÊL>µÕiÌÃÊ>`ÊÀ>iÃ°Ê ÕÀ}Êi>V Ê >Õ>Ê / ÊL>µÕiÌ]ÊÕÀÊ ÕViÊ>`ÊÌ iÀÊV>`iÀÃÊ>ÀiÊV >i}i`ÊÌÊ>VÌÛiÞÊ ÃÕ««ÀÌÊ / ° / iÊÕwi`ÊivvÀÌÃÊvÊiÊ>`ÊLÞÃÊ>VÀÃÃÊÌ ÃÊ>ÌÊ>ÀiÊi>`}ÊÌ ÕÃ>`ÃÊvÊ«i«iÊÌÊ ÀÃÌÊi>V ÊÞi>ÀÊ>ÀÕ`ÊÌ iÊÜÀ`°Ê ÃÃ>ÀiÃÊ`i«i`ÊÊÌ iÀÊ i«° ÜÊ iÃÊ / Êi«Ê7À`Ê ÃÃÃ¶Ê 7À`ÊÃÃ>ÀiÃÊÕÃiÊ / ÊiÞÊÌÊ«ÀÛ`iÊ LiÃ]Ê LiÊ«ÀÌÃÊ>`Ê«ÀÌi`ÊiÛ>}i ÃÊÌiÀ>ÌÕÀi°Ê/ iÊiÛ>}iÃÊÌiÀ>ÌÕÀiÊÃÊÕÃi`ÊvÀÊ}iiÀ>Ê`ÃÌÀLÕÌÊLÞÊ>Ì>ÃÊ>`Ê Ê Ìi>ÃÆÊÊViVÌÊÜÌ Ê`Ê iÜÃÊ ÀÕÃ>`iÃ]Ê`ÀÌ`ÀÊ>`ÊÃÌÀiiÌÊÜÌiÃÃ}ÆÊ>`Ê>ÃÊ vÜÕ«ÊÌÊiÜë>«iÀ]ÊÀ>`Ê>`ÊÌiiÛÃÊÀiëÃiðÊ7Ì Ê i«ÊvÀÊ / ]ÊÃÃ>ÀiÃÊ «ÀÌÊÕV ÊvÊÌ iÀÊÜÊÌiÀ>ÌÕÀiÊ>`ÉÀÊ«ÕÀV >ÃiÊ«ÀÌi`Ê>ÌiÀ>ÃÊvÀÊL>Ê1ÛiÀÃÌÞÊ >`Ê viÊ*ÕLà iÀð ÎÓ ÜÊÌÊiÌÊÌ iÊ ÃÌÊÀÊÌ iÊ ÃÃ>ÀÞÊ6ÃÌ iÌÌ}ÊÌ iÊÃÌÊvÀÊÌ iÊÃÃ>ÀÞÊÛÃÌÊLi}ÃÊÜÌ Ê>ÌÌÌÕ`i°Ê,iiLiÀ]ÊÞÕÀÊV ÕÀV Ê ii`ÃÊÃÃ>ÀiÃÊ>ÃÊÕV Ê>ÃÊÌ iÞÊii`ÊÞÕ°ÊÊÃÃ>ÀÞÊV>½ÌÊ}ÊÜÌ ÕÌÊw>V>Ê>`Ê «À>ÞiÀÊÃÕ««ÀÌÊ«ÀÛ`i`ÊLÞÊÌ iÊV>ÊV ÕÀV ]ÊLÕÌÊ>ÊÊV}Ài}>ÌÊV>ÌÊvÕwÊÌ iÊÀi>ÌÊ ÃÃÊÜÌ ÕÌÊÃÃ>ÀiÃÊÜ Ê>ÀiÊÜ}ÊÌÊÌ>iÊÌ iÊ}ëiÊÌÊÌ iÊi`ÃÊvÊÌ iÊi>ÀÌ ° ÊÌ iÀÊÜÀ`Ã]ÊÃÃÃÊÃÊ>Ê«>ÀÌiÀà «°Ê*>ÀÌiÀÃÊÀiëiVÌÊiÊ>Ì iÀÊ>`ÊÜÀÊVÃiÞÊ ÜÌ Êi>V ÊÌ iÀÊÌÊÀi>V ÊÌ iÀÊVÊ}>Ã°Ê Ü}ÊÌ iÊ«ÀÌ>ViÊvÊÌ ÃÊÕÌÕ>Êii`ÊvÀÊ i>V ÊÌ iÀ]ÊVÃ`iÀÊÃiÊÜ>ÞÃÊÌ >ÌÊ>ÊV ÕÀV ÊV>Ê>iÊ>ÊÃÃ>ÀÞÊÛÃÌÊ«i>Ã>ÌÊ>ÃÊÜiÊ>ÃÊ ivviVÌÛi° *ÀiÃiÀÛViÊ*>} UÊÊ7 iÊ>ÊV>``>ÌiÊÃÃ>ÀÞÊÃÊ>««ÀÛi`ÊÊÞÕÀÊ`ÃÌÀVÌ]ÊV>Êi`>ÌiÞÊÌÊÃV i`ÕiÊ>Ê ÃiÀÛVi°Ê/ ÃÊÜÊLiÊ i«vÕÊ>ÃÊ iÊÀÊà iÊÃiÌÃÊÕ«Ê>ÊÌiÀ>ÀÞ° UÊÊ,iÌÕÀÊÌ iÊÃÃ>ÀÞ½ÃÊ« iÊV>ðÊ/ ÃÊÜÊÃ>ÛiÊÌi]ÊiÞÊ>`ÊÃÌÀiÃÃÊvÀÊÌ iÊÊ ÃÃ>ÀÞ° UÊ-V i`ÕiÊÌ iÊÃÃ>ÀÞÊvÀÊ>ÞÊÀi}Õ>ÀÊÃiÀÛViÊÀÊiÛiÊ>Ê iÊ}ÀÕ«° UÊÊvÊÞÕÊV>½ÌÊÃV i`ÕiÊÌ iÊÃÃ>ÀÞÊvÀÊ>ÊÃiÀÛVi]ÊÃ>ÞÊðÊ/ iÊÃÃ>ÀÞÊÜÕ`Ê«ÀiviÀÊ>Ê º»ÊÌÊLi}Ê«ÕÌÊvv° UÊÊ/iÊÃÃ>ÀiÃÊÜ >ÌÊ«>ÀÌV«>ÌÊÌ iÞÊÜÊ >Ûi°ÊÜÊ>ÞÊÌiÃÊÜÊÌ iÞÊëi>¶Ê ÊÞÕÊÜ>ÌÊÌ iÊ>ÃÊÌÊëi>ÊÊ>Ê-Õ`>ÞÊ-V ÊV>ÃÃÊÀÊÌÊ>ÊÞÕÌ ÊÀÊV `Ài½ÃÊ }ÀÕ«¶ UÊ ÕV>ÌiÊÌ iÊÌÞ«iÊvÊ`ÀiÃÃÊ>««À«À>ÌiÊvÀÊÌ iÊÃiÀÛVi° UÊÊ/iÊÌ iÊÃÃ>ÀÞÊÌ iÊÃiÀÛViÊÌiÃÊ>`ÊÌ iÊÌiÊÜ iÊÞÕÊV>ÊiiÌÊ«ÀÀÊÌÊÌ iÊÃiÀÛViÊ vÀÊ«>}° UÊÊ*ÀÛ`iÊÌ iÊÃÃ>ÀÞÊÜÌ ÊvÀ>ÌÊVViÀ}Ê ÌiÊ>VV`>ÌÃÊÜ iÊ iÊÀÊ Ã iÊÃÊÜÌ ÊÞÕ° UÊ iÊÃÕÀiÊÌÊ}ÛiÊVi>ÀÊ`ÀiVÌÃÊÌÊÌ iÊV ÕÀV Ê>`ÊÌ iÊÃiÀÛViÊÌið UÊÊÛiÊÌ iÊÃÃ>ÀÞÊ>ÊÌii« iÊÕLiÀÊÌ iÀÊÌ >ÊÌ iÊV ÕÀV ÊvwVi°Ê/ iÊÃÃ>ÀÞÊ >ÞÊii`ÊÌÊV>Ê>ÌÊ>ÊÌiÊÜ iÊÌ iÊvwViÊÃÊÌÊ«i° / iÊ ÃÃ>ÀÞÊ6ÃÌ %ÊÊ >iÊÌiÊ>Û>>LiÊÌÊiiÌÊÜÌ ÊÌ iÊÃÃ>ÀÞÊ«ÀÀÊÌÊÌ iÊÃiÀÛViÊÌÊ}iÌÊLiÌÌiÀÊ>V µÕ>Ìi`]Ê>ÃʵÕiÃÌÃÊ>LÕÌÊëiVwVÊii`ÃÊ>`Ê`ÃVÕÃÃÊÌ iÊ«>À>iÌiÀÃÊvÀÊÌ iÊÃiÀÛVi° UÊ7ÊÌ iÊÃÃ>ÀÞÊLiÊ«Ài>V }ÊÀÊ >ÛiÊ>ÊLÀivÊÜ`ÜÊÊ>ÊÃiÀÛVi¶ UÊÃÊÌ iÊÃÃ>ÀÞÊ>ÊÃi`Ê«ÕLVÊëi>iÀÊÀÊÜÕ`ÊÌÊLiÊLiÌÌiÀÊÌÊV`ÕVÌÊ>ÊÌiÀÛiÜ¶Ê UÊ7 >ÌÊÃÊÌ iÊÌiÊvÀ>iÊvÀÊ ÃÊÀÊ iÀÊ«>ÀÌV«>̶ UÊ ÊÞÕÊÜ>ÌÊ>ÊÃiÀ]ÊiÝ«iÀiViÃÊvÀÊÌ iÊwi`ÊÀÊLÌ ¶ UÊÊ/iÊÌ iÊÃÃ>ÀÞÊÜ >ÌÊ iÊÀÊà iÊV>Ê`ÊÌÊ>ÃÃÃÌÊÞÕÊÊLÕ`}Ê>ÊÃÌÀ}ÊÃÃÃÊÛ ÃÊÜÌ ÊÞÕÀÊV}Ài}>Ì° UÊÊÛiÊÌ iÊV}Ài}>ÌÊÌ iÊ««ÀÌÕÌÞÊÌÊÀië`ÊÜÌ Ê>Ê}iiÀÕÃÊÊvviÀ}Ê>vÌiÀÊÌ iÊ ÃÃ>ÀÞÊ >ÃÊà >Ài`Ê ÃÊÀÊ iÀÊÛÃÊ>`ÊÃÌÀÞ° ÎÎ UÊÊ ÃÃ>ÀiÃÊà Õ`ÊÀiViÛiÊ>ÊvviÀ}ÊÀ>Ì iÀÊÌ >Ê>Ê«Ài`iÌiÀi`Ê À>ÀÕ°Ê9ÕÊ >ÀiÊÌÊ«>Þ}ÊÌ iÊvÀÊÃiÀÛViÃÊÀi`iÀi`ÆÊÀ>Ì iÀ]Ê«i«iÊ>ÀiÊ}Û}ÊÌÜ>À`ÊÌ iÊii`ÃÊvÊ >Ê`Þ}ÊÜÀ`° UÊÊ-iÌÊ>ÊÕÊV>à ÊvviÀ}°Ê/ ÃÊi>ÃÊÌ iÞÊVÕ`ÊÀiViÛiÊÀiÊvÊÌ iÊvviÀ}ÊÃÊ>À}iÀ]Ê LÕÌÊÌ iÞÊÜÕ`ÊiÛiÀÊÀiViÛiÊiÃÃÊÌ >ÊÌ iÊÕ°Ê Ã`iÀÊÌ >ÌÊÊÓääÓ]ÊÌ iÊ>ÛiÀ>}iÊ ÃÃ>ÀÞÊvviÀ}ÊÜ>à >°ÊfΣʫiÀÊÃiÀÛViÊvÀÊV>``>Ìià L°Êf{ÈxÊ«iÀÊÃiÀÛViÊvÀÊÛiÌiÀ>à vÌiÀÊ/ iÊ-iÀÛVi UÊÊ >iÊÌiÊÌÊ ÃÌÊÌ iÊÃÃ>ÀÞÊvÀÊ>Êi>ÊÀÊ`iÃÃiÀÌ°Ê/ ÃÊÜÊ}ÛiÊÀiÊÌiÊÌÊ}iÌÊ >VµÕ>Ìi`° UÊÊ >iÊ«ÀÛÃÊÌÊ}ÛiÊÌ iÊÃÃ>ÀÞÊ>ÊV iVÊvÀÊÌ iÊvviÀ}ÊÜ iÊ iÊÀÊà iÊÃÊÌ iÀi°Ê / iÃiÊvÕ`ÃÊ>ÞÊLiÊii`i`ÊvÀÊÌÀ>ÛiÊÌÊÌ iÊiÝÌÊ`iÃÌ>Ì° UÊÊÛiÊÃÃ>ÀiÃÊ>ÊÃ}i`ÊÌ ÞÊVÌiÌÊvÀÊLivÀiÊÌ iÞÊi>Ûi°Ê/ ÃÊÜÊ >ÃÌiÊ Ì iÀÊ`i«>ÀÌÕÀiÊÌÊÌ iÊwi`Ê>`ÊÜÊÀiiÛiÊ>Ê}Ài>ÌÊ`i>ÊvÊÃÌÀiÃðÊ/ iÊ>ÛiÀ>}iÊÌ ÞÊ VÌiÌÊÃÊfxΰ UÊÊvÊÌÊýÌÊ«ÃÃLiÊÌÊ}ÛiÊÌ iÊ>ÊÃ}i`ÊVÌiÌÊÜ iÊÌ iÞÊ>ÀiÊÌ iÀi]ÊÌiÊÌ iÊÜ >ÌÊ ÞÕÊ «iÊÌÊ`Ê>`ÊÜ iÊÞÕÊ«>ÊÌÊ`ÊÌ° Î{ 3%#4)/. !SSEMBLIES OF 'OD 7ORLD -ISSIONS Ê ÝÌiÃÊvÊÌ iÊ V>Ê ÕÀV iÊÃÃiLiÃÊvÊ`ÊÃÊÃÌÊVÌÌi`ÊÌÊºÌ iÊ}Ài>ÌiÃÌÊiÛ>}iÃÊÌ iÊ /ÜÀ`Ê >ÃÊiÛiÀÊÃii°»Ê7À}ÊÊV«iÀ>ÌÊÜÌ ÊÌ iÊV>ÊV ÕÀV ]ÊÜÀ`Ê ÃÃÃÊ >ÃÊLiiÊÌ iÊiÞÊÌÊVÀ`>Ì}Ê>`Ê>`ÃÌiÀ}ÊÀiÃÕÀViÃÊ}ÛiÊLÞÊ Ì ÕÃ>`ÃÊvÊV}Ài}>ÌÃÊ>VÀÃÃÊiÀV>°Ê7À`ÊÃÃÃÊÃÊ>ÊiÝÌiÃÊvÊ Ì iÊV>ÊV ÕÀV ]Ê>}ÊÌÃÊyÕiViÊ«ÃÃLiÊÊÀiÊÌ >ÊÓääÊVÕÌÀiÃÊ>`Ê ÌiÀÀÌÀiÃÊ>ÀÕ`ÊÌ iÊÜÀ`° ÊiÀÕÃ>iÊÌ iÊLiiÛiÀÃÊÜiÀiÊ}>`ÊÌÊÃiiÊÕðÊ/ iÊiÝÌÊ`>ÞÊ*>ÕÊÜiÌÊÜÌ Ê ÕÃÊÌÊÛÃÌÊ>iÃ]Ê>`Ê>ÊÌ iÊi`iÀÃÊÜiÀiÊÌ iÀi°Ê*>ÕÊ}ÀiiÌi`ÊÌ iÊ>`ÊÌ`ÊÌ iÊ iÛiÀÞÌ }Ê`Ê >`Ê`iÊ>}ÊÌ iÊÌ iÀÊ>ÌÃÊÌ ÀÕ} Ê °Ê7 iÊÌ iÞÊÌ iÊ i`iÀÃ®Ê i>À`ÊÌ Ã]ÊÌ iÞÊ«À>Ãi`Ê`° VÌÃÊÓ£\£ÇÓäÊ 6 Îx 0!24 !LL !BOUT !SSEMBLIES OF 'OD 7ORLD -ISSIONS ÊÌÀÕiÊÃÃ>ÀÞÊi`i>ÛÀÃÊLi}Ê>`Êi`ÊÜÌ Ê`ÊÌ iÊ Ài>ÌÀ]Ê-ÕÃÌ>iÀ]Ê->ÛÀÊ>`Ê À`°Ê/ iÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ«À}À>ÊÃiiÃÊÌÊ`iÌvÞÊÜÌ ÊÃÊ«ÕÀ«ÃiÃ]ÊÃÊ Ì >ÌÊÊ>ÊÌ }ÃÊiÊÃÊ}Àwi`Ê>`ÊÃÊ«>ÊvÀÊÌ iÊÜÀ`ÊvÕwi`° 7À`Ê ÃÃÃÊ*ÕÀ«Ãi iÊÃÃiLiÃÊvÊ`Êi>`ÃÊiÊvÊÌ iÊ>ÀÊÃÃ>ÀÞÊÕÌÀi>V iÃÊÊÌ iÊÜÀ`Ê>`ÊÃÊ /Ì iÊ>À}iÃÌÊÃÃÃÊL`ÞÊÊÌ iÊ Û>}iV>ÊiÜà «ÊvÊ ÃÃÃÊ}iViÃÊ ®°ÊÊ >ÞÊVÕÌÀiÃ]ÊÌ iÊÃÃiLiÃÊvÊ`ÊÃÊÌ iÊ>À}iÃÌÊ*ÀÌiÃÌ>ÌÊL`Þ°Ê/ iÊÕLiÀÊvÊiLiÀÃÊ >`Ê>` iÀiÌÃÊÛiÀÃi>ÃÊÃÊ>LÕÌÊ£xÊÌiÃÊ}Ài>ÌiÀÊÌ >ÊÊÌ iÊ1Ìi`Ê-Ì>Ìið ÃÊ>ÊiÌÌÞÊvÊÌ iÊiiÀ>Ê ÕV]ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>vwÀÃÊÌ iÊiÜ Ã «½ÃÊ-Ì>ÌiiÌÊvÊÕ`>iÌ>Ê/ÀÕÌ ÃÊ>`ÊÌÃÊ ÃÌÌÕÌ]ÊÜ V ÊÃÌ>ÌiÃ\ º°Ê°Ê°Ì iÊ«ÀÀÌÞÊÀi>ÃvÀLi}ÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÃÊÌÊLiÊ>Ê>}iVÞÊvÊ`Ê vÀÊiÛ>}iâ}ÊÌ iÊÜÀ`]ÊÌÊLiÊ>ÊVÀ«À>ÌiÊL`ÞÊÊÜ V Ê>Ê>ÞÊÜÀà «Ê`]Ê>`Ê ÌÊLiÊ>ÊV >iÊvÊ`½ÃÊ«ÕÀ«ÃiÊÌÊLÕ`Ê>ÊL`ÞÊvÊÃ>ÌÃÊLi}Ê«iÀviVÌi`ÊÊÌ iÊ>}iÊ vÊÃÊ-°» / iÊÃiÊ«ÕÀ«ÃiÊvÊÜÀ`ÊÃÃÃÊÃÊÌÊëÀiÊ>`Êi>LiÊÌ iÊÃÃiLiÃÊvÊ`ÊÌÊvÕwÊ Ì iÊÀi>ÌÊ ÃÃÊ >ÌÌ iÜÊÓn\£nÓäÆÊ >ÀÊ£È\£xÆÊVÌÃÊ£\n®°Ê/ iÊÃÌÀ>Ìi}ÞÊvÊÜÀ`Êà ÃÃÊÃÊÌ £®Ê Û>}iâiÊÌ iÊëÀÌÕ>ÞÊÃÌÊÌ ÀÕ} Ê>Ê>Û>>LiÊi>Ã°Ê Ó®Ê ÃÌ>Là Ê`}iÕÃIÊV ÕÀV iÃÊ>vÌiÀÊÌ iÊ iÜÊ/iÃÌ>iÌÊ«>ÌÌiÀ° ήÊÊ/À>Ê>Ì>ÊLiiÛiÀÃÊÌÊ«ÀV>ÊÌ iÊ}ëiÊÌÊÌ iÀÊÜÊ«i«iÊ>`ÊÊ>ÊiÝ «>`}ÊÃÃÊÌÊÌ iÀÊ«i«iÊ}Àիð {®ÊÊ- ÜÊV«>ÃÃÊvÀÊÃÕvviÀ}Ê«i«iÊÊ>Ê>iÀÊÀi«ÀiÃiÌ}ÊÌ iÊÛiÊvÊiÃÕÃÊ ÀÃÌ° I`}iÕÃÊV ÕÀV iÃÊ>ÀiÊÌ ÃiÊÌ >ÌÊ>ÀiÊÃiv}ÛiÀ}]ÊÃivÃÕ««ÀÌ}Ê>`ÊÃiv«À«>}>Ì}Ê iÜÊ /iÃÌ>iÌÊV ÕÀV iÃ°Ê 7À`Ê ÃÃÃÊ >À` iÊ7À`Ê ÃÃÃÊ >À`ÊÀi}Õ>ÌiÃÊÌ iÊ>VÌÛÌiÃÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ°Ê // iÊL>À`ÊVÃÃÌÃÊvÊÌ iÊiÝiVÕÌÛiÊ`ÀiVÌÀÊÜ ÊÃiÀÛiÃÊ>ÃÊV >À>®]Ê}iiÀ>ÊÃÕ«iÀÌi `iÌÊiÝÊvwV®ÆÊÌÜÊiÝiVÕÌÛiÊ«ÀiÃLÞÌiÀÃÆÊÜÀ`ÊÃÃÃÊiÝiVÕÌÛiÊ>`ÃÌÀ>ÌÀÆÊÃÝÊÀi} >Ê`ÀiVÌÀÃÊvÊÜÀ`ÊÃÃÃÆÊi} ÌÊ«>ÃÌÀÃÊvÊ«ÀÛiÊÜÀ`ÊÃÃÃÊâi>Ê>`Ê>VV«Ã iÌÃ]Êi>V ÊvÀÊ>Ê`vviÀiÌÊ>Ài>ÊvÊÌ iÊ>ÌÆÊ>`Êi} ÌÊ>Þ«i«i]Êi`ÀÃi`ÊLÞÊÌ iÀÊ«>ÃÌÀÃ]Ê i>V ÊvÀÊ>Ê`vviÀiÌÊ>Ài>ÊvÊÌ iÊ>ÌÊ>`ÊvÀÊV ÕÀV iÃÊÌ iÀÊÌ >ÊÌ ÃiÊÜ ÃiÊ«>ÃÌÀÃÊ ÃiÀÛiÊVVÕÀÀiÌÞÊÊÌ iÊ7À`Ê ÃÃÃÊ >À`° / iÊ7À`Ê ÃÃÃÊ >À`ÊÃÊÀiëÃLiÊvÀÊiÃÌ>Là }Ê«VÞ]Ê>««Ì}ÊÃÃ>ÀiÃÊ >`ÊV>ÀÀÞ}ÊÕÌÊ`ÕÌiÃÊ>ÃÊ>ÃÃ}i`ÊLÞÊÌ iÊ ÝiVÕÌÛiÊ*ÀiÃLÞÌiÀÞ°Ê/ iÊL>À`ÊiiÌÃÊÌÜViÊ>ÊÞi>À° ÎÈ 7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌii iÊ7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌiiÊÃÊÀiëÃLiÊvÀÊÌ iÊ}iiÀ>ÊÃÕ«iÀÛÃÊ>`Ê` /ÀiVÌÊvÊÌ iÊÜÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>`ÊÌÃÊÃÃ>ÀiðÊÌÃÊi>`iÀ à «ÊÕÃÌÊLiÊÊVvÀÌÞÊÜÌ ÊiÃÌ>Là i`Ê«ViÃÊ>`Ê«ÀV«iÃÊvÊÌ iÊiiÀ>Ê ÕVÊ>`Ê Ì iÊ7À`Ê ÃÃÃÊ >À`° iLiÀÃÊvÊÌ iÊ ÝiVÕÌÛiÊ ÌÌiiÊVÕ`iÊÌ iÊiÝiVÕÌÛiÊ`ÀiVÌÀÊV >À>®]Ê>`ÃÌÀ> ÌÀ]ÊÃÝÊÀi}>Ê`ÀiVÌÀÃ]ÊÀiÃi>ÀV Ê`ÀiVÌÀ]Ê`ÀiVÌÀÊvÊ1°-°Ê,i>ÌÃ]Ê`ÀiVÌÀÊvÊ i`>Ê>`Ê `Û>ViiÌ]Ê`ÀiVÌÀÊvÊÌiÀ>Ì>Ê-iÀÛViÊ ÃÌÀiÃÊ>`Ê`ÀiVÌÀÊvÊ*iÀÃiÊ>`Ê> ÞÊ vi° / iÊ ÝiVÕÌÛiÊ ÌÌiiÊiiÌÃÊ>ÌÊi>ÃÌÊViÊÜiiÞÊÌÊ`ÃVÕÃÃÊ>`ÃÌÀ>ÌÛiÊ`iVÃÃÊ Ài}>À`}ÊÃÃ>ÀiýÊÃÌÀiÃ]ÊÜÀÊ>`Ê«iÀÃ>Êii`ð 7À`Ê ÃÃÃÊ-Ì>vv ÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊi«ÞÃÊÀiÊÌ >Ê££äÊ«i«iÊÜ ÊÜÀÊÊ Ì}iÌ iÀÊÌÊÃiÀÛiÊÃÃ>ÀiÃÊ>ÃÊÌ iÞÊV>ÀÀÞÊÕÌÊÌ iÊÀ}>ÊVÌiÌÊÌÊÜÀ`Ê iÛ>}ið / iÊiÝiVÕÌÛiÊ`ÀiVÌÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÃÊiiVÌi`ÊLÞÊÌ iÊiiÀ>Ê ÕVÊ>`ÊÃÊ>ÊiLiÀÊvÊÌ iÊ ÝiVÕÌÛiÊ*ÀiÃLÞÌiÀÞÊ>`ÊiiÀ>Ê*ÀiÃLÞÌiÀÞ°Ê,iëÃL ÌiÃÊvÊÌ iÊiÝiVÕÌÛiÊ`ÀiVÌÀÊVÕ`i £®Ê>VVÕÌ>LÌÞÊÌÊÌ iÊiiÀ>Ê ÕVÊvÀÊÌ iÊiÌÀiÊÜÀ`ÊÃÃÃÊivvÀÌ Ó®ÊV >À>ÊvÊÌ iÊ7À`Ê ÃÃÃÊ >À` ήÊV >À>ÊvÊÌ iÊ7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌii ,i}>Ê ÀiVÌÀà -ÝÊ`ÀiVÌÀÃÊÛiÀÃiiÊÌ iÊivvÀÌÃÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ]ÊÊÌ iÃiÊÃÝÊ}i }À>« V>ÊÀi}Ã\ £®ÊvÀV>Ê Ó®ÊÃ>Ê*>VwVÊ Î®Ê ÕÀ>Ã>Ê {®Ê ÕÀ«iÊ x®Ê >ÌÊiÀV>Ê>`ÊÌ iÊ >ÀLLi>Ê È®Ê ÀÌ iÀÊÃ>Ê Ê>««Ìi`ÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊ«iÀÃiÊi}>}i`ÊÊ>««ÀÛi`ÊÛiÀÃi>ÃÊÃÃÃÊ>V ÌÛÌiÃÊ>ÀiÊÀiëÃLiÊÌÊÌ iÊÀi}>Ê`ÀiVÌÀÊvÊÌ iÊwi`ÊÌÊÜ V ÊÌ iÞÊ>ÀiÊ>ÃÃ}i`° Ài>Ê ÀiVÌÀà 7Ì Êi>V ÊÀi}]Ê>Ài>Ê`ÀiVÌÀÃÊÛiÊÊÌ iÊwi`Ê>`Ê>ÃÃÃÌÊÊLÌ ÊÃÌÀÞÊ>`Ê>`à ÌÀ>ÌÊ>ÃÊii`i`°Ê/ ÃÊÀi`ÕViÃÊÌ iÊ>À}iÊ>ÕÌÊvÊÀiµÕiÃÌÃÊÌ >ÌÊViÊÌÊÌ iÊÀi}>Ê`ÀiVÌÀÊ >`Ê i«ÃÊv>VÌ>ÌiÊ`iVÃÃÊÌ >ÌÊii`ÊÌÊLiÊ>`iÊÊÌ iÊwi`° ÎÇ `ÃÌÀ>ÌÀ / iÊ>`ÃÌÀ>ÌÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÃÊÀiëÃLiÊÌÊÛiÀÃiiÊÌ iÊ«iÀ> ÌÊvÊ>ÊÜÀ`ÊÃÃÃÊ`i«>ÀÌiÌðÊ/ iÃiÊVÕ`i £®ÊÊÌiÀ>Ì>Ê-iÀÛViÃÊ ÃÌÀiÃÊ ÊÊÊ/ iÊÃÌÀiÃÊVÕ`iÊL>Ê1ÛiÀÃÌÞ]Ê viÊ*ÕLà iÀÃ]Ê iÌiÀÊvÀÊ ÃÌÀÞÊÌÊ ÕÃÃ]Êi>Ì >ÀiÊ ÃÌÀiÃ]Ê ÊvÊ«i]Ê>`ÊL>Ê/iiÊ >i}i° Ó®ÊÊ i`>Ê`Û>ViiÌÊ ÊÊÊ/ iÊvÕ`À>Ã}]Êi`>Ê«À`ÕVÌÊ`i«>ÀÌiÌÊvÊ7À`Ê ÃÃð ήÊÊ*iÀÃiÉ>ÞÊ viÊ ÊÊÊ/ ÃÊ`i«>ÀÌiÌÊ«ÀÛ`iÃÊÛiÀÃ} ÌÊvÊÌ iÊÃÃ>ÀÞÊ«iÀÃiÊ«ÀViÃÃÊ>`ÊV>ÀiÊvÊ Ì iÊÃÃ>ÀÞÊv>Þ°Ê ÊÊÊ/ iÊ«iÀÃiÊ«ÀViÃÃÊVÕ`iÃÊÌiÀÛiÜ}]Ê«ÀViÃÃ}Ê>`Ê«ÀÛ`}ÊÀiÌ>ÌÊ vÀÊÃÃ>ÀÞÊV>``>ÌiÃ]ÊÃÃ>ÀÞÊ>ÃÃV>ÌiÃÊ>`Ê ÃÃÃÊLÀ>`Ê*>ViiÌÊ-iÀ ÛViÊ *-®Ê«iÀÃiÊ>`ÊëiV>ÃÌðÊ/ iÞÊ>ÃÊ«ÀÛ`iÊ««ÀÌÕÌiÃÊvÀÊ>Þ«i«iÊ ÌÊÃiÀÛiÊÊÌ iÊÃÃÊwi`ÊÌ ÀÕ} Êà ÀÌÌiÀ]Ê}ÌiÀÊ>`ÊV>ÀiiÀÊÃÌÀiÃÊÜÌ Ê LÌ Ê`Û`Õ>Ê>`ÊÌi>Ê«>ÀÌV«>Ì°Ê ÊÊÊ/ iÊ>ÞÊ viÊ>ëiVÌÊ«iÀÌ>ÃÊÌÊÌ iÊ}}ÊV>ÀiÊvÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊV `ÀiÊÊVÕVÌÊÜÌ ÊÌ iÊÀi}>ÊvwVið {®ÊÊ1°-°Ê,i>ÌÃÊ ÊÊÊ1°-°Ê,i>ÌÃÊÃÊÀiëÃLiÊvÀÊÛiÀÃii}ÊÌ iÊÌiÀ>ÌÊ«ÀViÃÃÊvÊ>Ê>««ÀÛi`Ê >`Ê>««Ìi`ÊÃÃ>ÀiÃ]ÊÌÀ}ÊÌ iÀÊ«À}ÀiÃÃÊ>`Ê>ÕÌ Àâ}Êw>ÊVi>À>ViÊ vÀÊ`i«>ÀÌÕÀiÊÌÊÌ iÊwi`°ÊÌÊ>ÃÊÃiiÃÊÌÊ>Ì>ÊÀi>Ìà «ÃÊLiÌÜiiÊÃÃiLiÃÊ vÊ`Ê7À`Ê ÃÃÃÊ>`ÊV>ÊV ÕÀV iÃ]Ê«>À>V ÕÀV ÊÀ}>â>ÌÃ]ÊÃÌÌÕÌÃÊ >`Ê`ÃÌÀVÌðÊ-iÀÛViÃÊvÊÌ ÃÊ>Ài>ÊVÕ`iÊÌ iÊVÀi>ÌÊvÊ«ÀÌ>Ê>ÌiÀ>ÃÊ>`Ê Ì iÊVÀ`>ÌÊvÊ>Ê7À`Ê ÃÃÃÊ«ÕLV>ÌðÊ"Ì iÀÊÃiÀÛViÃÊVÕ`iÊ«ÀÛ`}Ê ÃÃÃÊi`ÕV>ÌÊÊV>ÊV ÕÀV iÃ]ÊiVÕÀ>}}ÊÃÃÃÊVÛiÌÃÊ>`Ê«ÀÛ`}Ê >ÃÃÃÌ>ViÊ>`ÊÌÃÊvÀÊ«>}Ê>ÊivviVÌÛiÊÃÃÃÊÃÌÀ>Ìi}ÞÊvÀÊV>ÊV}Ài}>ÌÃ°Ê / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊ«>ÀÌÊvÊÌ ÃÊ>Ài>°Ê x®ÊÊ"Ì iÀÊ7À`Ê ÃÃÃÊ i«>ÀÌiÌÃÊ ÊÊÊ>V>Ê-iÀÛViÃ]Ê ÃÃ>ÀÞÊ-iÀÛViÃ]Ê ÛÃ>ÊVVÕÌ}]Ê+Õ>ÌÞÊÃÃÕÀ>Vi]Ê /iV V>Ê-iÀÛViÃÊ>`Ê7À`Ê*ÀViÃÃ}° În 0!24 7ORLD -ISSIONS -INISTRIES ÃÌÊvÊ ÃÌÀiÃ]Ê Ì>VÌÊ*iÀÃÃÊ>`Ê Ì>VÌÊvÀ>Ì vÀ>ÌÊÊ>ÊÃÌÀiÃÊÃÌi`ÊLiÜÊ >ÃÊLiiÊÃÌ>Ìi`ÊVÀÀiVÌÞÊ>ÃÊÛiÀwi`ÊLÞÊÌ iÊVÌ>VÌÊ «iÀðÊ/ii« iÊÕLiÀÃ]Êv>ÝÊÕLiÀÃ]Êi>Ê>``ÀiÃÃiÃÊ>`ÊVÌ>VÌÊ«iÀÃÃÊ>ÀiÊÃÕLiVÌÊ ÌÊV >}i° >ÃÌÊÕ«`>Ìi`\ÊÊ>Õ>ÀÞÊ£Î]ÊÓääx ,iÃÕÀViÊÃÌ}ÊV«i`ÊLÞÊ iÊ/``]Ê7 Ê >À}Ê iVÌ >}Ê``ÀiÃÃÆÊ ÃÌÀÞÊ >i iÃVÀ«ÌÊvÊ ÃÌÀÞ Ì>VÌÊ*iÀà /ii« iÆÊ>ÝÆÊÊ >ÆÊ7iLÊÃÌi vÀV>Ê>ÀÛiÃÌÊ ÊÃÌÀÞÊvÊvÀV>Ê>ÀÛiÃÌÊ ÃÌÀiðÊÊ Ê/ÕViÀ]Ê £È{äÊ °Ê ÛiÊÛi° ÌiÀViÃÃÀà ʫÀ>ÞiÀÊÃÌÀÞÊÊLi >vÊvÊÌ iÊ ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÎ ii`ÃÊÊÌ iÊvÀV>Êwi`ð {£Ç®ÊnÈÓÓÇn£ÊÝ£ÇÎÓ >ÝÊ{£Ç®ÊnÈÎÈx£n `ÌÕViÀJ> «>V°À} vÀV>Ê>ÀÛiÃÌÊ VÕ`iÃÊvÀV>Ê>ÀÛiÃÌÊÌiÀViÃÃÀÃ]Ê Ê/ÕViÀ]Ê £È{äÊ °Ê ÛiÊÛi° ÃÌÀiÃÊ ® vÀV>Ê ÌiÀ>ÌÕÀiÊ>`Ê i`>ÊÃÃÃÌ>Vi]Ê ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÎ vÀV>Ê/>LiÀ>ViÊ Û>}iÃÊ>`Ê {£Ç®ÊnÈÓÓÇn£ÊÝ£ÇÎÓ vÀV>½ÃÊ `Ài >ÝÊ{£Ç®ÊnÈÎÈx£n `ÌÕViÀJ> «>V°À} vÀV>½ÃÊ«i ÊÃÌÀÞÊ>VVi«Ì}ÊÌ iÊV >i}iÊvÊ i6>iÊ Vii]Ê xnäÊ7iÃÌÊ iÌÀ>Ê-ÌÀiiÌ ÌÀ>}ÊÌ iÊi>`iÀÃÊvÊvÀV>ÊÊvÕÀÊ ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÓ Ü>ÞÃ\ {£Ç®ÊnÈÓÇÇÓx £°Ê-ÌÕ`iÌÊ-V >Àà «Ã ÜÜÜ°>vÀV>à «i°À} Ó°Ê>VÕÌÞÊ-V >Àà «Ã Î°Ê `ÕV>Ì>Ê,iÃÕÀVià {°Ê ÃÕÌ>ÌÃÊÌÊ*>ÀÌiÀ}Ê-V à vÀV>Ê LÀ>ÀÞÊ ÃÌÀLÕÌiÃÊLÃÊÊ }à ]ÊÀiV Ê >ÀÞÊ >ÀÃÊ]Ê xnäÊ7iÃÌÊ iÌÀ>Ê-ÌÀiiÌ -iÀÛViÃÊ"vwViÊ >`Ê-«>à Ê>ÌÊÌ iÊÜiÃÌÊ«ÃÃLiÊ ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÓ VÃÌ]ÊLÀ>ÀÞÊiÝ«iÀÌÃi]ÊÃÕ««iÃÊ {£Ç®ÊnÈÓÇÓ£È -"® >`ÊV>Ì>}}ÊÌÊ LiÊ-V Ã]Ê >ÝÊ{£Ç®ÊnÈÓ£nÇ£ ÃÃ>ÀiÃÊ>`Ê>Ì>ÃÊÊÌ iÊÌÜ -"J>}`°À} Ì À`ÃÊÜÀ`° vÀV>Ê ÌiÀ>ÌÕÀiÊ ÊÃÌÀÞÊvÊvÀV>Ê>ÀÛiÃÌÊ ÃÌÀiðÊÊ Ê/ÕViÀ]Ê £È{äÊ °Ê ÛiÊÛi° >`Ê i`>Ê ÃÌÀÞÊÌÊÌ iÊÌiÀ>ÌÕÀiÊ>`Êi`>Ê À`>ÌÀ -«À}wi`]Ê "ÊÈxnäÎ ii`ÃÊvÊÌ iÊvÀV>Êwi`ÃÊÜÌ ÊÛ`iÃ]Ê {£Ç®ÊnÈÓÓÇn£ÊÝ£ÇÎÓ ÃÃÃÌ>Vi ÌÀ>VÌÃÊ>`Ê-Õ`>ÞÊ-V Ê>ÌiÀ>ð >ÝÊ{£Ç®ÊnÈÎÈx£n `ÌÕViÀJ> «>V°À} vÀV>Ê/>LiÀ>ViÊ ÊÃÌÀÞÊvÊvÀV>Ê>ÀÛiÃÌÊ ÃÌÀiðÊÊ Ê Ài]Ê £È{äÊ °Ê ÛiÊÛiÕi Û>}ià *ÀÛ`iÃÊ>`iµÕ>ÌiÊV ÕÀV ÊLÕ`}ÃÊ À`>ÌÀ -«À}wi`]Ê "ÊÈxnäÎ vÀÊÜÀÌ ÞÊV}Ài}>ÌÃÊ>VÀÃÃÊvÀV>Ê {£Ç®ÊnÈÓÓÇn£ÊÝ£ÇÎÓ Ì ÀÕ} ÊÌ iÊ>VÌÛiÊÛÛiiÌÊvÊ1°-°Ê >ÝÊ{£Ç®ÊnÈÎÈx£n V ÕÀV iÃÊ>`Ê`Û`Õ>ÃÊÊ«ÕÀV >Ã}Ê ÜÜÜ°Ì>LiÀ>ViÃJ> «>V°À} >`ÊVÃÌÀÕVÌ}ÊÌ iÊLÕ`}ð Î vÀV>Ê/ i}V>Ê º"ÕÀÊÃÃÊÃÊÌÊiVÕÀ>}i]Ê Ê6°Ê9À]Ê xnäÊ7iÃÌÊ iÌÀ>Ê-ÌÀiiÌ /À>}Ê-iÀÛViÊ v>VÌ>ÌiÊ>`ÊÛ>`>ÌiÊÌ i}V>Ê ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÎ ÌÀ>}ÊÜÌ ÊÌ iÊ ÕÀV ÊvÊvÀV>]Ê {£Ç®ÊnÈÓÇÓ£È //-® Ì ÕÃÊ>ÃÃÃÌ}ÊvÀV>ÊÌÊ«>ÀÌV«>ÌiÊ >ÝÊ{£Ç®ÊnÈÓ£nÈÇ vÕÞÊÊÌ iÊ>VV«Ã iÌÊvÊÌ iÊ ÜÜÜ°>ÌÌÃJiÌâiÀ°iÌ Ài>ÌÊ Ãð» vÀV>½ÃÊ `Ài ÊÃÌÀÞÊvÊvÀV>Ê>ÀÛiÃÌÊ Ê/ÕViÀ]Ê £È{äÊ °Ê ÛiÊÛiÕi ÃÌÀiðÊÊ*ÀÛ`}Êv`]Êi`Vi]Ê ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÎ VÌ }]ÊÃV Ã]ÊV `ÊiÛ>}iÃÊ {£Ç®ÊnÈÓÓÇn£ÊÝ£ÇÎÓ VÀÕÃ>`iÃ]ÊV `Ài½ÃÊÜÀiÀÃÊÌÀ>}Ê >ÝÊ{£Ç®ÊnÈÎÈx£n Ãi>ÀÃ]Ê -ÊÜ>ÀiiÃÃÊÌÀ>}Ê `ÌÕViÀJ> «>V°À}ÊÀ >`Ê>ÌiÀ>Ã]ÊÛÌ>Ã]ÊÞÕÌ Ê >vÀV>ÃV `ÀiJ> «>V°À} V>«Ã]Ê}Þ>ÃÌVÊiµÕ«iÌÊ>`Ê Ì iÊÃÌÊ}iÃÊ° Ã>Ê*>VwVÊ * ÊÃÊ`i`V>Ìi`ÊÌÊÌ iÊÌ>ÃÊvÊ /ÞÊEÊ >Ê-Û>]Ê *°"°Ê ÝÊÎÓ >«ÕÃÊ >i}iÊ Ài>V }ÊiÛiÀÞÊÃ>Ê*>VwVÊÞÕÌ Ê À`>ÌÀà £xäÓÊÀii à ÜÌ ÊÌ iÊëiÊ`ÕÀ}ÊÌ iÀÊ ]Ê* ««ià * ® >V>`iVÊV>ÀiiÀðÊ* Ê>`ÊÌ iÊ1-Ê ÈÎÓ{ÎxÈäÈÇ >Ì>Ê9ÕÌ Ê i«>ÀÌiÌÊ >ÛiÊ >ÝÊÈÎÓÓx{Î Ìi>i`ÊÌ}iÌ iÀÊÜÌ ÊÃÃ>ÀiÃÊ >«VVJ«>VwV°iÌ°« >`ÊÃ>Ê>Ì>ÃÊÌÊV`ÕVÌÊ ÜÜÜ°{ÞÕÌ >Ã>°V ÃÌiÊÞÕÌ ÊÃÌÀÞÊÌÀ>}Ê VviÀiViÃÊV>i`ʺL9 iÌ»°ÊÊ * Ê>ÃÊV`ÕVÌÃÊÌ iÊÃ>Ê ÃÌÌÕÌiÊvÊ9ÕÌ Ê-ÌÕ`iÃÊ9-®ÊÊ Ì iÊV>«ÕÃÊvÊ*/-Ê>`ÊÌ iÞÊ>ÀiÊÌ iÊ `ÃÌÀLÕÌÀÃÊvÀÊÌ iÊ ÊvÊ«iÊÊ Ã>° Ã>Ê*>VwVÊ Ê`i«>ÀÌiÌÊvÊÃ>Ê*>VwVÊ 7>ÞiÊ >}i]Ê * iÌiÀÊvÀÊÌ iÊ / i}V>Ê-i>ÀÞÊ*/-®ÊÃiÀÛ}Ê ÀiVÌÀ *°"°Ê ÝÊÎÇÇ Ì iÊV ÕÀV iÃÊLÞÊ`iÛi«}Ê>`Ê ÓÈääÊ >}ÕÊ ÌÞ `Û>ViiÌÊ v>VÌ>Ì}Êà ÀÌÌiÀÊ«À}À>ÃÊvÀÊ * ««ià vÊ i>`iÀà «Ê ÌÀ>}ÊÃÃ>ÀiÃÊ>`ÊV ÕÀV Ê ÈÎÇ{®Ê{{ÓÇäÈn >`Ê ÃÃÃÊ i>`iÀðÊÊ*À}À>ÃÊvviÀi`ÊVÕ`iÊÌ iÊ >ÝÊÈÎÇ{®Ê{{ÓÈÎÇn ÃÃ>ÀÞÊ/À>}Ê*À}À>Ê /*®Ê vJ>«Ìði`Õ * ® vÊÌ iÊÃÃiLiÃÊvÊ`ÊÃ>Ê ÃÃÃÊÃÃV>ÌÊ ®]Ê ÜÜÜ°>«Ìði`Õ ÃÌÌÕÌiÊvÊÃ>VÊ-ÌÕ`iÃÊ-®]ÊÃ>Ê *>VwVÊÃÌÌÕÌiÊvÊ Õ`` ÃÌÊ-ÌÕ`iÃÊ * -®]Ê i>`iÀà «Ê iÛi«iÌÊ ÃÌÌÕÌiÊ ®Ê>`ÊÃ>ÊÃÌÌÕÌiÊ vÊ9ÕÌ Ê-ÌÕ`iÃÊ9-ÊvviÀi`Ê ÊV«iÀ>ÌÊÜÌ ÊÃ>Ê*>VwVÊ >«ÕÃÊ >i}i®°ÊÊ Ài`ÌÊÕ«}À>`iÃÊ ÌÊ ÊiÛiÊ>ÀiÊ«ÃÃLiÊÜÌ ÊiÝÌÀ>Ê VÕÀÃiÊÜÀÊ>`Ê«>ÞiÌÊvÊVÕÀÃiÊ viið {ä Ã>Ê*>VwVÊ Ê«À}À>ÊvÊÌ iÊÃ>Ê*>VwVÊ iÌiÀÊ >Ê Ã]Ê */-* - ÃÌÌÕÌiÊvÊ vÀÊÌ iÊ`Û>ViiÌÊvÊ i>`iÀà «Ê ÀiVÌÀ *°"°Ê ÝÊÎÇÇ >`Ê ÃÃÃÊ* ®°ÊÊÊ ÓÈääÊ >}ÕÊ ÌÞ Õ`` ÃÌÊ-ÌÕ`iÃÊ V«Ài iÃÛiÊi} ÌÜiiÊ«À}À>Ê * ««ià * -® Ì >ÌÊ«Ài«>ÀiÃÊ`Û`Õ>ÃÊvÀÊÃÌÀÞÊ ÈÎÇx®Ê{{ÓÓÇÇ ÌÊ Õ`` ÃÌÃÊÊÌ iÀÊÜÊVÕÌÀiÃÊ >ÝÊÈÎÇ{®Ê{{ÓÈÎÇn ÀÊ>ÃÊVÀÃÃVÕÌÕÀ>ÊÃÃ>ÀiðÊÊ LÃJ>«Ìði`Õ ÕÀÃiÃÊ>ÀiÊÌ>Õ} ÌÊLÞÊÕÌÃÌ>`}Ê Õ`` ÃÌÊÃV >ÀÃÊ>`ÊÃÃ>ÀiÃÊ ÜÜÜ°>«Ìði`Õ ÜÌ ÊiÝÌiÃÛiÊiÝ«iÀiViÊÊÃÌÀÞÊ ÌÊ Õ`` ÃÌÃÊÊÛ>ÀÕÃÊ«>ÀÌÃÊvÊ Ì iÊÜÀ`°ÊÊ/ iÊÃÌÌÕÌiÊvviÀÃÊ>Ê ÕµÕiÊ««ÀÌÕÌÞÊÌÊ`ii«iÊÞÕÀÊ Õ`iÀÃÌ>`}Ê>`ÊÛiÊvÀÊ Õ`` ÃÌÊ «i«iÃÊ>`Ê`iÛi«ÊÌ iÊÃÃÊvÀÊ ivviVÌÛiÊÃÌÀÞÊÌÊ Õ`` ÃÌðÊÊ Ài`ÌÊÕ«}À>`iÃÊÌÊÌ iÊ ÊiÛiÊÜÌ Ê Ã>Ê*>VwVÊ/ i}V>Ê-i>ÀÞÊ>ÀiÊ «ÃÃLiÊÜÌ ÊiÝÌÀ>ÊVÕÀÃiÊÜÀÊ>`Ê «>ÞiÌÊvÊVÕÀÃiÊviið Ã>Ê*>VwVÊ Ê«À}À>ÊvÊÌ iÊÃ>Ê*>VwVÊ iÊ >}vÀ`]Ê */-- ÃÌÌÕÌiÊvÊÃ>VÊ iÌiÀÊvÀÊÌ iÊ`Û>ViiÌÊvÊ ÀiVÌÀ *°"°Ê ÝÊÎÇÇ i>`iÀà «Ê>`Ê ÃÃÃÊ* ®Ê ÓÈääÊ >}ÕÊ ÌÞ -ÌÕ`iÃÊ-® vviÀi`ÊÊV«iÀ>ÌÊÜÌ ÊÌ iÊ * ««ià iÌiÀÊvÀÊ ÃÌÀÞÊÌÊ ÕÃðÊÊÊ ÈÎÇ{®Ê{{ÓÓÇÇ V«Ài iÃÛiÊi} ÌÜiiÊ«À}À>Ê >ÝÊ{{ÓÈÎÇn Ì >ÌÊ«Ài«>ÀiÃÊ`Û`Õ>ÃÊvÀÊÃÌÀÞÊ ÃJ>«Ìði`Õ ÌÊ ÕÃÃÊÊÌ iÀÊÜÊVÕÌÀiÃÊ ÀÊ>ÃÊVÀÃÃVÕÌÕÀ>ÊÃÃ>ÀiðÊÊ ÜÜÜ°>«Ìði`Õ ÕÀÃiÃÊ>ÀiÊÌ>Õ} ÌÊLÞÊÕÌÃÌ>`}Ê Ã>VÊÃV >ÀÃÊ>`ÊÃÃ>ÀiÃÊ ÜÌ ÊiÝÌiÃÛiÊiÝ«iÀiViÊÊÃÌÀÞÊ ÌÊ ÕÃÃÊÊÛ>ÀÕÃÊ«>ÀÌÃÊvÊ Ì iÊÜÀ`°ÊÊ/ iÊÃÌÌÕÌiÊvviÀÃÊ>Ê ÕµÕiÊ««ÀÌÕÌÞÊÌÊ`ii«iÊÞÕÀÊ Õ`iÀÃÌ>`}Ê>`ÊÛiÊvÀÊ ÕÃÊ «i«iÃÊ>`Ê`iÛi«ÊÌ iÊÃÃÊvÀÊ ivviVÌÛiÊÃÌÀÞÊÌÊ ÕÃðÊÊ Ài`ÌÊ Õ«}À>`iÃÊÌÊÌ iÊ ÊiÛiÊÜÌ ÊÃ>Ê *>VwVÊ/ i}V>Ê-i>ÀÞÊ>ÀiÊ «ÃÃLiÊÜÌ ÊiÝÌÀ>ÊVÕÀÃiÊÜÀÊ>`Ê «>ÞiÌÊvÊVÕÀÃiÊviið Ã>Ê*>VwVÊ Ê«À}À>ÊvÊÌ iÊÃ>Ê*>VwVÊ iÌiÀÊ 7>ÞiÊ >}i]Ê */- i>`iÀà «Ê vÀÊÌ iÊ`Û>ViiÌÊvÊ i>`iÀà «Ê ÀiVÌÀ *°"°Ê ÝÊÎÇÇ >`Ê ÃÃÃÊ* ®°ÊÊ/ iÊ >}ÕÊ ÌÞ iÛi«iÌÊ ÃÌÌÕÌiÊÃÊ>ÊÌ ÀiivÕÀÊÜiiÊ«À}À>Ê * ««ià ÃÌÌÕÌiÊ ® vÊÌiÃÛiÊÃÌÕ`iÃÊÊLLV>Ê ÈÎÇ{®Ê{{ÓÓÇÇ i>`iÀà «ÊvÀÊ«>ÃÌÀÃ]ÊÃÃ>ÀiÃÊ >ÝÊÈÎÇ{®Ê{{ÓÈÎÇn >`ÊÌ iÀÊV ÕÀV Êi>`iÀðÊÊ Ài`ÌÊ `J>«Ìði`Õ Õ«}À>`iÃÊÌÊÌ iÊ ÊiÛiÊÜÌ ÊÃ>Ê *>VwVÊ/ i}V>Ê-i>ÀÞÊ>ÀiÊ ÜÜÜ°>«Ìði`Õ «ÃÃLiÊÜÌ ÊiÝÌÀ>ÊVÕÀÃiÊÜÀÊ>`Ê «>ÞiÌÊvÊVÕÀÃiÊviið Ã>Ê*>VwVÊ /À>}ÊÃ>Ê*>VwVÊ ÀÃÌ>Ê Ê-`iÀ]Ê ÀiVÌÀ *°"°Ê ÝÊ£ÎnääÊ i`>Ê ÃÌÀiÃÊ i>`iÀÃÊÌÊÕÃiÊ>`Ê«À`ÕViÊi`>Ê "ÀÌ}>ÃÊ iÌiÀ «À`ÕVÌÃÊÌ >ÌÊÜÊÃÌiÀÊÌÊÌ iÀÊ £ÈxäÊ*>Ã} * ® VÕÌÕÀi Ê* ««ià ÈÎÓ£{ÇÈÇÊÀÊ {£Ç®ÊnÈÎÈxäÓ vJ>«i`>°À} ÜÜÜ°>«i`>°À} {£ Ã>Ê*>VwVÊ */-ÊvviÀÃÊ>VVÀi`Ìi`Ê«À}À>ÃÊ Ê >ÀÌiÀ]Ê */- / i}V>Ê i>`}ÊÌÊ}À>`Õ>ÌiÊ>`Ê«ÃÌ *ÀiÃ`iÌÆÊÊ7>ÞiÊ ÝÊÎÇÇ }À>`Õ>ÌiÊ`i}ÀiiÃ]ÊVÕ`}Ê >ÃÌiÀÊ >}i]Ê*ÀiÃ`iÌÊ>ÉÊ ÓÈääÊ >}ÕÊ ÌÞ -i>ÀÞÊ*/-® vÊÀÌÃÊÎÈÊÀÊ{nÊVÀi`Ìî]Ê >ÃÌiÀÊ «ÀÊÓää{ * ««ià vÊ ÛÌÞÊÈÊVÀi`Ìî]Ê >ÃÌiÀÊ ÈÎÇ{{{ÓÓÇÇ vÊ/ i}ÞÊÎÈÊVÀi`ÌîÊ>`Ê >ÝÊÈÎÇ{{{ÓÈÎÇn VÌÀÊvÊ ÃÌÀÞÊÎäÊVÀi`ÌÃ®Ê vJ>«Ìði`Õ ÜÌ ÊVViÌÀ>ÌÃÊÊÃÌÀÞ]Ê Ì i}Þ]ÊÃÃÃÊ>`Ê*iÌiVÃÌ>Ê ÜÜÜ°>«Ìði`Õ ÃÌÕ`iðÊÊ ÝÌiÃÊ«À}À>ÃÊi>`}Ê ÌÊÌ iÊ Ê`i}ÀiiÊ>ÀiÊvviÀi`ÊÊ ÃiÛiÀ>ÊVÕÌÀiÃÊÊÃ>Ê*>VwVÊ>`Ê Ã ÀÌÌiÀÊi>`iÀà «Ê>`ÊÃÃÃÊ ÌÀ>}Ê«À}À>ÃÊ>ÀiÊ«ÀÛ`i`Ê Ì ÀÕ} ÊÌ iÊÃ>Ê*>VwVÊ iÌiÀÊvÀÊ Ì iÊ`Û>ViiÌÊvÊ i>`iÀà «Ê>`Ê ÃÃÃÊ* ®°Ê Ã>½ÃÊ ÌÌiÊ"iÃÊ *ÀÛ`iÃÊii`i`ÊÀiÃÕÀViÃÊ>`Ê >Ì >Ê/ÕÀiÞ]Ê ÎäÊ °ÊivviÀà "® >ÃÃÃÌ>ViÊÌÊV `Ài½ÃÊ iÃ]Ê ÀiVÌÀ -ÕÌiÊÎ{{Ê >`>ÀÊ vii`}Ê«À}À>Ã]ÊÃV ÃÊ>`Ê `}°® i>Ì ÊVVÃÊÊÌ iÊÃ>Ê*>VwVÊ>`Ê -«À}wi`]Ê "ÊÈxnäÈ ÀÌ iÀÊÃ>Ê,i}° {£Ç®ÊnÈÓÈ£xx >ÝÊ{£Ç®ÊnÈÓÈ£{£ vJ>Ã>ÃÌÌiiðÀ} ÜÜÜ°>Ã>ÃÌÌiiðÀ} ÃÃiLiÃÊvÊ`Ê À`>ÌÊvÊÀiëÃiÊÌÊ`Ã>ÃÌiÀÃÊ >VÞÊ>`]Ê £{{xÊ ÛiÊÛiÕi Ã>ÃÌiÀÊ,iivÊ >ÀÕ`ÊÌ iÊÜÀ`]Ê«>ÀÌiÀà «ÊÜÌ Ê >ÃÃÃÌ>Ì -«À}wi`]Ê "ÊÈxnäÓ 7 Ê«iÀÃi]ÊÌ iÊÀi}>ÊvwViÊ {£Ç®ÊnÈÓÓÇn£ÊÝÓänäÊÀÊ ÌÌii vÀÊÌ iÊ>vviVÌi`Ê>Ài>]Ê>`ÊÌ iÊ>Ì>Ê Óää V ÕÀV ]Ê«ÀÛ`}Ê>ÃÃiÃÃiÌ]Ê >ÝÊ{£Ç®ÊnÈÓänÇÈ i`V>ÉÊ>ÌiÀ>Ê>ÃÃÃÌ>ViÊ>`Ê >`J>}°À} ÌÀ>}°ÊÊ7 iÊÊÃiÃÃ]ÊVÌÌiiÊ iLiÀÃÊVÕ`iÊÀi«ÀiÃiÌ>ÌÛiÃÊ vÊ *-Ê Õ`iÀÃ]Êi>Ì >ÀiÊ ÃÌÀiÃ]Ê7À`ÊÃÃiLiÃÊvÊ `Ê,iivÊ}iVÞ]Ê>ÃÊÜiÊ>ÃÊ Ài«ÀiÃiÌ>ÌÛiÃÊvÀÊÌ iÊ>vviVÌi`Ê >Ài>ð ÃÃiLiÃÊvÊ`Ê ÃÃÃÌÃÊÜÌ Ê«ÀiVÌÃÊÀ>Ã}ÊvÕ`ÃÊvÀÊ ,>`ÞÊÕÀÃÌ]Ê £{{xÊ ÛiÊÛiÕi ,iiv V«>ÃÃÊÃÌÀið ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÓ {£Ç®ÊnÈÓÓÇn£ÊÝ£ÇÇx >ÝÊ{£Ç®ÊnΣÓÇä À ÕÀÃÌJ>}°À} ÃÃiLiÃÊvÊ`Ê Ê7À`Ê ÃÃÃÊ >ÃÊ>ÕV i`Ê iÌÌÞÊ/``]Ê £{{xÊ ÛiÊÛiÕi 7À`Ê ÃÃÃÊ *À>ÞiÀ iÌÊÌÊVÕV>ÌiÊ *À>ÞiÀ iÌÊ -«À}wi`]Ê "ÊÈxnäÓ Ì ÀÕ} ÕÌÊÌ iÊÃÃiLiÃÊvÊ`Ê À`>ÌÀ {£Ç®ÊnÈÓÓÇn£ÊÝÓäxÓ *À>ÞiÀ iÌ viÜà «ÊÛ>Êi>ÊÌ iÊ«À>ÞiÀÊ >ÝÊ{£Ç®ÊnÎÓnÇÓÎ ÀiµÕiÃÌÃÊvÊÃÃ>ÀiÃÊVViÀ}Ê ÜÀ`ÃÃëÀ>ÞiÀJiÜð>}°À} Ì iÀÊ«iÀÃ>Ê>`Êv>ÞÊii`ÃÊ>ÃÊ LÌ``J>}°À} ÜiÊ>ÃÊÌ iÊii`ÃÊvÊÌ iÊÜÀÊvÊ ÀÃ̽ÃÊ }`Ê>ÀÕ`ÊÌ iÊÜÀ`°ÊÊ / iÃiÊÀiµÕiÃÌÃÊV>ÊLiÊÃiÌÊÌiÀ>ÞÊ >ÀÕ`ÊÌ iÊÜÀ`ÊÊÃiV`ðÊÊ/ iÀiÊ ÃÊ>Ê>ÀÞÊvÊÌiÀViÃÃÀÃÊ>`ÊÞÕÊ V>ÊLiÊ>Ê«>ÀÌÊvÊÌ i° {Ó LiÊ>Vi /À>Ã>Ì}Ê>`Ê«ÕLà }Ê iÀLÊÀvw]Ê £{ääÊ °Ê >«LiÊÛiÕi ÌiÀ>Ì>Ê>}Õ>}iÊi`ÌÃÊvÊ *ÀiÃ`iÌ -«À}wi`]Ê "ÊÈxnäÓ Ì iʺÀiÊ Li»]ÊÌ iÊ>iÊ}ÛiÊÌÊ nää®ÊxÎÓä{{äÊÀ Ì iʺ viÊÊÌ iÊ-«ÀÌÊ-ÌÕ`ÞÊ Li»Ê {£Ç®ÊnÎÓä{{ä vÀiÀÞʺÕÊ viÊ-ÌÕ`ÞÊ Li»®° >ÝÊ{£Ç®ÊnΣÈ{{x vJLLi>>Vi°À} ÊvÊ«iÊ / iÊ ÊvÊ«iÊÃÊÌ iÊëiÊÌiÝÌÊ LÊÃÃ]Ê Î£££Ê-7Ê£äÌ Ê-ÌÀiiÌ ÌiÀ>Ì> >Àâi`]ÊÌÀ>Ã>Ìi`Ê>`Ê«ÕLà i`Ê ÀiVÌÀÆÊÊ,LÊ *«>Ê i>V ]Ê Ê ÌÊ`vviÀiÌÊ>}Õ>}iÃÊVÕÀÀiÌÞÊÊ ÃÃ]Ê ÝiVÕÌÛiÊ ÎÎäÈ xÓÊ`ÃÌVÌÊ>}Õ>}iîÊ>`Ê`ÃÌÀLÕÌi`Ê ÀiVÌÀ x{®ÊÇxÇÇÇÇ ÜÌ Ê}ÛiÀiÌÊ«iÀÃÃÊÊ vÀÊvÀ>ÌÊ Ì iÊ«ÕLVÊ>`Ê«ÀÛ>ÌiÊÃV ÃÊ>Ê Ã >ÀLiÃÌJLvÊ «i°iÌ ÛiÀÊÌ iÊÜÀ`°ÊÊ"ÛiÀÊÓääÊÊ ÜÜÜ°Lv «i°iÌ V«iÃÊvÊÌ iÊ ÊvÊ«iÊ >ÛiÊ LiiÊ`ÃÌÀLÕÌi`ÊLÞÊ>Ì>ÊV ÕÀV Ê iLiÀÃÊ>`Êà ÀÌÊÌiÀÊÃÃ>ÀiÃÊ ÜÊ>ÃʺvviVÌÊ iÃÌÞÊ/i>û° ÞÃÊ>`ÊÀÃÊ ÊÃÊÌ iÊÃÃÃÊi`ÕV>ÌÊ >Û`Ê Þ`]Ê £{{xÊ ÛiÊÛiÕi ÃÃ>ÀÞÊ i« >ÃÃÊvÀÊV `ÀiÊÊÌ iÊ >Ì>Ê ÀiVÌÀÊ -«À}wi`]Ê "ÊÈxnäÓÊ ÃÃiLiÃÊvÊ`°ÊÊÌÊ«ÀÛ`iÃÊ vÊ `Ài½ÃÊ VÌÕ>ÊV>ÌÊ ÀÕÃ>`iÊ ® ÀiÃÕÀViÃÊÌÊ i«ÊÌi>V Ê`ÃÊ>LÕÌÊ ÃÌÀiÃÉÊ <iÀ>Ê Õ`}® ÃÃðÊÊÌÊ i«ÃÊLÕÞÊÃÌÀÞÊ {£Ç®ÊnÈÓÓÇn£ÊÝ{ää ÃÕ««iÃÊvÀÊÌ iÊÃÃ>ÀiÃÊÌ >ÌÊ >ÝÊ{£Ç®ÊnÈÓÓÈxä Ài>ÌiÊÌÊiÛ>}iÃÊ>`Ê`ÃV«ià «Ê L}VJ>}°À} ÃÕV Ê>ÃÊ«Õ««iÌÃ]ÊÕÃVÊ>`ÊÛ`iÊ Ì>«iÃ]ÊÌÀ>VÌÃ]Ê LiÃ]ÊÌiÀ>ÌÕÀi]ÊÃÕ`Ê ÜÜÜ°L}V°>}°À} ÃÞÃÌiÃ]ÊV«ÕÌiÀÃ]ÊV«ÞÊ>V iÃÊ >`Ê>ÊÜ iÊÌÊÀi° Õ`iÀÃÊ ÊÃÌÀÞÊ`iÃ}i`ÊÌÊ i«ÊÊ >Û`Ê7>}iÀ]Ê *°"°Ê ÝÊ£È ÌiÀ>Ì> >À}iÀÊ«ÀiVÌÃÊ>ÃÊÜiÊ>ÃÊ«ÀiVÌÃÊÊ À`>ÌÀ "â>À]Ê "ÊÈxÇÓ£ `ÃÌÀiÃÃ]ÊÜÌ Ê>Êi« >ÃÃÊÊ LiÊ {£Ç®ÊxnÓäääÎ ÃV ðÊÊ7iÊ>ÀiÊ>ÊVÃÌÀÕVÌÊ {£Ç®ÊxnÓäxä ÃÌÀÞÊÛÛi`ÊÊ>ÃÌiÀÊ LÕ`iÀÃÌJ>}°À} «>}]Êvi>ÃLÌÞÊÃÌÕ`iÃ]ÊvÕ`Ê ÜÜÜ°Ì iLÕ`iÀÃVÕL°À} À>Ã}]Êi}iiÀ}]Ê>ÀV ÌiVÌÕÀ>]Ê VÃÌÀÕVÌ]Ê>ÃÊÜiÊ>ÃÊ i«}ÊÌÊ >VµÕÀiÊii`i`Ê *-ÊÌi>ÃÊÌÊwÃ Ê «ÀiVÌðÊÊ7iÊ>ÀiÊ}Ê«i«iÊÜÌ Ê Ì iÃiÊ}vÌ}ÃÊÌÊÕÃiÊÊii`ÃÊ>ÀÕ`Ê Ì iÊÜÀ`° >«>iÌÊ >Ê iÛi«}ÊÃÌÀiÃÊvÀÊiÊ>`Ê Õ}>ÃÊ >Àà ]Ê £{{xÊ ÛiÊÛiÕi ÕLÀiÊ >«Ê LÞÃÊvÊ >ÌÊiÀV>Ê>`ÊÌ iÊ ,Þ>Ê,>}iÀÃÊ -«À}wi`]Ê "ÊÈxnäÓ >ÀLLi>]ÊÌ ÀÕ} Ê,Þ>Ê,>}iÀÃÊ "ÛiÀÃi>ÃÊ {£Ç®ÊnÈÓÓÇn£ -ÕÌ® >`ÊLÀiÃÊ`iÊÀÊ iÊvÊ À`>ÌÀ >ÝÊ{£Ç®ÊnΣnÓÎä ÀÊi½ÃÊÃÌÀiðÊÊ1Ìâ}Ê `Õ}°>Àà JÊ>}`°À} >Ênä>VÀiÊÌiÀ>Ì>ÊÌÀ>}Ê ÜÜÜ°`Õ}>Àà °À} >`Ê`ÃV«ià «ÊViÌiÀÊV>Ìi`ÊÊ Ì iÊÌÀ«VÃÊvÊ ÃÌ>Ê,V>]Ê iÌÀ>Ê iÀV>° >ÀLLi>Ê-V Ê -/ÊÃÊ>ÊLiÊÃi>ÀÞÊÜ V Ê iÜÃÊ VÊ Ü]Ê *°"°Ê ÝÊ£ÈÎ{ vÊ/ i}ÞÊ -/® vviÀÃÊ>Ê>`Û>Vi`ÊiÛiÊvÊÃÌÕ`iÃÊ *ÀiÃ`iÌ -«À}wi`]Ê "ÊÈxnän vÀÊ ÀÃÌ>Êi>`iÀÃ]Ê«>ÃÌÀÃ]Ê LiÊ {£Ç®ÊnÈÓxÎÎÊÝÓxÓx ÃV ÊÌi>V iÀÃÊ>`Ê>`ÃÌÀ>ÌÀðÊÊ >ÝÊ{£Ç®ÊnÈ{ÎnÓ -/ÊvÜÃÊÕ«ÊÌ iÊ`«>Ê«À}À>Ê iÜð V ÜJ>}`°À} vÊ>Ì>Ê LiÊÃV ÃÊÜÌ Ê °°Ê >`Ê °°Ê`i}ÀiiÃÊLÞÊÌ iÊi>ÃÊvÊ >Õ>Ê>`ÊL>Õ>ÊÃÌiÊÃi>Àð {Î >À} iVÌ ÃÌiÀ}ÊÌÊÌ iÊÃÃ>ÀÞÊv>ÞÊ >ÞiÊ/`Üi]ÊÊ xÓ£Ê7°Ê ÞÊ-ÌÀiiÌ Ì ÀÕ} Ê«À>VÌV>Ê i«ÃÊÊÌ iÊ>Ài>ÃÊ /i>Ê i>`iÀ -«À}wi`]Ê "ÊÈxnäÓ vÊ i>Ì ÊÃÃÕiÃ]Êv>ÞÊÃÃÕiÃ]Êi½ÃÊ {£Ç®ÊnÈÎÇÇ£Ç >`ÊÜi½ÃÊÃÃÕiÃ]ÊV `Ài½ÃÊ >ÝÊ{£Ç®ÊnÈΣ{ÇÇ Ã«iV>Êi`ÕV>ÌÊii`Ã]Ê«iÀÃ>Ê>`Ê vÌ`ÜiJ>}°À} VÀÃÃÊVViÀÃ]ÊÃÌÀÞÊÌÊ7 Ê ÜiLÊÃÌi\ÊÃÃ>ÀÞÊ ÀiÌÀiiÃ]ÊÊ*À>ÞiÀ iÌ]Ê/ÕiÃ`>ÞÊ «>ÃÃÜÀ`Ê«ÀÌiVÌi`Ê 7 Ê*À>ÞiÀ]Ê,iiÌÀÞÊvÀÊÛiÌiÀ>Ê ÃÃ>ÀiÃ]Ê >À} iVÌÊÜiLÊ VÌ>VÌÊ>ÞiÊ/`ÜiÊvÀÊ ÃÌi]Ê>`ÊÌ iÀÊ>Ài>ÃÊ>ÃÊii`i`° vÕÀÌ iÀÊvÀ>Ì° >À} iVÌÊ / iÊÃÃÊvÊ -ÊÃÊÌÊÃÌiÀÊ À°Ê7>ÊÀ> >]ÊÊ - i`V>Ê-iÀÛViÊ V«>ÃÃ>ÌiÞÊÌÊÌ iÊ« ÞÃV>]Ê i`V>Ê ÀiVÌÀ ÌÌ\Ê iLLiÊ VÜ` iÌ>Ê>`ÊëÀÌÕ>Êii`ÃÊvÊÌ iÊ xÓ£Ê7°Ê ÞÊ-ÌÀiiÌ -® 7 ÊÃÃ>ÀiÃÊÃÊÌ >ÌÊÌ iÞÊ -«À}wi`]Ê "ÊÈxnäÓ >ÞÊÀiÊivviVÌÛiÞÊvÕwÊ`½ÃÊ {£Ç®ÊnÈÈÈΣ£ ÛÃÊvÀÊÌ iÀÊÃÌÀÞ°ÊÊ7iÊÃiiÊ iÀ}iVÞÊViÊ{£Ç®Ê ÌÊiÃÌ>Là Ê>`Ê>Ì>ʵÕ>ÌÞÊ n{n{{Èx i`V>ÊÛiÀÃ} ÌÊvÀÊÌ iÊiLiÀÃÊ vÊÌ iÊ7 ÊÃÃ>ÀÞÊv>ÞÊLÞÊ >ÝÊ{£Ç®ÊnÈÈ{Ç££ «ÀÛ`}ÊVÃÕÌ>ÌÛi]Êi`ÕV>Ì>Ê `ÀÃ}À> >J>°V >`Ê«ÀiÛiÌ>ÌÛiÊÃiÀÛViÃÊÌÊi>V Ê `Û`Õ>° iÌiÀÊvÀÊ ÃÌÀÞÊ º ÊÃÊ>Êv>VÌ>Ì}ÊÃÌÀÞÊ Ê iiÌÌ]Ê ÓäÎÓÊ >ÃÌÊ i>ÀiÞ]ÊÊ ÌÊ ÕÃÃÊ ÌÊ>ÃÃÃÌÊÌ iÊV ÕÀV ÊÜÀ`Ü`iÊÊ ÀiVÌÀ -ÕÌiÊÓäx «ÀÛ`}Ê>Ê>`iµÕ>ÌiÊ>`ÊVÕÌÕÀ>ÞÊ -«À}wi`]Ê "ÊÈxnäÎ ® ÃiÃÌÛiÊÜÌiÃÃÊvÊiÃÕÃÊ ÀÃÌÊ {£Ç®ÊnÈÈÎΣΠÌÊiÛiÀÞÊ ÕÃÊLÞÊiÛiÀÞÊi>ÃÊ >ÝÊ{£Ç®ÊnÈÈÎÇÎÎ «ÃÃLi\ÊÌiÀViÃÃ]ÊÜ>ÀiiÃÃÊ ÇÈÓ{ΰÓÇÈÓJV«ÕÃiÀÛi°V -i>ÀÃ]ÊÃÌÌÕÌiÃÊvÊÃ>VÊ ÜÜÜ°ViµÕ«°À} -ÌÕ`iÃ]Ê,iÃi>ÀV Ê>`Ê-ÌÀ>Ìi}ÞÊ ÃÕÌ>Ì]Ê,iÃÕÀViÊ>`Ê i`>Ê iÛi«iÌ]Ê Lâ>Ì]Ê>`Ê ÌiÀ,i}>Ê iÌÜÀ}°» `Ài½ÃÊ ÊVÃÃÊvÊÃÃ>ÀiÃÊÜ Ê -ÌiÛiÊ iÌi`]Ê ÎnäÊ °ÊÜÞ°Ê ÃÌÀiÃÊ ÜÀÊ«À>ÀÞÊÜÌ ÊV `Ài°ÊÊ >À> -ÕÌiÊ £ä{ , ÊiÌÜÀÃÊÃÃ>ÀiÃÊ>Ê Ý>]Ê "ÊÈxÇ£{ ,iÃÕÀViÊ ÛiÀÊÌ iÊÜÀ`ÊvÀÊÌ iÊ«ÕÀ«ÃiÊ {£Ç®ÊÇÓ{£ÓÓÓ ÃÃÊ vÊà >À}ÊÀiÃÕÀViÃÊ>`Ê`i>ðÊÊ >ÝÊ{£Ç®ÊÇÓ{䣣 , ® >V ÊÀi}ÊÃÊÀi«ÀiÃiÌi`ÊÊÌ iÊ iJµÌiÀ>Ì>°V `ÃÌÀ>ÌÛiÊ ÌÌii]ÊÜ V Ê 7iLÊÃÌiÊ>``ÀiÃÃÊÌÊLiÊ ÃÊ>ÃÊÛÛi`ÊÊÌ iÊ`iÃ}Ê>`Ê `iÌiÀi`® ÃÌ}ÊvÊÌ iÊ , ÊÜiLÊÃÌi° ÌiÌ>Ê /-ÊvviÀÃÊÌ i}V>ÊÌÀ>}ÊÊ ,>`Ê+°Ê Õ`iÞ]Ê >ÃÌiiÃÌÀ>>ÌÊ{n / i}V>Ê >ÊÌiÀ>Ì>ÊÃiÌÌ}ÊÀiÃÕÌ}Ê\Ê *ÀiÃ`iÌ £ÈääÊ-Ì*iÌiÀà iiÕÜ >ÃÌiÀÊvÊÀÌÃÊÊ LV>Ê-ÌÕ`iÃ]Ê 1 -i>ÀÞ >V iÀÊvÊÀÌÃÊÀÊ «>ÊÊ LiÊ ÎÓÊäÓ®ÊnÎ{nxxx >`Ê/ i}ÞÊÀÊ>Ê iÀÌwV>ÌiÊÊ LiÊ >ÝÊÎÓÊäÓ®ÊÎÎ{nxx >`Ê ÕÀV Ê ÕÃV° vJVÌÃi°i`Õ ÜÜÜ°VÌÃi°i`Õ ÛÞÊvÊ«iÊ "ÊÃiÀÛiÃÊÊÌ iÊ1Ìi`Ê-Ì>ÌiÃÊ>`Ê >Ê >`Ã]Ê ÎÎäÊ-°Ê*>ÌÌiÀÃÊÛiÕi "® >ÀÕ`ÊÌ iÊÜÀ`Ê«ÀÛ`}Ê`Ã>ÃÌiÀÊ ÝiVÕÌÛiÊ ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÓ Àiiv]ÊLÕ`}ÊÃÕ««ÞÊiÃÊ>`Ê {£Ç®ÊnÓÎnn ëÃÀ}ÊÕÌÀi>V iÃÊÌÊÌ iÊ«ÀÊ >ÝÊ{£Ç®ÊnÓÎnÓ{{ >`Ê ÕÀÌ}ÊÊVÕÌiÃ°Ê ÕÀ}Ê vJVÛÞv «i°À} >Ê "Ê"ÕÌÀi>V ]ÊvÀiiÊ}ÀViÀiÃÊ>ÀiÊ ÜÜÜ°VÛÞv «i°À} `ÃÌÀLÕÌi`]ÊLÊ1-®Ê>`Ê i>Ì Ê v>ÀÃÊ>ÀiÊÀ}>âi`Ê>`Ê>VÌÛÌiÃÊvÀÊ V `ÀiÊ>ÀiÊ«ÀÛ`i`° {{ ÀÞÊvÀV> º Ài>Ìi`ÊÌÊ«>ÀÌiÀÊÜÌ ÊÌ iÊ À>`Ê/ÕViÀ]Ê £ÈÓÈÊ °Ê ÛiÊÛi° 7 ÊvÀV>ÊÃÃ>ÀÞÊv>ÞÊ `ÃÌÀ>ÌÀ -«À}wi`]Ê "ÊÈxnäÓ >`ÊvÀV>½ÃÊ>Ì>ÊV ÕÀV iÃÊ {£Ç®ÊnÎÓäxä ÌÊÀiÊ>}}ÀiÃÃÛiÞÊ>``ÀiÃÃÊÌ iÊ >ÝÊ{£Ç®ÊnÈÓä£Çx 6É -ÊVÀÃÃÊ>`ÊÌÃÊÕÌ VÀÞ>vÀV>J«ViÌV°V v>ViÌi`ÊÀ>wV>ÌÃÊÌ ÀÕ} ÕÌÊ Ì iÊVÌiÌ°Ê"ÕÀÊÃiÀÛViÃÊVÕ`iÊ «ÀviÃÃ>ÊVÃÕÌ}]ÊiÌÜÀ}]Ê ÌiÀ>Ì>ÊÃÌÀÞÊ>Ã]Ê «ÀiVÌÊvÕ`}]Ê>`Ê>Ü>ÀiiÃÃÊ >`Ê«ÀÌÊ>}ÃÌÊÕÀÊ1°-°Ê VÃÌÌÕiVÞ°» ÕÀ>Ã>½ÃÊÕÌÕÀi º ÃÌÀÞÊÌÊV `ÀiÊÊ ÕÀ>Ã>°ÊÌÊ ÕViÊ*>ÀÃ]Ê"vwViÊ £È{äÊ °Ê ÛiÊÛi° «ÀiÃiÌ]ÊÜiÊ>ÀiÊ>ÞÊÀ>Ã}ÊvÕ`ÃÊ >>}iÀ -«À}wi`]Ê "ÊÈxnäÎ ÌÊ i«ÊÜÌ ÊÌ iÊ>ÞÊ«ÀiVÌÃÊÊÌ iÊ {£Ç®ÊnÈÓÓÇn£ÊÝ£Ç{ä ÕÀ>Ã>Êwi`° >ÝÊ{£Ç®ÊnÈÓ{ÇÈ ÕÀ>Ã>J>}`°À} ÀÌiÊ º ÊiÝÃÌÃÊÌÊvÃÌiÀÊivviVÌÛiÊ Ê*>i]Ê ÀiVÌÀ £Ó££Ê-°ÊiÃÌiÊÛi° ÃÌÀiÃÊ ® V ÕÀV «>Ì}ÊÊÌ iÊvÀÌÊiÃÊ -ÕÌiÊ ä vÊÌ iÊ }`½ÃÊ>`Û>Vi°ÊÊ Ê -«À}wi`]Ê "ÊÈxnä{ ÀiVÀÕÌÃÊÊÌÀ>Ã]Ê>`Êi>`ÃÊà ÀÌÌiÀÊ {£Ç®ÊnnÓäÇän ÃÌÀÞÊÌi>ÃÊvÀÊÌ iÊ1°-°ÊÌÊ >ÝÊ{£Ç®ÊnnÓäÈx£ >ÃÃÃÌÊÊÌ iÀÊV ÕÀV «>Ì}ÊivvÀÌÃÊ yJvÀÌi°>}°À} Ì ÀÕ} ÊV«>ÃÃ>ÌiÊÃÌÀiÃ]Ê ÜÜÜ°vÀÌi°>}°À} iÛ>}iÃ]ÊVÃÌÀÕVÌ]ÊÌÀ>}]Ê >`ÊÌ iÀÊÌÞ«iÃÊvÊÃÌÀÞ°» L>Ê ÀÃÌ>Ê ÊÃÊÌ iÊiÝVÕÃÛiÊ`ÃÌÀLÕÌÀÊ {x L>Ê1ÛiÀÃÌÞÊ / ÀÕ} ÊÌÃÊÜÀ`Ü`iÊiÌÜÀÊ ,>`ÊÜ>Ã]Ê £Ó££Ê-°ÊiÃÌiÊÛi° iÀi>É vÊvwViÃÊ>`ÊÃÌÌÕÌÃ]ÊL>Ê *ÀiÃ`iÌ -«À}wi`]Ê "ÊÈxnä{ 1ÛiÀÃÌÞÊ«ÀÛ`iÃÊÌ iÊÜÀ`Ü`iÊ nää®Ê{{ΣänÎÊÀ *iÌiVÃÌ>ÊV ÕÀV ÊÜÌ Ê>ÊÃi>iÃÃÊ {£Ç®ÊnÈÓxÎÎ ÃÞÃÌiÊÌ >ÌÊi>LiÃÊ>Þi]Ê vJ}L>ÕÛiÀÃÌÞ°i`Õ >ÞÜ iÀi]Ê>ÌÊ>ÞÊÌi]Ê>VViÃÃÊÌÊ ÜÜÜ°}L>ÕÛiÀÃÌÞ°i`Õ iÛ>}iÃ]Ê`ÃV«ià «]ÊÃÌiÀ>Ê ÌÀ>}]Ê>`Ê>V>`iVÊ«À}À>ÃÊ i>`}ÊÌÊL>VV>>ÕÀi>ÌiÊ>`Ê>ÃÌiÀÃÊ iÛiÊ`i}Àiið i>Ì >ÀiÊ º7À`Ü`iÊ i`V>Ê ÃÃÃÊ>ÀÊ V >iÊ"½ Ài]Ê xÓ£Ê7°Ê ÞÊ-ÌÀiiÌ ÃÌÀiÃÊ ® vÊ7 ÊÜÀ}Ê`ÀiVÌÞÊÌ ÀÕ} Ê Ê ÃÃ>ÀÞ -«À}wi`]Ê "ÊÈxnäÓ Ì iÊi`Ê ÃÃ>ÀÞÊ>`ÉÀÊ >Ì>Ê {£Ç®ÊnÈÈÈΣ£ ÕÀV ÊV`ÕVÌ}Êà ÀÌÊÌiÀÊ >ÝÊ{£Ç®ÊnÈÈ{Ç££ ÃÃÃÊÌÀ«Ã]ÊiiÀ}iVÞÊÀiëÃiÊ LÀiJ V`v°À} Ìi>Ã]ÊL>Ê`Ê*>ÀÌiÀà «]Ê ÜÜÜ° i>Ì V>ÀiÃÌÀiðÀ} i>Ì Êi`ÕV>ÌÊ>`Ê`iÛi«iÌÊ Ãi>ÀÃÊ>`ÊÜÀÊÜÌ Ê«iÀÃÃÊÜÌ Ê `Ã>LÌið» iÀ>Ê*>LÊ *À`ÕViÀÃÊ>`Ê`ÃÌÀLÕÌÀÃÊvÊ-«>Ã Ê >ÀiÃÊ,>ÞÊ *°"°Ê ÝÊ£äää ÃÌÀià ÌiiÛÃÊ>`ÊÀ>`ÊiÛ>}iÃÌVÊ -ÌiÜ>ÀÌÊ >ÀÃÊ ÃÌ>Ê iÃ>]Ê ÊÓÈÓn «À}À>ÃÊ{ÊÕÌiÃÊi>V ®°Ê*À}À>ÃÊ ,iÞ®]ÊÃÃ>ÀÞÊ {®ÊÈ{xäÈÇÈ >ÀiÊ>Û>>LiÊvÀiiÊÌÊ>ÞÊÃÃ>ÀÞÊ]Ê VÌ>VÌ >ÝÊ{®ÊÈ{xäÎÇ{ vÊvÀÊÕÃiÊÊÊ>ÀÊLÀ>`V>ÃÌ}° «JLÝ£ää°À} ÜÜÜ°LÝ£ää°À} ÌiÀ>Ì>Ê / iÀÊÃÃÊÃʺÌÊiÃÌ>Là Ê>Ê}L>Ê Ê iÀÀi]Ê i`>Ê ÃÌÀiÃÊ ÜÌiÃÃÊvÊiÃÕÃÊ ÀÃÌÊÌ ÀÕ} Ê ÀiVÌÀ * "ÊÓää£ i`>°ÊÀÊÌ iÊ«>ÃÌÊ£ÇÊÞi>ÀÃÊ Ê Ónnä£ÊV>>Ê`iÊi>ÀiÃ6>L> ® >ÃÊ«>ÀÌiÀi`ÊÜÌ ÊV ÕÀV ÊÊiÛiÀÞÊ >`À`]Ê-«> VÌiÌÊÌÊÕÃiÊi`>ÊÌÊÜÊÌ iÊÃÌÊ J°i`Õ >`ÊÌÀ>ÊÌ iÊvÕ`°» ÜÜÜ°°i`Õ }½ÃÊ >ÃÌiÊ Õ`i`ÊÊ£n]ÊÌÊÀ>ÃiÊÕ«Ê>Ê>ÀÞÊ Ê/À«iÌÌ]Ê ÕLÊ6*ÊÎÈ ÃÌÀiÃÊ >ÃÌÊ vÊÞÕ}]ÊëÀÌwi`ÊÜ>ÀÀÀÃÊÜ Ê ÀiVÌÀ *°"°Ê ÝÊxÓxÎÈÓ ÜÕ`ÊÛ>`iÊ >ÌÊiÀV>ÊÜÌ ÊÌ iÊ >]Ê ÊÎΣxÓ `iÊ,iÞ® ëiÊiÃÃ>}iÊÌ >ÌʺiÃÕÃÊÃ>ÛiÃÊ>`Ê * i\Ê䣣xäÎÓn{Îxx{Ê ÃÊV}Êû°Ê/`>ÞÊÌ >ÌÊÛÃÊ ÀÊ䣣xäÎÓÈÎÎÈä{ >ÃÊiÝ«>`i`ÊÌÊ`âiÃÊvÊVÕÌÀiÃÊ ÌÀ«iÌÌJ}ÃV>ÃÌi°À} Ì ÀÕ} ÕÌÊÌ iÊÜÀ`° ÜÜÜ°}ÃV>ÃÌi°À} >ÌÊiÀV>Ê -/ÊvviÀÃÊ>ÊÃÌiÀ>ÊÃÌÕ`ÞÊ Ê }Ã]Ê ÓxÎxÊ °Ê{äÌ ÊÛiÕi `Û>Vi`Ê-V Ê «À}À>ÊÀiÃÕÌ}ÊÊÌ iÊiµÕÛ>iÌÊ ÀiVÌÀ ÞÜ`]Ê ÊÎÎäÓ£ vÊ>Ê >V iÀÊvÊÀÌÃÊ i}ÀiiÊ x{®ÊÈÓÈÎ vÊ/ i}ÞÊ ViV>ÌÕÀ>®ÊÊÌ iÊ-«>Ã Ê >ÝÊx{®ÊÈ£Ó{£n -/®ÆÊÃÌÌÕÌÊ >}Õ>}iÊvÀÊ>Ì>Êi>`iÀÃ]Ê wV>ÃÕJ>°V `iÊ-Õ«iÀ>VÊ «>ÃÌÀÃ]ÊÃÃ>ÀiÃ]Ê LiÊÃV Ê ÜÜÜ°-1 °À} `ÀiVÌÀÃÊ>`Ê«ÀviÃÃÀðÊÊ >ÃÃiÃÊ>ÀiÊ ÃÌiÀ>Ê-1 ® Ì>Õ} ÌÊÊV>ÌÃÊ>VViÃÃLiÊÌÊÌ iÊ ÃÌÕ`iÌÃÊÊ >ÌÊiÀV>Ê>`ÊÌ iÊ >ÀLLi>° >ÌÊiÀV>Ê / ÃÊÃÌÀÞÊÃiÀÛiÃÊÌ iÊÀiÊÌ >Ê ,`Ê Þ`]Ê ÀiVÌÀÆÊ «>ÀÌ>`Ê££x LiÊ-V Ê £]äääÊ LiÊÃV ÃÊÊ-«>à >ÀÀÞÊ>`Ê ÀÌ ÞÊ *>>>ʧ ëi>}Ê >ÌÊiÀV>Ê>`ÊÌ iÊ i`iÀL]Ê * `ÛÃÀÞÊ iÌiÀ >ÀLLi>ÊÌ ÀÕ} ÊÌiÀ>Ì>Ê>`Ê `ÛÃÀà ³xäÇÊÓÈ£ÎΣ >Ì>ÊVviÀiViÃ]ÊVÃÕÌ}Ê>`Ê >ÝʳxäÇÊÓÈÓ{äx ÌiÀiÌÊÀiÃÕÀVið ,J-iÀÛV °iÌ ÜÜÜ° Þ`ðÀ}É iÌÀ {È >ÌÊiÀV>Ê / iÊÃÃÊvÊ >ÌÊiÀV>Ê iÊ > >}iÀ]Ê-ÌiÛiÊ £Ó££Ê-°ÊiÃÌiÊÛi° ` >ÀiÊ ® ` >ÀiÊÃÊÌÊÌÀ>ÃvÀÊÌ iÊÛiÃÊvÊ ÃÕ«]Ê ÀiVÌÀà -ÕÌiÊxä£ V `ÀiÊÊii`ÊÜÌ ÊÌ iÊ`Ê iÜÃÊ -«À}wi`]Ê "ÊÈxnä{ vÊiÃÕÃÊ ÀÃÌÊÌ ÀÕ} Êi`ÕV>ÌÊ nää®ÊÓnÇäÇ£ÊÀÊ >`ÊÌ iÀÊÃÌÀiÃÊvÊV«>ÃðÊÊ {£Ç®ÊnÈÓnxää -«ÃÀÃÊ i«Ê Ê«ÀÛ`iÊvÀÊ >ÝÊ{£Ç®ÊnÈÓÎÎä£ nä]äääÊV `ÀiÊÊÎääÊÃV ÃÊÊÓäÊ vwViJ>VV{ «i°À} VÕÌÀiÃÊvÊ >ÌÊiÀV>Ê>`ÊÌ iÊ >ÀLLi>° ÜÜÜ°>VV{ «i°À} >ÌÊiÀV>Ê º- ÊVÀ`>ÌiÃÊÃÃiLiÃÊvÊ ,ÞÊ-iÞ>]Ê ÓxäÇÊ-°Ê-Õ«Ài>ÊÛi° ÀÃÌ>Ê `ÊÃÌiÀ>ÊÌÀ>}ÊvÀÊÌ iÊ ÌiÀ>Ì>Ê -«À}wi`]Ê "ÊÈxnäÇ ÓäÊ-«>à Êëi>}ÊVÕÌÀiÃÊvÊ À`>ÌÀ {£Ç®ÊnÈÓxÎÎÊÀÊ `ÕV>ÌÊ-iÀÛViÆÊ -ÕÌ Ê>`Ê iÌÀ>ÊiÀV>]Ê ÕL>Ê nää®Ê{{ΣänÎ Ê-iÀÛVÊ >`ÊÌ iÊ V>Ê,i«ÕLV°ÊÊ-iVÊ >ÝÊ{£Ç®ÊnÈxÈÎÇn `iÊ `ÕV>VÊ ÃÕ«iÀÛÃiÃÊÌ iÊ >ÌÊiÀV>Ê ÀÞ°ÃiÞ>J>}`°À} / i}V>Ê-i>ÀÞÊ /-®Ê>`Ê ÜÜÜ°ÃiÀÛV>`°À} ÀÃÌ>>Ê- ® Ì iÊ >ÌÊiÀV>Ê`Û>Vi`Ê-V Ê vÊ/ i}ÞÊ -/®]Ê«ÕÃÊÛiÀÊ £äääÊ LiÊÃÌÌÕÌiÃ]ÊÌ iÊ/ i}V>Ê ÃÃV>ÌÊvÊ >ÌÊiÀV>Ê / ®]Ê >ÌÊiÀV>Ê LÀ>ÀÞÊ -iÀÛViÃÊ -®Ê>`Ê " "< ]ÊÌ iÊ i`ÕV>Ì>Ê>}>âiÊÜ V Ê}iÃÊÌÊ £ä]äääÊ >ÌÊiÀV>ÊÉÊÃÌiÀðÊÊ / iÊÃÌÊiÝVÌ}ÊÃÌÀÞÊvÊ- ÊÃÊ ÌÀ>}ÊÃVÀiÃÊvÊ >ÌÊiÀV>ÃÊ Ü Ê>ÀiÊÜÊÀÊÜÊLiÊÃÃ>ÀiÃÊ >ÀÕ`ÊÌ iÊÜÀ`]Ê>ÞÊÌÊÃiÃÌÛiÊ VÕÌÀiÃÊÜ iÀiÊ1°-°ÊÃÃ>ÀiÃÊ>ÀiÊ ÕÜiVi°» >ÌÊiÀV>Ê -ÊÀ`iÀÃÊLÃ]Ê«ÀViÃÃiÃÊÌ iÊ ÛiÀiÌÌÊ7>À`]Ê £ÇÓÓÊ-°ÊiÃÌiÊÛi° LÀ>ÀÞÊ-iÀÛViÃÊ >`Ê«Ài«>ÀiÃÊÌ iÊÊLÀ>ÀÞÊvÀÊ ÀiVÌÀ -ÕÌiÊ7££ÓÊiÃÌiÊ vÀÊ`iÛiÀÞÊÌÊ LiÊVi}iÃÊÊ >ÌÊ -µÕ>Ài® -® iÀV>Ê>`ÊÌ iÊ >ÀLLi>°ÊÊ/ iÞÊ -«À}wi`]Ê "ÊÈxnä{ vviÀÊÃiÛiÊÌÞ«iÃÊvÊLÀ>Àið {£Ç®ÊnnÈÈx£ >ÝÊ{£Ç®ÊnnÈÇ{Èä >ÃJLLÃiÀÛ°À} ÜÜÜ°LLÃiÀÛ°À} >ÌÊiÀV>Ê , Ê«ÀÛ`iÃÊ ÀÃÌ>Ê>ÌiÀ>ÃÊ >Ì ÞÊ}}]Ê £ÇÓÓÊ-°ÊiÃÌiÊÛi° >`Ê >ÀLLi>Ê Ê-«>à Ê>`Ê }à ÊvÀÊV `Ài]Ê ÀiVÌÀ -ÕÌiÊ7£ÈÎÊiÃÌiÊ ÞÕÌ ]Êi]ÊÜiÊ>`Ê«>ÃÌÀðÊÊ -µÕ>Ài® ,iÃÕÀViÊ>`Ê / iÊ>ÌiÀ>ÃÊ>ÀiÊÊ>Õ`]ÊÛÃÕ>Ê>`Ê -«À}wi`]Ê "ÊÈxnä{ iÛi«iÌÊ ÜÀÌÌiÊvÀð {£Ç®Ênn£{Èn ÃÌÀÞÊ >Ý{£Ç®Ênn££äÎÇ , ® , ÌJÀ`Ì°À} ÜÜÜ°, Ì°À} >ÌÊiÀV>Ê *ÀÛ`iÃÊ>VVÀi`Ì>ÌÊvÊ LiÊ £ÇÓÓÊ-°ÊiÃÌiÊÛi° / i}V>Ê ÃV ÃÊ>`Ê}À>`Õ>ÌiÊÃÌÌÕÌÃ]Ê -ÕÌiÊ7£äÈ ViÀÌwV>ÌÊvÊ«ÀviÃÃÀÃ]Ê>`ÊÃiÀÛiÃÊ -«À}wi`]Ê "ÊÈxnä{ ÃÃV>ÌÊ ÌÊ«ÀiÃiÀÛiÊÃÕ`Ê`VÌÀiÊÊÌ iÊ {£Ç®ÊnnnÓÈä / ® ÃV ð / ÓääÎJðV {Ç >ÌÊiÀV>Ê º 1 / ÊvviÀÃÊÌ iÊÞÊ >ÀÀÞÊ V i]Ê £Ó££Ê-°ÊiÃÌi]ÊÊ / i}V>Ê }À>`Õ>ÌiÊÌ i}V>Êi`ÕV>ÌÊ ÀiVÌÀ -ÕÌiÊxäÎ «À}À>ÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÊ -«À}wi`]Ê "ÊÈxnä{ -i>ÀÞÊ>VÕÌ>`Ê >ÌÊiÀV>Êi>`}ÊÌÊ>Ê >ÃÌiÀ½ÃÊ {£Ç®ÊnnÈnxx `iÊ/i}>Ê`iÊ i}ÀiiÊÌ>Õ} ÌÊiÌÀiÞÊÊ-«>à °ÊÊ >ÝÊ{£Ç®ÊnnÈÈ£Óx >ÃÊÃ>Li>ÃÊ`iÊ ÕÀÃiÃÊ>ÀiÊÌ>Õ} ÌÊ>ÌÊiÝÌiÃÊÃÌiÃÊ >ÌÃJv>VÕÌ>`>`°À} V>Ìi`ÊÌ ÀÕ} ÕÌÊ >ÌÊiÀV>Ê ÜÜÜ°v>VÕÌ>`>`°À} î >`ÊÌ iÊ >ÀLLi>°ÊÊ/ iÊÃÌÕ`iÌÊ L`ÞÊvÊ>ÃÌÊ{ääÊVÕ`iÃÊ >Ì>Ê }iiÀ>ÊÃÕ«iÀÌi`iÌÃÊ>`ÊÌ iÀÊ iÝiVÕÌÛiÊi>`iÀÃ]Ê«>ÃÌÀÃ]Ê LiÊ ÃÌÌÕÌiÊ«ÀviÃÃÀÃ]ÊiÛ>}iÃÌÃÊ>`Ê ÃÃ>Àið» viÊ*ÕLà iÀÃÊ º viÊÃiÀÛiÃÊ>ÃÊÌ iÊvÀi}Ê>}Õ>}iÊ iÀLÊÀvw]Ê £{ääÊ °Ê >«LiÊÛi° ÌiÀ>Ì> «ÕLà iÀÊvÊÌ iÊ7 ]Ê>ÃÃÃÌ}Ê *ÀiÃ`iÌ -«À}wi`]Ê "ÊÈxnäÓ ÃÃ>ÀiÃÊ>`Ê>Ì>ÊV ÕÀV iÃÊ nnn®ÊÇÇÈÓ{ÓxÊÀÊ ÜÌ Ê«ÕLà }Êii`ÃÊÊ>ÊVÕÌÀiÃÊ {£Ç®ÊnΣÇÇÈÈ >`Ê>}Õ>}ið»ÊÊ >ÌiÀ>ÃÊÊ >ÝÊ{£Ç®ÊnΣÈ{{x Û>ÀÕÃÊ>}Õ>}iÃÊVÕ`i\Ê,>`>ÌÊ viJÝV°À} viÊVÕÀÀVÕÕ]Ê"«Ì>Ê ÀÃÌ>Ê `ÕV>ÌÊVÕÀÀVÕÕ]ʺ ÀV iÌ»Ê >}>âi]ÊÌiÝÌLÃ]Ê`iÛÌ>Ê LÃ]ÊÌÀ>VÌÃÊ>`ÊÌ iʺ viÊÊÌ iÊ -«ÀÌ»Ê-ÌÕ`ÞÊ Li° } ÌÊvÀÊÌ iÊ ÃÌÊ / ÊÃÊ`i`V>Ìi`ÊÌÊëÀi>`}ÊÌ iÊ /ÊÀiii]Ê £{{xÊ ÛiÊÛi° / ® `Ê iÜÃÊvÊÃ>Û>ÌÊÌ ÀÕ} Ê >Ì>Ê -«À}wi`]Ê "ÊÈxnäÓ iÃÕÃÊ ÀÃÌÊÜÌ ÊÌiÀ>ÌÕÀiÊÌ >ÌÊÃÊ À`>ÌÀ VÌÕ>ÊV>Ì\Êà VÀvÌÊ Ã ««i`Ê>ÊÛiÀÊÌ iÊÜÀ`°ÊÊ / Ê iÌiÀ]ÊÓ`ÊyÀ® >ÃÊ«ÀÛ`iÃÊw>ViÃÊvÀÊiÛ>}iÃÌVÊ {£Ç®ÊnÈÓÓÇn£ÊÝ{£ÈÓ ÌiÀ>ÌÕÀiÊ«À`ÕVi`ÊÊVÕÌÀiÃÊ >ÝÊ{£Ç®ÊnÎÓäxÇ{ >ÀÕ`ÊÌ iÊÜÀ`° vÌJ>}°À} ÜÜÜ°} ÌvÀÌ iÃÌ°>}°À} ÃÃÃÊLÀ>`Ê *À}À>Ê`iÃ}i`ÊÌÊÛÛiÊiÊ ,VÊ Ã]Ê £{{xÊ ÛiÊÛi° *>ViiÌÊ-iÀÛViÊ >`ÊÜiÊÊà ÀÌÌiÀÊÃÃ>ÀÞÊ ÀiVÌÀ]Ê-«iV>Ê -«À}wi`]Ê "ÊÈxnäÓÊ ÃiÀÛViÊ£xÊÌ Ã®ÊÛiÀÃi>ðÊÊ *-Ê ÃÌÀiÃÆÊ iÊ {£Ç®ÊnÈÓÓÇn£ÊÝÓän{ *-® >««iÃÊÌ iÊÃÃÊ>`ÊÌiÀiÃÌÃÊvÊ VÃ]Ê*ÀViÃÃ}Ê >ÝÊ{£Ç®ÊnÈÓänÇÈ `i`V>Ìi`Ê`Û`Õ>ÃÊÜ ÊÜà ÊÌÊLiÊ -«iV>ÃÌ 7 *-JÊ>}°À} ÕÃi`ÊLÞÊ`ÊÌÊÃÌiÀÊ>LÀ>`° ÜÜÜ°ÜÀ`ÃÃð>}°À} ÃÃÃÊLÀ>`Ê *À}À>ÊÀiVÀÕÌÃÊÌi>ÃÊvÊÛÕÌiiÀÃÊ iÀ>`Ê>VÃ]ÊÊ £{{xÊ ÛiÊÛi° *>ViiÌÊ-iÀÛViÊ ÌÊ>ÃÃÃÌÊÃÃ>ÀiÃÊÊLÕ`}]Ê 7 Ê *-Ê -«À}wi`]Ê "ÊÈxnäÓ ÀiÛ>Ì}]ÊÀÊÀi«>À}ÊV ÕÀV iÃ]Ê ÃÌÀÕVÌÊ {£Ç®ÊnÈÓÓÇn£ÊÝÊÓänÓ *-Ê Õ`iÀî LiÊÃV Ã]Ê/iiÊ >i}iÊ ,i«ÀiÃiÌ>ÌÛiÆÊ >ÝÊ{£Ç®ÊnÈÓänÇÈ ViÌiÀÃ]Ê>`ÊÕV ÊÀi°ÊÊ-iÊ iiÊiÀ`°Ê 7 *- Õ`iÀÃJ>}°À} Ìi>ÃÊÀiLÕ`ÊÃÌÀÕVÌÕÀiÃÊÌ >ÌÊÜiÀiÊ -Õ««ÀÌÊ-«iV>ÃÌÊ ÜÜÜ°ÜÀ`ÃÃð>}°À} `>>}i`ÊÀÊ`iÃÌÀÞi`ÊLÞÊ>Ê`Ã>ÃÌiÀ]Ê VÃÌÀÕVÌÊÌi>ÃÆÊ Ü iÊÌ iÀÃÊLÕ`ÊiÌÀiÊLÕ`}ÃÊ vÀÊÌ iÊ}ÀÕ`ÊÕ«°ÊÊ *-Ê ÃÌÀÞÊ / ÊÃÌÀÞÊ Ìi>ÃÊ>ÀiÊ>ÃÊ >`i`ÊÌ ÀÕ} ÊÌ ÃÊ Ìi>î «À}À>°ÊÊ ÃÌÊÌi>ÊÌÀ«ÃÊ>ÀiÊiÊÌÊ ÌÜÊÜiið +ÕiÃÌÊ ÃÌÀiÃÊ Ài>ÌÀÃÊvÊ*ÜiÀ >ÀÊ VÃÊ>Ê iÊ >``Ý]Ê ÎnäÊ °ÊÜÞ°Ê ÌiÀ>Ì> ÀÃÌ>ÊVVÊLÊÃiÀiÃÊÃ`Ê `ÃÌÀ>ÌÛiÊ -ÕÌiÊ £ä{Ê >ÊÛiÀÊÌ iÊÜÀ`ÆÊ*ÜiÀ >ÀÊ À`>ÌÀ Ý>]Ê "ÊÈxÇ£{ -iiiÀÊ-iÀiÃÊ>ÊV `Ài½ÃÊÃÝÊiÃÃÊ {£Ç®ÊÇÓ{£ÓÓÓ `ÃV«ià «ÊVÕÀÃiÊÜÀÌÌiÊÊVVÊ >ÝÊ{£Ç®ÊÇÓ{䣣 LÊvÀ>ÌÆÊ>`Ê i>`µÕ>ÀÌiÀÃÊ iJµÌiÀ>Ì>°V vÀÊ `Ã+ÕiÃÌÊÌiÀ>Ì>Ê>Ê ÜÜÜ°«ÜiÀ>ÀVVðV V«Ài iÃÛiÊV `Ài½ÃÊiÛ>}iÃÊ ÜÜÜ°`õÕiÃÌÜÀ`°V ÃÌÀ>Ìi}ÞÊvÀÊV ÕÀV iÃÊÊ`iÛi«}Ê VÕÌÀiðÊÊÕ`i`ÊLÞÊ-ÌiÛiÊ>`Ê `ÞÊ iÌi`° {n ,>`ÊÛ>Vi 4HE VOICE OF THE !SSEMBLIES OF 'OD iiÌ Ê-Ì ]Ê *°"°Ê ÝÊÓ{Ón TO THE (ISPANIC WORLD PRODUCING OVER ÀiVÌÀ 6>ÀV]Ê ÊÎÎ{x HALF HOUR PROGRAMS PER YEAR HEARD VÌÕ>ÊV>Ì\Ê£ÎnÊ ON LOCAL STATIONS SHORT WAVE SATELLITE *ÀÛ`iViÊ,>` AND THE INTERNET !PPROXIMATELY À>`]Ê ÊÎÎx££ DIFFERENT FORMATS ARE UTILIZED TO MINISTER n£Î®ÊÈx{££Çä THE 'OSPEL TO THE LIVES OF NONBELIEVERS >ÝÊn£Î®ÊÈx{nnÎÈ AND BELIEVERS ALIKE AMONG THE CHILDREN À>`>Û>ViJÀ>`>Û>Vi°V YOUTH AND ADULTS OF THE 3PANISH ÜÜÜ°À>`>Û>Vi°V 3PEAKING 7ORLD ,Þ>Ê,>}iÀÃÊ 2OYAL 2ANGERS )NTERNATIONAL EXISTS TO Õ}Ê >Àà ]Ê £{{xÊ ÛiÊÛiÕi ÌiÀ>Ì> EMPOWER MISSIONARIES AND NATIONAL ÀiVÌÀ -«À}wi`]Ê "ÊÈxnäÓ CHURCH LEADERS TO STRENGTHEN AND {£Ç®ÊnÈÓÓÇn£ÊÝ{£{ EXPAND 2OYAL 2ANGERS IN EACH REGION >ÝÊ{£Ç®ÊnΣnÓÎä OF THE WORLD 4HE h'LOBAL "ASELINE `>Àà J>}°À} #URRICULUM AND 4RAINING 0ROCEDURESv ÜÜÜ°`Õ}>Àà °À} IS A STARTER CURRICULUM PROVIDED IN ELECTRONIC FORM ENABLING EACH NATION TO ADAPT THE MATERIALS TO THEIR CULTURE AND NEEDS BEFORE IMPLEMENTING 0ROMOTIONAL TRAINING AND CONSULTATIVE SERVICES ARE ALSO AVAILABLE ->ÛiÊ ÕÀ«i½ÃÊ h3AVE %UROPES #HILDREN EXISTS TO MEET ->`À>Ê Õ`Ã]Ê £nÎÊ °Ê-Õà i]Ê-ÕÌiÊÈ `Ài THE NEEDS OF %UROPES CHILDREN THROUGH À`>ÌÀ -«À}wi`]Ê "ÊÈxnä{ COMPASSION EVANGELISM AND #HRISTIAN {£Ç®ÊnÈÓÓÇÎÓ EDUCATIONv >ÝÊ{£Ç®ÊnnÎÎÓä Ã>ÛiiÕÀ«iÃV `ÀiJiÌâiÀ°iÌ - ÀÌ/iÀÊ #OORDINATION OF THE SHORT TERM ,VÊ Ã]Ê £{{xÊ ÛiÊÛiÕi ÃÌiÀÊLÀ>`Ê OVERSEAS MINISTRY OF !SSEMBLIES OF 'OD ÀiVÌÀ]Ê-«iV>Ê -«À}wi`]Ê "ÊÈxnäÓ CREDENTIAL HOLDERS PASTORS EVANGELISTS ÃÌÀiÃÆÊÞViÊ {£Ç®ÊnÈÓÓÇn£ÊÝÓänäÊÀÊ -/ ® AND "IBLE 3CHOOLSEMINARY PROFESSORS ÕLLÃ]Ê*ÀViÃÃ}Ê Óän WITH THE ONGOING WORK OF THE !'7- -«iV>ÃÌ >ÝÊ{£Ç®ÊnÈÓänÇÈ MISSIONARIES AND THE NATIONAL CHURCH -/ J>}°ÊÀ} WORLDWIDE ÜÜÜ°ÜÀ`ÃÃð>}°À} -ÌÕ`iÌÃÊvÀÊ 3&# IS AN EXTENSION OF THE CHURCH ÊEÊÌ>Ê >ÕÃÃiiÊ`iÊ7>ÌiÀ ÀÃÌÊ ÕÀ«iÊ REACHING OUT TO COLLEGES AND ià >]Ê {x]Ê£È{äÊ, `i-Ì°iiÃi UNIVERSITIES OF %UROPE 3&# CONSISTS ÃÃ>ÀÞÊVÌ>VÌà i}ÕÆ "vwViÊ- ® OF MISSIONARIES NATIONAL WORKERS ÎÓ°ä®Ó°Îxn°{{xÈ 0ENTECOSTAL CHURCHES AND STUDENT LEADERS >ÝÊÎÓ°ä®Ó°Îxn°xxÈ£ WHO FOCUS THEIR LIVES MINISTRIES AND °ià >J>}`°À} SPARE TIME TO CREATE A COMMUNITY OF ÜÜÜ°ÃvViÕÀ«i°À} BELIEVERS ON THE CAMPUS WHO HAVE A PASSION OF REACHING STUDENTS FOR *ESUS { ÌiÀ>Ì>Ê-iÀÛViÊ ÃÌÀià ÕLiÀÊvÊÃÃ>ÀÞÊÃÕ««ÀÌÊÃÌÀiÃ]ÊÜÀ}ÊÕ`iÀÊÌ iÊ>ÕëViÃÊvÊÃÃiLiÃÊvÊ`Ê Ê7À`Ê ÃÃÃ]Ê}iiÀ>ÌiÊ i«ÊvÀÊ>««Ìi`ÊÃÃ>ÀiÃÊÊÌ iÊ>Ài>ÃÊvÊÌiÀ>ÌÕÀi]Ê LiÃ]Ê «À>ÞiÀ]Êi`>ÊÕÌÀi>V ]ÊiÛ>}iÃ]Ê`ÃV«ià «]ÊÌÀ>}]ÊV `Ài½ÃÊÃÌÀiÃÊ>`Ê Õ>Ì>À >ÊVViÀð ÕÀÊÃÌÀiÃÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÃiÀÛiÊÌ iÊiÌÀiÊÃÃ>ÀÞÊL`Þ°Ê/ iÞÊ«ÀÛ`iÊÌÃÊ >`ÊvviÀÊëiV>âi`Ê>ÃÃÃÌ>ViÊÌÊiÝÌi`ÊÌ iÊÃÌÀiÃÊvÊÃÃ>ÀiÃÊ>`Ê>Ì>ÊV ÕÀV ið ÊvÊ«i ÊÌ iÊ«>ÃÌÊ£ÇÊÞi>ÀÃ]ÊvviVÌÊ iÃÌÞÊÌi>ÃÊ >ÛiÊ`ÃÌÀLÕÌi`ÊÀiÊÌ >ÊÓÎäÊÊV«iÃÊvÊ ÊvÊ«iÊÌÊV `ÀiÊ>`ÊÞÕÌ ÊÊ£äÈÊVÕÌÀiðÊÃÊ>ÞÊ>ÃÊx]ÎÓäÊLiiÛiÀÃÊvÀÊÌ iÊ 1Ìi`Ê-Ì>ÌiÃÊ >ÛiÊÃ>VÀwVi`ÊÛ>V>ÌÃÊ>`Ê«>`ÊÌ iÀÊiÝ«iÃiÃÊÌÊÌÀ>ÛiÊÜÌ Ê "Êi>`iÀÃÊÌÊ `ÃÌÀLÕÌiÊÌ iÊLÊÊÃV ÃÊÌ ÀÕ} ÕÌÊÌ iÊÜÀ`°Ê ÊvÊ«iÊÃÊ>Ê >ÀÞÊvÊÌ iÊà «iÃ]ÊVÕ`iÃÊÌ iÊ«>ÊvÊÃ>Û>Ì]Ê>`Ê >ÃÊLiiÊÌÀ>Ã>Ìi`ÊÌÊÀiÊÌ >ÊÈxÊ>}Õ>}ið / iÊÃÌÀÞ]ÊiÃÌ>Là i`ÊLÞÊÃÃ>ÀÞÊ LÊÃÃ]Ê>ÃÊÜÀÃÊÊV«iÀ>ÌÊÜÌ Ê> Ì>ÊV ÕÀV iÃÊÌÊ«ÀiÃiÌÊ«iÊiÃÌÊiÛ>}iÃÌVÊVÀÕÃ>`iðÊ/ ÕÃ>`ÃÊvÊ«i«iÊ >ÛiÊ>VVi«Ìi`Ê ÀÃÌÊ>ÃÊÌ iÀÊ->ÛÀ]ÊÛiÃÊ >ÛiÊLiiÊÌÀ>ÃvÀi`]Ê>`Ê>ÞÊV ÕÀV iÃÊ >ÛiÊLiiÊ«>Ìi`Ê Ì ÀÕ} Ê ÊvÊ«iÊ`ÃÌÀLÕÌð /À>}ÊÃÊ>ÌÊÌ iÊvÀivÀÌÊvÊ "½ÃÊÃÌÀ>Ìi}Þ°Ê *-ÊÜÀiÀÃÊ>`ÊÃÃ>ÀÞÊ>ÃÃV>ÌiÃÊ ÜÀ}ÊÜÌ Ê "ÊV`ÕVÌÊV `ÀiÊ>`ÊÞÕÌ ÊiÛ>}iÃÊÃi>ÀÃÊ>`Ê`iÊ`ÃÌÀLÕÌÊÊ ÃV ðÊ/ iÃiÊÞÕ}Ê>`ÕÌÃÊ>ÀiÊLi}ÊiÌÀi`Ê>ÃÊviÌiÊÃÃ>ÀiÃÊ>`ÊÃÃÃvVÕÃi`Ê «>ÃÌÀÃ]ÊV ÕÀV Êi>`iÀÃÊ>`Ê>ÞÊ«i«i° ÀÊÀiÊvÀ>ÌÊVÌ>VÌÊ ÊvÊ«i]ÊΣ££Ê-7Ê£äÌ Ê-ÌÀiiÌ]Ê*«>Ê i>V ]Ê Ê ÎÎäÈ°Ê* \Êx{ÇxÇÇÇÇÆÊ >\ÊvJLv «i°iÌÊÀÊÜÜÜ°Lv «i°iÌ° iÌiÀÊ"vÊ ÃÌÀÞÊ/Ê ÕÃà ÊÌ iÊi>ÀÞÊ£näÃÊÌ iÊVVi«ÌÊvÊÃÌiÀ}ÊÌÊ ÕÃÃÊÜ>ÃÊiÜ°Ê ÀÃÌ>ÃÊÊÌ iÊ1Ìi`Ê -Ì>ÌiÃÊiÜÊÛiÀÞÊÌÌiÊ>LÕÌÊÃ>ÊÀÊÌÃÊvÜiÀð ÕÌÊ>ÃÊÌ ÃÊÕÀi>V i`Ê«i«iÊ}ÀÕ«Ê}ÀiÜÊÌÊ>ÃÌÊääÊ]Ê>ÊLÕÀ`iÊÌÊÀi>V Ê ÕÃÃÊ ÜÌ ÊÌ iÊ}ëiÊLi}>ÊÌÊLÕÀÊÊÌ iÊ i>ÀÌÃÊvÊ ÝiVÕÌÛiÊ ÌÌiiÊiLiÀðÊ/ iÞÊÃÕ} ÌÊ`Ê vÀÊ`ÀiVÌ]Ê>`Ê>ÃÊ>ÊÀiÃÕÌÊÌ iÊ iÌiÀÊvÀÊ ÃÌÀÞÊÌÊ ÕÃÃÊ ®ÊÜ>ÃÊiÃÌ>Là i`° -ViÊÌÃÊLi}}]Ê ½ÃÊ>ÊvVÕÃÊ >ÃÊLiiÊÌÊLâiÊ>ÊvÀViÊÜ ÃiÊ«À>ÀÞÊÛÛi iÌÊÃÊÌiÀViÃÃÀÞÊ«À>ÞiÀÊvÀÊ ÕÃÃÊ>ÀÕ`ÊÌ iÊÜÀ`°Ê/ ÃÊ«À>ÞiÀÊvÀVi]ÊÜ V ÊÌ`>ÞÊ ÕLiÀÃÊÎä]äääÊ«i«iÊÊ{Ê>ÌÃ]ÊÃÊÜÊ>ÃÊÌ iÊÕ>>Ê*À>ÞiÀÊiÜà «°ÊÕ>>ÊÃÊÌ iÊ À>LVÊÜÀ`ÊvÀÊÀ`>Þ]ÊÌ iÊ`>ÞÊvÀÊVÕÌÞÊ«À>ÞiÀÊÊÌ iÊ ÕÃÊÜÀ`° /Êii«ÊÌÃÊ«À>ÞiÀÊvÀViÊvÀi`ÊvÊiÜÃÊ>`ÊëiVwVÊ«À>ÞiÀÊii`ÃÊÜÌ ÊÌ iÊÃ>VÊÜÀ`]Ê Ê«ÕLà iÃÊÌiÀVi`i]Ê>ÊLÌ ÞÊiÜÃÊ>`Ê«À>ÞiÀÊiÌÌiÀÊ`ÃÌÀLÕÌi`ÊÊnäÊVÕÌÀið ÃÊ>ÊÃiV`Ê«ÀÀÌÞ]Ê ÊÃÊ`i`V>Ìi`ÊÌÊLâ}Ê>`ÊÌÀ>}Ê>Ì>Ê«>ÃÌÀÃ]Êi>`iÀÃÊ >`ÊÜÀiÀÃÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÜÀ`Ü`i°ÊÊÌ iÊ«>ÃÌÊÃiÛiÀ>ÊÞi>ÀÃ]ÊÌÀ>}Ê>`Ê>Ü>Ài iÃÃÊÃi>ÀÃÊ >ÛiÊLiiÊV`ÕVÌi`ÊÊnäÊVÕÌÀiÃÊÊÃÝÊVÌiÌÃ°Ê ÀiÊÌ >ÊÓÇ]äääÊ«>ÃÌÀÃÊ >`ÊÜÀiÀÃÊ >ÛiÊ>ÌÌi`i`ÊÌ iÃiÊÃi>ÀÃ°Ê Ê«iÀÃiÊ>ÃÊ >ÛiÊÌ>Õ} ÌÊVÕÀÃiÃÊÊÃ>VÊ ÃÌÕ`iÃÊÊÃÃiLiÃÊvÊ`Ê LiÊVi}iÃÊÊ>ÞÊVÕÌÀið Ì iÀÊvVÕÃÊvÊ ÊÃÊÌÊ i«Ê ÀÃÌ>ÃÊÊÌ iÊ1Ìi`Ê-Ì>ÌiÃÊLiViÊ>Ü>ÀiÊvÊÃ>Ê>`Ê ÌÃÊL>ÃVÊLiivÃ°Ê Ê >ÃÊ i«i`ÊÌ ÕÃ>`ÃÊvÊ«i«iÊi>ÀÊ ÜÊÌÊÀi>V ÊÕÌÊÌÊ ÕÃÃÊÜÌ Ê Ì iÊiÃÃ>}iÊvÊÌ iÊ}ëiÊLÞÊiÃÌ>Là }Ê>ÊvÕ`>ÌÊvÊvÀi`à «Ê>`ÊÌÀÕÃÌ°Ê/ ÃÊvÀ> xä ÌÊÃÊ>Û>>LiÊÊÃiÛiÀ>Ê ÊLiÌÃÊpÊ- >À}Ê9ÕÀÊ>Ì ÊÜÌ Ê ÕÃÃ]Ê,i>V Ê"ÕÌÊÊ Ài`à «]Ê7 >ÌÊ ÀÃÌ>ÃÊ ii`ÊÌÊ ÜÊLÕÌÊ ÕÃÃ]Ê>`ÊÕÀiÞÊÌÊ1`iÀÃÌ>`}° Ê>ÃÊ«ÕLà iÃÊ ÀÊ1Ê>µÊ/ iÊ } ÌÊvÊ/ÀÕÌ ®]Ê>ÊL}Õ>Ê«ÕLV>ÌÊÊ }Ã Ê >`ÊÀ>LVÊÌ >ÌÊ«ÀiÃiÌÃÊÌ iÊ}ëiÊÊ>ÊVÌiÝÌÕ>âi`ÊÜ>ÞÊÌÊ ÕÃÃ°Ê ÕÀÀiÌÞ]Ê ÀÊ1Ê >µÊÃÊ`ÃÌÀLÕÌi`ʵÕ>ÀÌiÀÞÊÊ£äÈÊVÕÌÀið Ê«ÀÛ`iÃÊÌÀ>}ÊvÀÊ>ÊÃÃiLiÃÊvÊ`ÊÃÃ>ÀÞÊV>``>ÌiÃÊÜ Ê«>ÊÌÊÃÌiÀÊ Ê>ÌÃÊÜÌ Ê>À}iÊ ÕÃÊ««Õ>ÌðÊÊV«iÀ>ÌÊÜÌ ÊÃÃiLiÃÊvÊ`Ê/ i}V>Ê -i>ÀÞÊÊ-«À}wi`]Ê ÃÃÕÀ]Ê ÊvviÀÃÊ>Ê}À>`Õ>ÌiiÛiÊÌÀ>}ÊÃiÃÃÊi>V ÊÞi>À° / iÊÛ>ÃÌÊÕLiÀÊvÊÃÌÀÞÊÕÌÀi>V iÃÊÌ >ÌÊÛÛiÊ ÊVÌÕiÃÊÌÊiÝ«>`Ê>ÃÊiÜÊ iÌ `ÃÊ>`Ê««ÀÌÕÌiÃÊvÀÊÀi>V }ÊÌ iÊÜÀ`ÊvÊÃ>ÊÜÌ ÊÌ iÊ}ëiÊLiViÊÜ° ÀÊÀiÊvÀ>ÌÊ>LÕÌÊ iÌiÀÊvÀÊ ÃÌÀÞÊÌÊ ÕÃÃÊ>`ÉÀÊÃ>«iÃÊvÊ Ê«ÕL V>ÌÃ]ÊVÌ>VÌÊ iÌiÀÊvÀÊ ÃÌÀÞÊÌÊ ÕÃÃ]ÊÓäÎÓÊ °Ê i>ÀiÞ]Ê-ÕÌiÊÓäx]Ê-«À}wi`]Ê "Ê ÈxnäΰÊ* \Ê{£ÇnÈÈÎΣÎÆÊ>Ý\Ê{£ÇnÈÈÎÇÎÎÆÊ7iLÊÃÌi\ÊÜÜÜ°ViµÕ«°À}° L>Ê/iiÊ >i}i / iÊ«ÀLiÊvÊ>``VÌÊVvÕ`ÃÊ}ÛiÀiÌÊ>ÕÌ ÀÌiÃÊ>`ÊVvÕÃiÃÊ>`Ê`iÃÌÀÞÃÊ v>iÃÊÌ ÀÕ} ÕÌÊÌ iÊÜÀ`°Ê/ ÀÕ} ÊÌ iÊÃÌÀÞÊvÊ`i`V>Ìi`Ê«iÀÃiÊÊÓ{£ÊViÌiÀÃ]Ê L>Ê/iiÊ >i}iÊÃÊÀi>V }ÊÌ iÊÃÌÊ>`ÊÌÀÕLi`ÊÃÕLVÕÌÕÀiÊvÊ>``VÌðÊ/ ÊiÛ>}iÃÊ ÕÌÀi>V iÃÊ«ÀiÃiÌÊ ÀÃÌ]ÊÌ iÊÃÜiÀÊÌÊ>``VÌ]ÊÊÃÌÀiiÌÃ]Ê}>}ÊÌÕÀvÃ]ÊÀi`Ê} ÌÊ`ÃÌÀVÌÃ]Ê «ÀÃÃ]Ê`«iÊ`iÃÊ>`ÊÌ iÀÊ`>ÀÊ>`Ê`>}iÀÕÃÊ«>ViÃÊÌ >ÌÊiÛiÊ«ViÊvÌiÊ>Û`°Ê/ ÃÊ ÀÃÌViÌiÀi`]Êv>Ì L>Ãi`Ê«À}À>ÊÃÊvÌiÊÌ iÊÞÊ«>ViÊ>ÞÊ>``VÌÃÊV>ÊLiÊ«iÀ>iÌÞÊ V >}i`°Ê/ ÊÃÃ>ÀiÃÊÌÀ>Ê>Ì>ÊÜÀiÀÃÊÌÊVvÀÌÊÌ iÊ «iiÃÃiÃÃÊvÊ>``VÌÊ >`ÊÌ iÀÊviVÌÀ}Ê«ÀLiÃÊÜÌ ÊL`ÊiÛ>}iÃÊivvÀÌÃÊ>`ÊÌ iÊV«>ÃÃÊvÊ ÀÃÌ° ÀÊÀiÊvÀ>ÌÊVÌ>VÌÊL>Ê/iiÊ >i}i]Ê*"Ê ÝÊnä]Ê VÕÃÌÊÀÛi]Ê6Ê ÓÓxän°Ê* \Êx{äÇÓnÓÓÎÆÊ >\Ê}ÌVJ}L>ÌV°À}ÊÀÊÜÜÜ°}L>ÌV°À}°Ê L>Ê1ÛiÀÃÌÞ L>Ê1ÛiÀÃÌÞ]ÊiÃÌ>Là i`ÊÊ£ÈÇ]ÊÃÊ>ÊÜÀ`ÊÃÃÃÊÕÌÀi>V Ê`i`V>Ìi`ÊÌÊÌ>}ÊÌ iÊ }ëiÊÌÊ>Ê>ÌÃÊ>`Ê>}Ê`ÃV«iÃÊÜ ÊÊÌÕÀÊÜÊ`ÃV«iÊ>`ÊÌÀ>ÊÌ iÀðÊÀÊÌÃÊ ÌiÀ>Ì>Ê i>`µÕ>ÀÌiÀÃÊÊ-«À}wi`]Ê ÃÃÕÀ]ÊL>Ê1ÛiÀÃÌÞÊÃiÀÛiÃÊ>ÊiÌÜÀÊvÊÀiÊ Ì >ÊÓäÇÊÀi}>Ê>`Ê>Ì>ÊvwViÃÊÜÀ`Ü`i°ÊÌÃÊ«ÕÀ«ÃiÊÃÊÌÊ`iÛi«Ê>`Ê`ÃÌÀLÕÌiÊVÕÀ ÀVÕÕÊvÀÊiÛ>}iÃ]Ê`ÃV«ià «]ÊÕÌÀi>V ÊÌÊÌ iÊÌiÀ>Ìi]Ê>`Ê>VVÀi`Ìi`Ê >V iÀÊvÊÀÌÃÊ >`Ê}À>`Õ>ÌiÊÃÌÕ`ÞÊ«À}À>ÃÊvÀÊÌÀ>}ÊÃÌiÀð ÀiÊÌ >ÊÈ£È]äääÊ`i}ÀiiÊÃÌÕ`iÌÃÊ>`ÊÈ]ÇxÊVi}iiÛiÊÃÌÕ`iÌÃÊÊÀiÊÌ >Ê£ÈäÊ >ÌÃÊVÕÀÀiÌÞÊ>ÀiÊiÀi`ÊÊL>Ê1ÛiÀÃÌÞÊVÕÀÃiðÊ/ iÞÊÃÌÕ`ÞÊÊ>ÊÛ>ÀiÌÞÊvÊÃiÌÌ}Ã\Ê LÞÊVÀÀië`iVi]ÊÃ>Ê}ÀÕ«ÊÃÌÕ`iÃ]ÊV ÕÀV Êi>À}ÊViÌiÀÃÊÀÊÀiÃ`iÌÊ LiÊÃV ð -ViÊ£ÈÇÊÀiÊÌ >Ê£°nÊÊÃÌÕ`iÌÃÊ >ÛiÊÌiÃÌwi`ÊvÊÀiViÛ}ÊiÃÕÃÊ ÀÃÌÊ>ÃÊ->ÛÀÊ>ÃÊ >ÊÀiÃÕÌÊvÊÃÌÕ`Þ}ÊÜÌ ÊL>Ê1ÛiÀÃÌÞ°ÊL>Ê1ÛiÀÃÌÞÊ>ÌiÀ>ÃÊ>ÀiÊivviVÌÛiÊÌÃÊvÀÊ ÃÃ>ÀÞÊiÝÌiÃÊÕÌÀi>V Ê>`Ê LiÊÌÀ>}°Ê/ iÊÃÌÀÞÊ>ÃÊvviÀÃÊ LiÊÃÌÕ`ÞÊVÕÀÃiÃÊ Ê£xÓÊ>}Õ>}iÃ]Ê«ÀÛ`}Ê>ÌiÀ>ÃÊÊ«ÀÌ]Ê>Õ`]ÊÛ`iÊ>`ÊÌiÀ>VÌÛiÊi`>°ÊÌÊÃÊ>V VÀi`Ìi`ÊLÞÊÌ iÊVVÀi`Ì}Ê ÃÃÊvÊÌ iÊ ÃÌ>ViÊ `ÕV>ÌÊ>`Ê/À>}Ê ÕVÊÊÌ iÊ 1Ìi`Ê-Ì>Ìið L>Ê1ÛiÀÃÌÞÊw>V>ÊÃÕ««ÀÌÊViÃÊvÀÊÃÃÃ`i`Ê`Û`Õ>ÃÊ>`ÊV ÕÀV iÃÊ Ì >ÌÊ}ÛiÊvviÀ}ÃÊ>`ÊÌ ÞÊ«i`}ið ÀÊÀiÊvÀ>ÌÊVÌ>VÌÊL>Ê1ÛiÀÃÌÞ]Ê£Ó££Ê-ÕÌ ÊiÃÌi]Ê-«À}wi`]Ê "Ê Èxnä{°Ê* \Ê£nääÊ{{ΣänÎÆÊ >\ÊvJ}L>ÕÛiÀÃÌÞ°i`ÕÊÀÊÜÜÜ°}L>ÕÛiÀÃÌÞ°i`Õ°Ê x£ i>Ì V>ÀiÊ ÃÌÀiÃÊ i>Ì >ÀiÊ ÃÌÀiÃÊ ®ÊÃÊÌ iÊÜÀ`Ü`iÊi`V>ÊÃÌÀÞÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃðÊÌÊ«ÀÛ`iÃÊ>ÊV >iÊvÀÊi`V>Ê«ÀviÃÃ>ÃÊÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊÌÊÃiÀÛiÊ >ÃÊ>ÞÊiÛ>}iÃÌÃÊ>ÃÊÜiÊ>ÃÊ i>Ì ÊÜÀiÀÃÊÊ>Ê*iÌiVÃÌ>ÊÃÌÀÞ°ÊÌÊÌ iÊÀiµÕiÃÌÊvÊÃÃ>À iÃÊ>`Ê>Ì>ÊV ÕÀV Êi>`iÀÃ]Ê ÊÌi>ÃÊ `Ê£Ê>`ÊÓÜiiÊVVÃÊÊ>Ài>ÃÊÜÌ ÊLÕÀ}i}Ê i>Ì Êii`ÃÊV>ÕÃi`ÊLÞÊ«ÛiÀÌÞ]Ê««Õ>ÌÊVÀi>Ãi]ÊÜ>À]Êv>i]Ê`ÀÕ} ÌÊÀÊ>ÌÕÀ>Ê`Ã>ÃÌiÀð i>Ì >ÀiÊ ÃÌÀiÃÊ>ÃÃÃÌÃÊÜÀ`ÊÃÃÃÊÕÌÀi>V ÊÊÌ iÃiÊÜ>ÞÃ\ *ÀÛ`iÃÊ««ÀÌÕÌiÃÊvÀÊ«ÀviÃÃ>Ê i>Ì Ê«ÀÛ`iÀÃÊÌÊ>iÊà ÀÌÌiÀÊi`V>ÊÃÌÀÞÊÌÀ«ÃÊ ÌÊii`ÞÊVÕÌÀiðÊ/ ÃÊÃÌÀÞÊvviÀÃÊ>ÞÊ««ÀÌÕÌiÃÊÌÊÜÊ«i«iÊÌÊiÃÕÃÊiÊLÞÊi° *ÀÛ`iÃÊ««ÀÌÕÌiÃÊvÀÊi`V>Ê«i«iÊÌÊ«>ÀÌV«>ÌiÊÊ ÊÌi>Ã]Ê`iÃÌÀ>Ì}Ê V«>ÃÃÊ>`Êà >À}Ê ÀÃÌÊÜÌ Ê ÕÀÌ}]ÊÃÕvviÀ}ÊÕÌÌÕ`ið "vviÀÃÊ`Ã>ÃÌiÀÊÀiivÊ>ÃÃÃÌ>ViÊÜ iÊV>i`ÊÕ«Ê>`ÊÜ iÊi`V>Éw>V>ÊÀiÃÕÀViÃÊÊ >ÀiÊ>Û>>Li° -iÀÛViÃÊÌ iÊ i>Ì Êi`ÕV>ÌÊii`ÃÊ>`ÊV`ÕVÌÃÊi`V>ÊVVÊÃÌÀiÃÊvÀÊÌ iÊ>Ì>ÊV ÕÀV ° *ÀÌiÃÊ i>Ì Ê>`Ê`Ãi>ÃiÊ«ÀiÛiÌ° "vviÀÃÊÀiÃÕÀViÊvÀ>ÌÊvÀÊV>Ì}Êi`ViÃÊ>`Êi`V>ÊÃÕ««ið *ÀÛ`iÃÊÌ iÊÃÃ>ÀÞÊv>ÞÊÜÌ Ê i>Ì ÊÀiÌ>Ì]ÊVÕÃi}]Êi`V>Ê>`ÛViÊ>`Ê« Þ ÃV>ÊÀiviÀÀ>ð iÛi«ÃÊëiV>âi`Ê i>Ì Ài>Ìi`ÊÌiÀ>ÌÕÀiÊVÕÀÃiÃÊvÀÊÕÃiÊÊÃÃiLiÃÊvÊ`Ê LiÊ ÃV ÃÊÛiÀÃi>Ã°Ê ÃÃÃÌÃÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÊÃiiVÌ}Ê>`Ê«>V}Ê i>Ì Ê«ÀviÃÃ>ÃÊÊ ÛiÀÃi>ÃÊ>ÃÃ}iÌð Ê >ÃÊÃiÌÊÎäÊÌi>Ã]ÊV«Ãi`ÊvÊÎ]ÈÈÓÊÌi>ÊiLiÀÃ]ÊÌÊnÓÊVÕÌÀiÃÊÜ iÀiÊÌ iÞÊ >ÛiÊ ÃÌiÀi`ÊÌÊÀiÊÌ >ÊÎä{]äääÊ«i«i°ÊÊ>``ÌÊÌÊÌ iÀÊÃÌÀÞÊvÊi`ViÊ>`ÊÛi]ÊÌi>Ê iLiÀÃÊ >ÛiÊ«À>Þi`ÊÌ iÊÃiÀ½ÃÊ«À>ÞiÀÊÜÌ ÊÇÓ]ÇÎÊvÊÌ ÃiÊÌÀi>Ìi`° /ÊÀiViÛiÊvÀ>ÌÊÊ ÜÊÌÊÛÕÌiiÀÊvÀÊ ÊÌi>Ã]ÊÀiViÛiÊvÀ>ÌÊÕ«`>ÌiÃÊ >`Ê«iÀ`VÊ i>Ì Ài>Ìi`ÊLÕiÌÃ]ÊLÌ>Ê>ÊÃV i`ÕiÊvÊÕ«V}ÊÃÃÃÊÌÀ«ÃÊÀÊ«À>ÞÊvÀÊ Ì ÃÊÜÀ`Ü`iÊÃÌÀÞ]ÊVÌ>VÌ°Êi>Ì >ÀiÊ ÃÌÀiÃ]ÊxÓ£Ê7iÃÌÊ ÞÊ-ÌÀiiÌ]Ê-«À}wi`]Ê "Ê ÈxnäÓ°Ê* Ê{£Ç®ÊnÈÈÈΣ£ÆÊ7iLÊÃÌi\ÊÜÜÜ° i>Ì V>ÀiÃÌÀiðÀ}° viÊ*ÕLà iÀà viÊ*ÕLà iÀÃ]ÊÌ iÊvÀi}>}Õ>}iÊÌiÀ>ÌÕÀiÊ>ÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ]Ê vviÀÃÊ>Ê«ÕLà }ÊÃiÀÛViÊÌÊ>ÊÃÃ>ÀiðÊ"iÊvÊÌ iÊÜÀ`½ÃÊ>À}iÃÌÊ`ÃÌÀLÕÌÀÃÊvÊ}ëiÊ >ÌiÀ>ÃÊÊvÀi}Ê>}Õ>}iÃ]Ê viÊ*ÕLà iÀÃÊ«ÀÌÃÊiÛ>}iÃÌVÊÌÀ>VÌÃ]Ê-Õ`>ÞÊ-V Ê>ÌiÀ>ÃÊ >`ÊÌiÝÌLÃÊvÀÊÃÌiÀ>Ê>`Êi>`iÀà «ÊÌÀ>}°Ê ÀÊÀiÊÌ >ÊxäÊÞi>ÀÃ]Ê viÊ*ÕLà iÀÃÊ >ÃÊLiiÊ>ÊÌiÀ>Ì>ÊÃÕ««iÀÊvÊ LiÃÊ>`Ê LiÊ«ÀÌðÊ-VÀ«ÌÕÀiÃÊ>ÀiÊÃÕ««i`ÊÊ>ÞÊ>}Õ>}iÃ]ÊVÕ`}Ê,ÕÃÃ>]Ê iÃi]Ê-«>à ]Ê ÀiV ]Ê*ÀÌÕ}ÕiÃiÊ>`Ê>ÞÊÀi°Ê/ iÊ viÊÊÌ iÊ-«ÀÌÊ-ÌÕ`ÞÊ LiÊ>ÃÊV>i`ÊÌ iÊÀiÊ Li®Ê ÃÊ>Ê>ÀÊvVÕÃÊvÀÊ viÊ*ÕLà iÀÃÊ>`ÊÃÊÜÊ>Û>>LiÊÊÛiÀÊ>Ê`âiÊ>}Õ>}iÃ]ÊÜÌ ÊÓ{ÊÀiÊ >}Õ>}iÊ«ÀiVÌÃÊÊ«À}ÀiÃÃ°Ê viÊ*ÕLà iÀÃÊÃÊVÌÌi`ÊÌÊ>ÊÜÀ`Ü`iÊÃÌÀÞÊvÊ«ÕLà }Ê>`Ê`ÃÌÀLÕÌ}ÊÌ iÊ}ëiÊ Ì ÀÕ} ÊÌiÀ>ÌÕÀi]Ê«i}Ê>ÞÊ`ÀÃÊvÀÊÃÃÃÊÕÌÀi>V ° ÀÊÀiÊvÀ>Ì]ÊÜÀÌiÊ viÊ*ÕLà iÀÃ]Ê£{ääÊ ÀÌ Ê >«Li]Ê-«À}wi`]Ê "ÊÈxnäÓ°Ê * Ênnn®ÊÇÇÈÓ{ÓxÊÀÊ{£Ç®ÊnΣÇÇÈÈÆÊ >\Ê viJÝV°À}° xÓ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê ÃÌÀià Ü}Ê>Ê`ÀiVÌÛiÊvÊÌ iÊ7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌiiÊÊ£ä]ÊÃÃÃÊi>`iÀÃÊ>« «i>i`ÊÌÊV>ÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊÌÊVÀi>ÃiÊÌ iÀÊÛÛiiÌÊÊÃÃðÊÃÊ>ÊÀi ÃÕÌ]Ê>Ê ÃÃÃÊ ÛiÌÊ/>ÃÊÀViÊÜ>ÃÊvÀi`ÊÌÊ}ÛiÊ>ÃÃÃÌ>ViÊÌÊV ÕÀV iÃÊÌ >ÌÊÀië`i`° Ê£]ÊÌ iÊÌ>ÃÊvÀViÊLÀ>`ii`ÊÌÃÊ«ÕÀ«ÃiÊÌÊVÕ`i\Ê£®ÊÃÃÃÊVÛiÌÃ]ÊÓ®Ê ÃÃÃÊ -Õ`>ÞÊ«À}À>Ã]ÊήÊvÀiµÕiÌÊÃÃ>ÀÞÊÛÃÌÃ]Ê>`Ê{®ÊÜiÀ}>âi`ÊÃÃÃÊVÌÌiiðÊ/Ê VÕV>ÌiÊÌÃÊÛÃÊÀiÊVi>ÀÞ]ÊÌ iÊ>iÊÜ>ÃÊV >}i`ÊÌÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>°Ê / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊ«>ÀÌÊvÊÌ iÊ7 Ê1°-°Ê,i>ÌÃÊ i«>ÀÌiÌÊ>`ÊÃiÀÛiÃÊ LÌ Ê>ÃÊ>ÊÃÌÀÞÊ>`ÊÃiÀÛViÊ>}iVÞ°Ê/ iÊÌi>ÊÃÊV«Ãi`ÊvÊÃÃ>ÀiÃÊ>`ÊÌ iÀÃÊÜÌ Ê>Ê Üi`}iÊvÊ>`ÊLÕÀ`iÊvÀÊÃÃðÊ/ iÊ>Ì>ÊVÀ`>ÌÀÊ>`ÊÀi}>ÊÀi«ÀiÃiÌ>ÌÛiÃÊ ÜÀÊÜÌ Ê`ÃÌÀVÌÊÃÃÃÊ`ÀiVÌÀÃÊÊ`iÌvÞ}ÊV ÕÀV iÃÊii`}Ê>ÃÃÃÌ>Vi° / iÊ>Ì>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊVÕ`iÃÊvÕÀÊVViÌÀ>ÌÃ\ÊÊ£®Ê*À>ÞiÀÊ/>ÃÊÀVi]Ê Ó®ÊVi}iÃÊ>`ÊÕÛiÀÃÌiÃ]ÊήÊ>Õ`ÛÃÕ>Ê>ÃÃÃÌ>ViÊ>`Ê{®ÊLÕ`}ÊÃÃÃÊ>Ü>ÀiiÃÃÊÊV>Ê V}Ài}>Ìð *À>ÞiÀÊ/>ÃÊÀVi >V ÊÞi>ÀÊ*À>ÞiÀÊ/>ÃÊÀViÊÌi>Ã]ÊÕ`iÀÊÌ iÊÃÕ«iÀÛÃÊvÊ>ÊÌ>ÃÊvÀViÊÀi«ÀiÃiÌ>ÌÛi]ÊÌÀ>ÛiÊ ÌÊÌ iÀÊ>ÌðÊ/ iÀÊ«ÕÀ«ÃiÊÃÊÌÊvviÀÊÃÕ««ÀÌÊÌÊÃÃ>ÀiÃÊ>`ÊÃÃÃÊivvÀÌÃÊÊ>Ê«>À ÌVÕ>ÀÊV>ÌÊÌ ÀÕ} Ê«À>ÞiÀÊ>`Êv>ÃÌ}Ê>`ÊÌÊ>ÃÃÃÌÊÊiÛ>}iÃÊivvÀÌð /i>ÊiLiÀÃÊÕÃÌÊLiÊ>ÌÕÀi]Ê`i`V>Ìi`Ê ÀÃÌ>ÃÊ>`Ê>ÌÊi>ÃÌÊ£ÈÊÞi>ÀÃÊ`°Ê`Û`Õ>ÃÊ >`ÊVÕ«iÃÊ>ÀiÊÜiVi°Ê/i>ÃÊ>ÀiÊV«Ãi`ÊvÊ>Ì>ÊÀÊ`ÃÌÀVÌÊi>`iÀÃ]ÊÃÌiÀÃÊ>`ÊÊ >ÌÞ°Ê i½ÃÊ>`Ê7i½ÃÊ ÃÌÀiÃÊ}ÀÕ«Ã]ÊV ÕÀV iÃÊ>`Ê } ÌÊvÀÊÌ iÊ ÃÌÊÌi>ÃÊvÌiÊ«>ÀÌV «>ÌiÊÊ*À>ÞiÀÊ/>ÃÊÀViÊÌi>ð /i>ÃÊ>ÀiÊii`i`ÊÌÊÜÀÊÜÌ ÊÃÃ>ÀiÃÊÊVÕÌÀiÃÊÀÊ>Ài>ÃÊÜ iÀiÊiÜÊ`ÀÃÊvÊ««À ÌÕÌÞÊ >ÛiÊ«ii`ÊvÀÊiÛ>}iÃÊÀÊÜ iÀiÊÀiÃÃÌ>ViÊÌÊÌ iÊ}ëiÊ >ÃÊ>`iÊÃÌÀÞÊ`vwVÕÌ° ÞÊ`Û`Õ>ÊÀÊ}ÀÕ«Ê`iÃÀ}ÊÌÊ«>ÀÌV«>ÌiÊÊ>Ê*À>ÞiÀÊ/>ÃÊÀViÊÌi>Êà Õ`ÊVÌ>VÌÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊvwVi]Ê£{{xÊ Ûi]Ê-«À}wi`]Ê "ÊÈxnäÓ£n{]ÊÀÊV>Ê{£ÇnÈÓ ÓÇn£]ÊiÝÌiÃÊÓäxä° i}iÃÊ`Ê1ÛiÀÃÌià iÜÊ ÀÃÌ>ÊÃÌÕ`iÌÃÊ>ÌÌi`}ÊÃiVÕ>ÀÊVi}iÃÊÀÊÕÛiÀÃÌiÃÊ>ÀiÊVvÀÌi`ÊÜÌ ÊÌ iÊ V >i}iÊvÊÃÃðÊ/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Êi`i>ÛÀÃÊÌÊÀiVÀÕÌÊÃÌÕ`iÌÃÊ>ÃÊ«>ÀÌiÀÃÊ vÀÊÜÀ`ÊiÛ>}iâ>Ì°ÊÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÀi«ÀiÃiÌ>ÌÛiÊ`ÀiVÌÃÊ ÃÊ>ÌÌiÌÊÌÊ ÃÃiLiÃÊvÊ`ÊVi}iÃÊ>`ÊÕÛiÀÃÌiÃÊ>ÃÊÜiÊ>ÃÊÃiVÕ>ÀÊÕÛiÀÃÌiÃÊÌ ÀÕ} ÊÌ iÊV>Ê Ê « >ÊÃÌÀÞ° ÀÊÀiÊvÀ>Ì]ÊV>ÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊvwVi° Õ`ÛÃÕ>ÊÃÃÃÌ>Vi >ÞÊV ÕÀV iÃÊ>ÀiÊÃiVÕÀ}ÊÀiÊ>`Û>Vi`Ê>Õ`ÛÃÕ>ÊÌiV }Þ°Ê/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ /i>ÊvviÀÃÊ>ÃÃÃÌ>ViÊÊÌ iÊLiÃÌÊÜ>ÞÃÊÌÊÕÃiÊÌ ÃÊiµÕ«iÌÊÌÊ«ÀÌiÊÃÃðÊÀÊÀiÊ vÀ>ÌÊ>LÕÌÊÌ ÃÊÃiÀÛVi]ÊV>ÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊvwVi° Õ`}Ê ÃÃÃÊÜ>ÀiiÃà / iÊV >i}iÊvÊii«}ÊÃÃÃÊ>ÌÊÌ iÊvÀivÀÌÊvÊÀiÊÌ >Ê£Ó]äääÊÃÃiLiÃÊvÊ `ÊV}Ài}>ÌÃÊÃÊVÌÕÕðÊ/ ÃÊÃÊÕ`iÀÃVÀi`ÊLÞÊÃÌ>ÌÃÌVÃÊvÀÊ>ÊÀiViÌÊV ÕÀV Ê>`Ê ÃÌiÀ½ÃÊÀi«ÀÌ° xÎ UÊÊ"ÞÊӣʫiÀViÌÊvÊ>ÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊV`ÕVÌi`Ê>ÊÃÃÃÊVÛiÌ°Ê/ >ÌÊ i>ÃÊÀiÊÌ >Ên]äääÊV ÕÀV iÃÊ``ÊÌÊ >ÛiÊ>ÊVÛiÌ° UÊÓ]ÎääÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊ}>ÛiÊÌ }ÊÌÊÜÀ`ÊÃÃÃ°Ê UÊÊ>vÊvÊÌ iÊÜÀ`ÊÃÃÃÊViÊV>iÊvÀÊ{°ÎÊ«iÀViÌÊvÊ1°-°ÊÃÃiLiÃÊvÊ`ÊV ÕÀV ið UÊ{ÓÊ«iÀViÌÊvÊV ÕÀV iÃÊ``ÊÌÊ >ÛiÊ>ÊÃÃ>ÀÞÊëi>iÀÊ`ÕÀ}ÊÌ iÊÞi>À° / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊVÌÌi`ÊÌÊ>ÃÃÃÌ}ÊV>Ê«>ÃÌÀÃÊÊ>}ÊÌ iÀÊV}Ài }>ÌÃÊ>ÊvÀViÊvÀÊÜÀ`ÊiÛ>}iâ>Ì°Ê-iÊvÊÌ iÊiÌ `ÃÊ>ÀiÊÌo £°Ê*ÀÌiÊÃÃÃÊ>ÌÊ>ÊiÛið Ó°ÊÊi«ÊV ÕÀV iÃÊ«>Ê>`ÊiÃÌ>Là Ê>ÊÃÃÃÊLÕ`}iÌÊ>`Ê«iiÌÊÌ iÊv>Ì Ê«ÀÃiÊÊ }Û}ÊVVi«Ì° ΰÊÃÃÃÌÊV ÕÀV iÃÊÊ«>}Ê>`ÊV`ÕVÌ}ÊÃÃÃÊVÛiÌð {°ÊÊ*ÀÌiÊÌ iÊv>Ì Ê«ÀÃiÊ«>ÊvÊ}Û}°Ê >Ãi`ÊÊÀi«ÀÌÃÊvÀÊV>ÊV ÕÀV iÃ]Ê>Õ>Ê ÃÃÃÊ}Û}ÊÕÃÕ>ÞÊÀiÊÌ >Ê`ÕLiÃÊ>vÌiÀÊ>ÊwÀÃÌÌiÊÃÃÃÊVÛiÌÊÜ iÀiÊ v>Ì Ê«ÀÃiÃÊ>ÀiÊÀiViÛi`° x°Ê ÃÌÊ«À>ÞiÀÊ«>ÀÌiÀð È°ÊÊ À>`iÊV ÕÀV Ê«>ÀÌV«>Ì°Ê/ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Êi`i>ÛÀÃÊÌÊVÀi>ÃiÊÌ iÊ «iÀViÌ>}iÊvÊV ÕÀV iÃÊ >Û}Ê>Õ>ÊÃÃÃÊVÛiÌÃ]ÊLÀ}}Ê}Ài>ÌiÀÊL>>ViÊÊ Ì iÊÛiÀ>ÊÃÃÃÊÃÕ««ÀÌÊvÀÊÃÃiLiÃÊvÊ`ÊV ÕÀV ið Ç°Ê `ÕV>ÌiÊ«i«iÊÊV>ÊV ÕÀV iÃÊ>LÕÌÊÃÃð n°ÊÊ*ÀÛ`iÊÜÀiÀÃÊvÀÊÌ iÊ >ÀÛiÃÌ°ÊÃÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÛÛiÃÊÀiÊ«i«iÊ ÊÜÀ`ÊÃÃÃÊ««ÀÌÕÌiÃ]ÊÌ iÊÞÊ-«ÀÌÊÜÊëi>ÊÌÊ i>ÀÌÃÊ>`ÊV>ÊÀiÊà Ã>ÀÞÊV>``>ÌiÃÊÌÊiiÌÊÃÃ>ÀÞÊ«iÀÃiÊii`ð / iÊ>Ì>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊvwViÊ>ÃÊÃÊÀiëÃLiÊvÀÊ«ÀÛ`}ÊÌÃÊÌÊ i«Ê V>ÊV ÕÀV iÃÊLÕ`ÊÃÕVViÃÃvÕÊÃÃÃÊÕÌÀi>V iðÊ/ iÃiÊVÕ`io £°ÊÊ ÛiÌÊÊ>Ê ÝÊÊ/ ÃÊLÝÊVÌ>ÃÊiÛiÀÞÌ }Êii`i`ÊÌÊV`ÕVÌÊ>ÊÃÃÃÊV ÛiÌÊÊ>Ê>ÛiÀ>}iÃâiÊÃÃiLiÃÊvÊ`ÊV ÕÀV °ÊÌÊÃÊ>Û>>LiÊvÀiiÊvÊV >À}iÊvÀÊ>ÞÊ V ÕÀV ÊÌ >ÌÊ >ÃÊiÛiÀÊV`ÕVÌi`Ê>ÊVÛiÌÊÀÊ >ÃÊÌÊ`iÊÃÊvÀÊ>ÌÊi>ÃÌÊÌ ÀiiÊÞi>ÀÃ°Ê ÊwÀÊVÛiÌÊ`>ÌiÊÕÃÌÊLiÊÃiÌÊLivÀiÊÌ iÊLÝÊÜÊLiÊÃiÌ°Ê Ó°ÊÊ ÛiÌÊ*>iÀÊpÊ/ ÃÊ >`ÞÊ«ViÌÊ«>iÀÊ«ÀÛ`iÃÊÌ iÊ«>ÃÌÀÊÀÊÃÃÃÊV ÌÌiiÊV >À>ÊÜÌ Ê>ÊÀiÃÕÀViÊÌÊÀiVÀ`ÊÌ iÊ>VÌÛÌiÃÊÃV i`ÕiÊ>`Ê`iÌ>ÃÊ«iÀÌ>}ÊÌÊ Ì iÊÃÃÃÊVÛiÌ° ΰÊÊ*ÀÛiÊ ÃÃÃÊ ÛiÌÊ`i>ÃÊÊ/ ÃÊ>Õ>ÊvÊ`i>ÃÊÜÊ i«Ê>``ÊÛ>ÀiÌÞÊÊ«À Ì}ÊÃÃÃÊÊÌ iÊV>ÊV ÕÀV Ê>`ÊvÀ>ÌÌ}Ê>ÊÃÃÃÊVÛiÌ° {°ÊÊ/ iÊ Õi«ÀÌoÊ Õ`}Ê ÃÃÃÊ-Õ««ÀÌÊqÊÊÃÌi«LÞÃÌi«Ê>Õ>ÊÌÊi>`ÊÌ iÊ«>ÃÌÀÊ >`ÊV>ÊV ÕÀV Êi>`iÀà «ÊÊ«>}Ê>`ÊV`ÕVÌ}Ê>Ê>Õ>ÊÃÃÃÊVÛiÌ° x°ÊÊ/ iÊ Õi«ÀÌoÊ Õ`}Ê ÃÃÃÊ6ÃÊ Ì ÊLÞÊ Ì ÊqÊÊÜÀLÊÌÊ>ÃÃÃÌÊi>` iÀà «ÊÊ«>}ÊÃÕVViÃÃvÕÊ«ÀiÃiÌ>ÌÃÊvÀÊ ÃÃÃÊ-Õ`>Þ°Ê >ÞÊÜ>ÞÃÊ>ÀiÊ}ÛiÊÌÊ ii«ÊÃÃÃÊLivÀiÊÌ iÊV>ÊV}Ài}>Ì° È°ÊÊ/ iÊ Õi«ÀÌoÊ Õ`}Ê ÃÃÃÊ i>`iÀà «ÊqÊÌ ÃÊ>Õ>® x{ 0!24 &INANCIAL (ELPS 0ROGRAMS ÜÊ>ÀÊ«À}À>ÃÊ >ÛiÊLiiÊiÃÌ>Là i`ÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÌÊ>ÃÃÃÌÊ /ÃÃ>ÀiÃÊÜÌ ÊëiVwVÊw>V>Êii`ðÊ/ iÃiÊ«À}À>ÃÊ«ÀÛ`iÊ««ÀÌÕÌÞÊvÀÊ«i«iÊ ÌÊLiÊÛÛi`ÊÊÛ>ÀÕÃÊiÌ `ÃÊvÊiÛ>}iâ}ÊÌ iÊÜÀ`°Ê/ iÊÜ`iëÀi>`ÊÌiÀiÃÌÊÊ>`Ê ÃÕ««ÀÌÊvÊÌ iÃiÊ«À}À>ÃÊÃÊ`V>ÌÛiÊvÊ>ÊÃÌÀ}ÊÃÃ>ÀÞÊÛÃÊÌ >ÌÊiÝÃÌÃÊ>}ÊÃÃi LiÃÊvÊ`ÊVÃÌÌÕiÌÃ°Ê ÕÀV iÃÊ>`Ê`Û`Õ>ÃÊ«>ÀÌV«>Ì}ÊÊÌ iÃiÊ«À}À>ÃÊ«ÀÛ`iÊ>Ê VÌÕ>ÊÃÕÀViÊvÊ«À>ÞiÀÊ>`Êw>V>ÊÃÕ««ÀÌ]ÊvÕÀÌ iÀÊ>`Û>V}ÊÌ iÊV>ÕÃiÊvÊÃÃðÊ/ iÊ «À}À>ÃÊ>ÀiÊ-i`iÀÃÊÕ`Ê>`ÊÊ,iiv° / iÊ i`>Ê`Û>ViiÌÊ>Ài>ÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÀi}Õ>ÀÞÊ>««i>ÃÊÌÊ V ÕÀV iÃÊ>`Ê`Û`Õ>ÃÊvÀÊÌ ÞÊVÌiÌÊ>`ÊëiV>ÊvviÀ}ÃÊvÀÊÌ iÃiÊ«À}À>ð -i`iÀÃÊÕ` "vviÀ}ÃÊÌÊ-i`iÀÃÊÕ`Ê>ÀiÊÕÃi`ÊÌÊ>ÃÃÃÌÊwÀÃÌÌiÀÊÃÃ>ÀÞÊV>``>ÌiÃÊÜ Ê>ÀiÊ >Û}Ê `vwVÕÌÞÊÀ>Ã}ÊÌ iÀÊiViÃÃ>ÀÞÊÃÕ««ÀÌÊÀÊÜ Ê>ÞÊLiÊii`i`ÊÊÌ iÊwi`ÊÀiʵÕVÞ°Ê ÃÌÊV>``>ÌiÊÃÃ>ÀiÃÊLi}ÊÌiÀ>ÌÊÜÌ ÊÌ iÀÊÃÕ««ÀÌÊ>VVÕÌÊÊÛiÀ`À>vÌÊ`ÕiÊ ÌÊÌÀ>ÛiÊiÝ«iÃiÃÊÌÊ-«À}wi`]Ê ÃÃÕÀ]ÊvÀÊÌiÀÛiÜÃ]Ê >``>ÌiÊ-V Ê>`Ê-V ÊvÊ ÃÃÃ]Ê>`ÊÌ iÊVÃÌÊvÊi`V>ÊiÝ>>ÌÃÊ>`ÊÌ iÀÊÌ>ÊiÝ«iÃiðÊÕ`ÃÊÀ>Ãi`Ê`ÕÀ }Ê>ÊV>``>Ìi½ÃÊwÀÃÌÊviÜÊÌ ÃÊvÊÌiÀ>ÌÊ>ÞÊÃiÀÛiÊÞÊÌÊVi>ÀÊÌ iÊÛiÀ`À>vÌÊÊ ÃÊÀÊ iÀÊ>VVÕÌ°ÊÌÊÌ >ÌÊ«ÌÊÌ iÊV>``>ÌiÊV>Ê>VVÀÕiÊV>à Ê>`Ê«i`}iÃÊÌÜ>À`Ê}>}ÊVi>À >ViÊvÀÊÌ iÊwi`° -iÊV>``>ÌiÊÃÃ>ÀiÃÊ>ÞÊii`ÊÌÊ}iÌÊÌÊÌ iÊwi`ÊÃiÀÊÌ >ÊÌ iÊ>ÛiÀ>}iÊÌiÀ>ÌÊ ÌiÊvÊ£xÊÌ ÃÊ`ÕiÊÌÊÃiÀÕÃÊii`ÃÊvÀÊÃÃ>ÀÞÊ«iÀÃiÊÌÊwÊÛ>V>ViÃÊVÀi>Ìi`ÊLÞÊ ÀiÌÀiiÌ]ÊÌÀ>ÃviÀÊÀÊiiÀ}iVÞÊii`ÃÊÊÌ iÊwi`° Ê,iiv / iÊvÕÀÌ Ê«>ÀÊÊÜ V ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÃÊLÕÌÊÃÊ/ÕV }ÊpÊÃ Ü }ÊV«>ÃÃÊvÀÊÃÕvviÀ}Ê«i«iÊÊ>Ê>iÀÊÀi«ÀiÃiÌ}ÊÌ iÊÛiÊvÊiÃÕÃÊ ÀÃÌ° 7 iÊ>Ê`Ã>ÃÌiÀÊVVÕÀÃ]ÊÊ,iivÊvÕ`ÃÊ>ÀiÊ`ÃLÕÀÃi`ÊÌÊÌ iÊwi`]ÊÕ«Ê>««ÀÛ>ÊLÞÊÌ iÊ VÀÀië`}ÊÀi}>Ê`ÀiVÌÀ°Ê"ViÊÌ iÊvÕ`ÃÊ>ÀiÊ`ÃLÕÀÃi`ÊÌÊÌ iÊwi`]ÊÌ iÊ>Ài>Ê`ÀiVÌÀÊ iÃÕÀiÃÊÌ >ÌÊÌ iÞÊ>ÀiÊÕÃi`ÊivviVÌÛiÞÊÌÊ«ÀÛ`iÊ>ÃÃÃÌ>ViÊvÀÊÃÕvviÀ}Ê«i«i° vÊvÕ`ÃÊ>ÀiÊ>Û>>LiÊÊÌ iÊÊ,iivÊ>VVÕÌ]ÊÌ iÞÊV>ÊLiÊ`ÃLÕÀÃi`Êi`>ÌiÞ°ÊvÊvÕ`ÃÊ >ÀiÊÌÊ>Û>>Li]Ê>Ê>««i>ÊÃÊ>`iÊÌÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊ>`Ê`Û`Õ>ÃÊÌÊÃi`Ê VÌÀLÕÌÃÊÌÊ i«ÊiiÌÊÌ iÊii`° / ÀÕ} ÊÌ ÃÊ`iÃÌÀ>ÌÊvÊÌ iÊV«>ÃÃÊ>`ÊÛiÊvÊiÃÕÃÊ ÀÃÌ]ÊÃÃiLiÃÊvÊ`Ê ÃÃ>ÀiÃÊ >ÛiÊÃiiÊ>ÞÊ«i«iÊ>VVi«ÌÊ ÀÃÌÊ>ÃÊ->ÛÀ°ÊÊÃiÊ>ÌÃÊÌ iÃiÊÀiivÊivvÀÌÃÊ >ÛiÊyÕiVi`Ê}ÛiÀiÌÊi>`iÀÃÊ>`ÊLÀÕ} ÌÊ>LÕÌÊÀiÊ««ÀÌÕÌiÃÊvÀÊÃÃiLiÃÊvÊ `ÊÕÌÀi>V ° ÃÃiLiÃÊ"vÊ`ÊÕ`>Ì ÃÊ>Ê«>ÀÌiÀÊÊÃÌÀÞÊÜÌ ÊÃÃiLiÃÊ"vÊ`Ê7À`Ê ÃÃÃ]ÊÌ iÊÃÃiLiÃÊvÊ`Ê Õ`>ÌÊÃiÀÛiÃÊÌÊ i«ÊLÕ`ÊÃÃ>ÀÞÊÃÕ««ÀÌÊÌ ÀÕ} ÊÌ iÊÕÃiÊvÊLLV>ÊÃÌiÜ>À`à «Ê «>ÃÊ>`Ê«À}À>ð xx Ê£ÎÊÌ iÊÃÃiLiÃÊvÊ`ÊÕ`>Ì]ÊV°]ÊÜ>ÃÊvÀi`]ÊVL}ÊÌ iÊvÀiÀÊ i viÀÀi`ÊÛ}Ê>`Ê/ÀÕÃÌÃÊ>`Ê-ÌiÜ>À`à «Ê i«>ÀÌiÌÃÊvÊÌ iÊiiÀ>Ê ÕVÊvÊÌ iÊÊ ÃÃiLiÃÊvÊ`° / iÊÃÃÊvÊÌ iÊÕ`>ÌÊÃÊÌÊiiÌÊÌ iÊÃÌiÜ>À`à «]ÊiÃÌ>ÌiÊ«>}Ê>`Ê«>i`Ê }Û}Êii`ÃÊvÊÌ iÊiÜà «Ê>`Ê i«ÊÃÃiLiÃÊvÊ`ÊÃÌÀiÃÊ`iÛi«ÊÌ iÀÊw>V>Ê ÀiÃÕÀViðÊ/Ê>VV«Ã ÊÌ Ã]ÊÌ iÊÕ`>ÌÊ>iÃÊiÃÌ>ÌiÊ«>}Ê>`Ê«>i`Ê}Û}ÊÃiÀ ÛViÃÊ>Û>>LiÊÌ ÀÕ} ÊÌ iÊ1wi`Ê-ÌiÜ>À`à «Ê*À}À>° *>i`ÊÛ} "«ÌÃÊ/ >ÌÊ*ÀÛ`iÊ iÞÊÀÊ ÃÃÃÊ`Ê ÃÌÀià / iÊÕ`>ÌÊ«ÀÛ`iÃÊ«ÀviÃÃ>ÊVÕÃiÊÊÛÌ>Ê>Ài>ÃÊvÊ«iÀÃ>ÊÃÌiÜ>À`à «ÊÌ ÀÕ} Ê }ÀÕ«ÊÃiÃÃÃÊ>`Ê«iÀÃ>ÊÌiÀÛiÜðÊÊÌ iʺ iÞÃÊÌÊ/ÀÀܻʫiÀÃ>ÊÃÌiÜ>À`à «Ê «>}ÊÃi>ÀÃÊ>`ÊÌiÀÛiÜÊÃiÃÃÃ]ÊVÃÌÌÕiÌÃÊi>ÀÊ ÜÊÌÊVÀi>ÃiÊÌ iÀÊVÕÀÀiÌÊ ViÊÀiÌÕÀÊÜ iÊ>ÃÊVÀi>Ã}ÊÌ iÀÊ}vÌÊ«ÌiÌ>]ÊÀi`ÕViÊ«ÀL>ÌiÊ>`Ê>`ÃÌÀ>ÌÊVÃÌÃ]Ê >`Ê«>Ê}vÌÃÊÌÊÌ>iÊ>`Û>Ì>}iÊvÊÌ>ÝÊ`i`ÕVÌð `Û`Õ>ÃÊV>ÊVÕ`iÊ}vÌÃÊÌÊÜÀ`ÊÃÃÃÊÌ ÀÕ} ÊÕÌÀÕÃÌÃÊ>`Ê>ÕÌÞÊÌÀÕÃÌÃ]ÊÀiÛ V>LiÊ>`ÊÀÀiÛV>LiÊÛ}ÊÌÀÕÃÌÃ]Ê}vÌÊ>ÕÌiÃÊ>`Ê`iviÀÀi`Ê«>ÞiÌÊ}vÌÊ>ÕÌiÃ]Ê«i`Ê ViÊvÕ`Ã]Ê}vÌÃÊvÊÀi>`iÀÊÌiÀiÃÌÃ]Êi`ÜiÌÃ]ÊÜÃ]Ê>`ÊÌ iÀÊi`>ÌiÊ>`Ê`i viÀÀi`Ê}vÌÊ«>ð ÕÀV iÃÊ>`ÊÃÌÀiÃÊëÃÀʺ iÞÃÊÌÊ/ÀÀÜ»ÊÃi>ÀÃÊÌÊ«ÀÛ`iÊVÃÌÌÕiÌÃÊÌ iÊ ««ÀÌÕÌÞÊÌÊ >ÛiÊ«iÀÃ>ÊÌiÀÛiÜÊÃiÃÃÃÊÜÌ ÊÕ`>ÌÊÀi«ÀiÃiÌ>ÌÛiÃÊÌÊ`ÃVÕÃÃÊ Ì iÀÊëiVwVÊiÃÌ>ÌiÊ«>}Êii`ð ÀÊÀiÊvÀ>ÌÊ>Û>>LiÊÌ ÀÕ} ÊÌ iÊÕ`>Ì]ÊÀiµÕiÃÌÊ>ÊÃ>«iÊvÊÌ iÊ*iÀÃ>Ê -ÌiÜ>À`à «Ê*>}Ê*>ViÌÊLÞÊÜÀÌ}ÊÌÊÃÃiLiÃÊvÊ`ÊÕ`>Ì]Ê£ÈääÊ °Ê ÛiÊ ÛiÕi]Ê-«À}wi`]Ê "ÊÈxnäÎ]ÊÀÊV>Ê{£Ç®ÊnÈx{nnä° xÈ 0!24 4HE 2OLE OF $ISTRICT 7ORLD -ISSIONS 0ERSONNEL ÃÌÀVÌÊ7À`Ê ÃÃÃÊ ÀiVÌÀ / iÊ`ÃÌÀVÌÊÃÃÃÊ`ÀiVÌÀÊ ®Ê>ÞÊLiÊiiVÌi`ÊÀÊ>««Ìi`]Ê>VVÀ`}ÊÌÊÌ iÊ«VÞÊ vÊÌ iÊ`ÃÌÀVÌ°ÊIÊÀiµÕiÌÞ]ÊÌ iÊÃÃÃÊ`ÀiVÌÀÊÃÊ}ÛiÊ>Ê`Õ>Ê«ÀÌv]ÊVÕ`}ÊÀiëà LÌÞÊvÀÊLÌ ÊÜÀ`Ê>`Ê1°Ê-°ÊÃÃÃÊ>VÌÛÌiÃÊÜÌ ÊÌ iÊ`ÃÌÀVÌ° ,iëÃLÌiÃÊvÊÌ iÊ ÊVÕ`iÊÌ iÃi\ £°ÊÊ-iÀÛ}Ê>ÃÊ>ÃÊLiÌÜiiÊÌ iÊ`ÃÌÀVÌÊ>`ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃðÊÊÌ ÃÊ V>«>VÌÞÊ iÊÀÊà iÊÜÊ>ÌÌi`Ê>Ì>Ê>`ÊÀi}>ÊiiÌ}ÃÊi>V ÊÞi>À° Ó°ÊÊ-iÀÛ}Ê>ÃÊV >À>ÊvÊÌ iÊ`ÃÌÀVÌÊÃÃÃÊVÌÌii°Ê/ ÃÊVÌÌiiÊÀiViÛiÃÊ>`Ê ÀiÛiÜÃÊ>««V>ÌÃÊ>`ÊÌiÀÛiÜÃÊ«ÀëiVÌÛiÊV>``>ÌiÊÃÃ>Àið Î°Ê À`>Ì}Ê>`Ê«iiÌ}ÊÃÃÃÊ>VÌÛÌiÃÊ>Ì >°Ê ÃÌÀVÌÊÃV ÃÊvÊÃÃà L°Ê ÃÌÀVÌÊVÕVà V°Ê ÃÌÀVÌÉÃiVÌ>ÊÃÃÃÊÌÕÀÃÊ `°Ê ÃÌiÀÃÊÀiÌÀi>Ìà i°Ê >«Ã {°ÊÊ-iÌÌ}ÊÕ«ÊÃÃ>ÀÞÊÌiÀ>ÀiðÊ/ iÊ ÊÜÀÃÊVÃiÞÊÜÌ ÊÃiVÌ>ÊÃÃÃÊ Ài«ÀiÃiÌ>ÌÛiÃÊÌÊ>VV«Ã ÊÌ Ã°Ê6ÃÌ}ÊÃÃ>ÀiÃÊvÀÊÌ iÀÊ`ÃÌÀVÌÃÊà Õ`Ê Vi>ÀÊÌ iÀÊÌiÀ>ÀiÃÊÌ ÀÕ} ÊÌ iÊ °Ê/ ÃÊVÀ`>ÌÊ>`ÊÀÌ>ÌÊvÊÌiÀ>ÌÊ >VÌÛÌÞÊ i«ÃÊ}ÛiÊÃÃ>ÀiÃÊiµÕ>ÊÌiÀ>ÌÊÌi° x°ÊÊ ÌÀ}ÊÌ iÊÌiÀ>ÌÊ>VÌÛÌiÃÊvÊÃÃ>ÀiÃ]ÊVÕ`}ÊÌ iÀÊ>ÀÀÛ>Ê>`Ê«À iVÌi`Ê`i«>ÀÌÕÀiÊ`>ÌiðÊ/ iÊ ÊV>Ê«ÀÛ`iÊvÀ>ÌÊÀi}>À`}Ê>ÊÃÃ>ÀÞ½ÃÊ ÃV i`ÕiÊ>`ÉÀÊw>V>Êii`ðÊ1«Ê>ÊÃÃ>ÀÞ½ÃÊV >}iÊvÊÃÌ>ÌÕÃÊÀÊÀiÌÀiiÌ]Ê Ì iÊ ÊÃi`ÃÊ>ÊiÌÌiÀÊÌÊ`ÀÊV ÕÀV iÃÊvÀ}ÊÌ iÊvÊÌ ÃÊV >}iÊ>`ÊVÕ` }ÊÀiVi`>ÌÃÊvÊ ÜÊÌ iÞÊV>ÊÀi`ÀiVÌÊÌ iÀÊÃÕ««ÀÌ°Ê/ ÃÊiÌÌiÀÊvÜÃÊ>Ê VÕV>ÌÊÃiÌÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃð È°ÊÊ*ÀÛ`}ÊÃÃÃÊi`ÕV>ÌÊ>ÌiÀ>ÃÊ>`ÊvÀ>ÌÊÌÊÃiVÌ>ÊÃÃÃÊÀi«Ài ÃiÌ>ÌÛiÃÊ>`ÊV>ÊV ÕÀV ið Ç°Ê-iÀÛ}Ê>ÃÊ>Êëi>iÀÊ`ÕÀ}ÊÃÃÃÊÃiÀÛViÃÊÀÊVÛiÌð n°Ê-ÕLÌÌ}ÊÃÃÃÊvÀ>ÌÊÌÊÌ iÊ`ÃÌÀVÌÊiÜÃiÌÌiÀ° I ÃÌÀVÌÊ«ViÃÊÛ>ÀÞ°Ê Ì>VÌÊÞÕÀÊ`ÃÌÀVÌÊvwViÊÌÊi>ÀÊÜ >ÌÊÌ iÊ«VÞÊð ÃÌÀVÌÊ ÃÃÃÊ ÌÌii / iÊ ÊV >ÀÃÊÌ iÊ`ÃÌÀVÌÊÃÃÃÊVÌÌii°Ê iLiÀÃÊvÊÌ iÊVÌÌiiÊ>ÞÊVÕ`iÊ Ì iÀÊ`ÃÌÀVÌÊ«iÀÃi]ÊÃiVÌ>ÊÜÀ`ÊÃÃÃÊÀi«ÀiÃiÌ>ÌÛiÃ]Ê«>ÃÌÀÃÊ>`Ê>ÌÞ° / iÊÀiÊvÊÌ iÊ`ÃÌÀVÌÊÃÃÃÊVÌÌiiÊÃÊÌÊ«ÀÛ`iÊÃiVÌ>ÊÜÀ`ÊÃÃÃÊÀi«ÀiÃi Ì>ÌÛiÃÊ>`ÊV>ÊV ÕÀV iÃÊÜÌ ÊvÀ>Ì]Ê}Õ`>ViÊ>`Ê i«ÊÊ«>}]Ê«ÀÌ}Ê>`Ê ÃÕ««ÀÌ}ÊÜÀ`ÊÃÃÃÊÃÌÀið xÇ ÊÃiÊ`ÃÌÀVÌÃ]ÊÌ iÊVÌÌiiÊ ÃÌÃÊ`ÃÌÀVÌÜ`iÊÜÀ`ÊÃÃÃÊÌÕÀÃÊÀÊÃÃÃÊV ÛiÌðÊ/ iÊVÌÌiiÊ>ÞÊLiÊÀiëÃLiÊvÀÊ>««ÀÛ}ÊV>``>ÌiÃÊvÀÊÌ iÊ`ÃÌÀVÌÊÜ Ê >ÛiÊ>`iÊ>««V>ÌÊÌÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊvÀÊÃÃ>ÀÞÊ>««ÌiÌ° -iVÌ>Ê7À`Ê ÃÃÃÊ,i«ÀiÃiÌ>ÌÛi / iÊÃiVÌ>ÊÜÀ`ÊÃÃÃÊÀi«ÀiÃiÌ>ÌÛiÊÃÊ>ÊiÞÊÊÊÜÀ`ÊiÛ>}iÃ]Ê>VÌ}Ê>ÃÊ> ÃÊLiÌÜiiÊÌ iÊ ]ÊÌ iÊÃÃ>ÀÞÊ>`ÊÌ iÊV>ÊV ÕÀV ° / ÃÊ«ÃÌÊ>ÞÊLiÊ i`ÊLÞÊ>Ê«>ÃÌÀÊÀÊ>««ÀÛi`ÊÃÌiÀÊÊÌ iÊÃiVÌ°Ê/ iÊÀi«ÀiÃiÌ> ÌÛi½ÃÊ`ÕÌiÃÊVÕ`iÊÌ iÃi\ £°ÊÊÃÃÃÌ}ÊÌ iÊ ]ÊÜ iÊV>i`ÊÕ«]ÊÌÊÃiVÕÀiÊvÀ>ÌÊÀÊÃV i`ÕiÊÃÃ>ÀÞÊ ÃiÀÛViÃÊÊÌ iÊÃiVÌ° Ó°ÊÃÃÃÌ}Ê>`Ê«ÀÌ}Ê>ÊÃiVÌ>ÊÜÀ`ÊÃÃÃÊvÕVÌð ΰÊÊÃÃÃÌ}ÊV>ÊV ÕÀV iÃÊÜÌ ÊÌ iÊÃiVÌÊÜÌ ÊÃÃÃÊVÌÌiiÊ>VÌÛÌiÃ]ÊL> µÕiÌÃ]ÊÃiÀÛViÃÊ>`Êëi>iÀÃÊ>ÃÊii`i`° {°ÊÊVÌ}Ê>ÃÊ>ÊÜÀ`ÊÃÃÃÊÀiÃÕÀViÊ«iÀÃÊvÀÊÌ iÊÃiV̽ÃÊV ÕÀV iÃÊÀi}>À`}Ê>ÌiÀ >ÃÊ>`ÊÃÕ««iÃÊvviÀi`ÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃð x°ÊÊÌÌi`}Ê`ÃÌÀVÌÊÃÃÃÊ>VÌÛÌiÃÊÃÕV Ê>ÃÊ`ÃÌÀVÌÊVÕVÃ]ÊL>µÕiÌÃ]ÊÜÀà «ÃÊÀÊ iiÌ}ÃÊvÊÃiVÌ>ÊÜÀ`ÊÃÃÃÊÀi«ÀiÃiÌ>ÌÛiÃÊV>i`ÊLÞÊÌ iÊ ° È°Ê ÝiÀVÃ}ÊÌ>ÌÛiÊÊÀ>Ã}ÊÜÀ`ÊiÛ>}iÃÊVÃVÕÃiÃÃÊÊÌ iÊÃiVÌ°Ê Ç°ÊÊ,i`}Ê«>ÃÌÀÃÊvÊÌ iÊÃiVÌÊ>`ÊÃÃ>ÀiÃÊÌiÀ>Ì}ÊÊÌ iÊÃiVÌÊvÊ`ÃÌÀVÌÊ «ViÃÊ>`Ê«ÀVi`ÕÀiÃÊÌ >ÌÊÀi>ÌiÊÌÊÌ i° n°Ê*ÀÌ}ÊÃÃÃÊVÛiÌÃÊÊV>ÊV ÕÀV ið xn 0!24 ! (ISTORY OF !SSEMBLIES OF 'OD 7ORLD -ISSIONS ÞÊÞViÊ7iÃÊ âi iÊÛiÊvÊ`½ÃÊ-«ÀÌÊÌ >ÌÊÃÜi«ÌÊÌ ÀÕ} ÊiÀV>Ê>ÌÊÌ iÊLi}}ÊvÊÌ iÊÓäÌ ÊViÌÕÀÞÊ /LÀÕ} ÌÊ>ÊVÀi>Ãi`ÊÃÃÃÊÌiÀiÃÌ°Ê/ iÊ«ÀÃiÊvÊiÃÕýÊÃÊÀiÌÕÀÊÜ>ÃÊLÕÀi`ÊÌÊ i½ÃÊ i>ÀÌÃÊLÞÊÌ iÊÞÊ-«ÀÌ°Ê/ iÞÊÜiÀiÊwi`ÊÜÌ Ê>ÊÕÀ}iVÞÊÌÊÌ>iÊÌ iÊiÃÃ>}iÊvÊÃ>Û> ÌÊÌÊÌ iÊÃÌÊÜ iÊÌ iÀiÊÜ>ÃÊÃÌÊÌiÊvÀÊÀi«iÌ>ViÊ>`ÊVÛiÀð Ê>Õ>ÀÞÊ£ä£ÊÊ/«i>]Ê >Ã>Ã]ÊÌ iÊ`iÀÊ*iÌiVÃÌ>ÊÛiiÌÊLi}>°Ê >ÞÊ LiÊ ÃV ÊÃÌÕ`iÌÃÊÜiÀiÊL>«Ìâi`ÊÊÌ iÊÞÊ-«ÀÌÊ>`ÊëiÊÊÌ iÀÊÌ}ÕiÃÊ>ÃÊÌ iÊwÀÃÌÊ Àà Ì>ÃÊ``ÊÊÌ iÊ >ÞÊvÊ*iÌiVÃÌ°Ê/ ÃÊÛiiÌÊvÊÌ iÊÞÊ-«ÀÌÊÜ>ÃÊ>ÊÀiÛÛ>ÊvÊÌ iÊ`V ÌÀiÃ]ÊÀi}ÕÃÊiÝ«iÀiViÃ]Ê«À>VÌViÃÊ>`Ê«ÀÀÌiÃÊvÊÌ iÊi>ÀÞÊ>«ÃÌVÊV ÕÀV ° ÀÊÌ iÊLi}}ÊÌ iÊ*iÌiVÃÌ>ÊÛiiÌÊLÀÕ} ÌÊ>Ê`ii«ÊLÕÀ`iÊvÀÊÜÀ`ÊiÛ> }iâ>Ì°Ê/ iÊV>`ÊvÊiÃÕÃÊÊ >ÌÌ iÜÊÓn\£nÓäÊ>`Ê >ÀÊ£È\£x£nÊLiV>iÊ>Ê «iÀ>ÌÛiÊV>° 7 iÊÌ iÊiiÀ>Ê ÕVÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÜ>ÃÊvÕ`i`ÊÊ££{]ÊÌ iÊÃÌÊvÊÀiV }âi`ÊÃÌiÀÃÊVÌ>i`ÊÌ iÊ>iÃÊvÊÎÓÊÃÃ>ÀiðÊ-iÊÜiÀiÊ«ÀiÃiÌÊÊÌ iÊiiÌ}Ã]Ê >`ÊÃiÊ >`ÊÜÀÌÌiÊvÀÊÌ iÊwi`Ê>Ã}ÊÌÊLiÊVÕ`i`ÊÊ>ÞÊÀÊvÊiLiÀà «° / iÊiÜÞÊvÀi`ÊiiÀ>Ê ÕVÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÜ>ÃÊÌiÃiÞÊÃÃ>ÀÞ°ÊÌÊ Ì >ÌÊ ÕV]ÊÌ ÃiÊ«ÀiÃiÌÊV ÃiÊ>ÊÃÃ>ÀÞÊ«ÀiÃLÞÌiÀÞÊVÃÃÌ}ÊvÊ£ÓÊi`iÀÃÊÌʺÃiÀÛiÊÕÀÊ vÀi}ÊÃÃ>Àið» ÃÌÊvÊÌ iÊi>ÀÞÊÃÃ>ÀiÃÊÜiÌÊÕÌÊ>ÌÊ}Ài>ÌÊ«iÀÃ>ÊÃ>VÀwVi°Ê1ÃÕ>ÞÊÌ iÞÊ >`ÊÌÌiÊ ÀiÊÌ >Ê>ÊÃÕÌV>ÃiÊvÀÊiµÕ«iÌÊ>`ÊÊ}Õ>À>Ìii`ÊiÌ `ÊvÊÃÕ««ÀÌ° / iÊ >ÀÞÊ9i>Àà >ÀÞÊÊÌ iÊÓäÌ ÊViÌÕÀÞ]Ê >Ê>`Ê`>ÊÜiÀiÊÌ iÊVÕÌÀiÃÊvÊ}Ài>ÌiÃÌÊÃÃ>ÀÞÊi« > ÃðÊ*iÀ >«ÃÊÌ iÀÊ Õ}iÊ««Õ>ÌÃÊÃiii`ÊÌÊ«ÀiÃiÌÊÌ iÊÃÌÊÕÀ}iÌÊii`Ã°Ê ÕÌÊÃÃ>ÀiÃÊ >ÃÊÜiÌÊÌÊ iÌÀ>Ê>`Ê-ÕÌ ÊiÀV>]ÊvÀV>]ÊÌ iÊ ``iÊ >ÃÌÊ>`ÊÌÊÃiÊ>Ài>ÃÊvÊÃ>° -VÀiÃÊvÊÌ iÃiÊ«iiÀÊÃÃ>ÀiÃÊÌiÀ>ÞÊ}>ÛiÊÕ«ÊiÛiÀÞÌ }°Ê >ÞÊÜiÌ]ÊÌÀÕÃÌ}Ê`Ê vÀÊÌ iÀÊÃÕ««ÀÌ°Ê"Ì iÀÃÊ`i«i`i`ÊÊÌ iÀÊ iÊV ÕÀV iÃ]Êv>iÃÊ>`ÊvÀi`ÃÊvÀÊ i«°Ê -Õ««ÀÌÊÜ>ÃÊvÌiÊiÀÀ>ÌV]Ê>`ÊÃiÊÜiÀiÊvÀVi`ÊÌÊViÊ i°Ê"ÞÊ>ÊÃÌÀ}ÊÌÀÕÃÌÊÊ`Ê i>Li`Ê>ÞÊÌ iÀÃÊÌÊÃÌ>ÞÊÊÌ iÊwi`° ÌÊÌ iÊÃiV`ÊiiÀ>Ê ÕV]ÊV`ÕVÌi`ÊÊ V>}ÊÊ ÛiLiÀÊ££{]ÊÌ iÊÛÃÊvÀÊ ÃÃiLiÃÊvÊ`ÊÃÃÃÊÜ>ÃÊV>ÃÌÊÜ iÊÌ iÊ`ii}>ÌiÃÊÕ>ÕÃÞÊ>««ÀÛi`Ê>ÊÀiÃÕÌ]Ê Ü V ÊÃ>`ÊÊ«>ÀÌ]ʺ7iÊVÌÊÕÀÃiÛiÃÊ>`ÊÌ iÊÛiiÌÊÌÊÊvÀÊÌ iÊ}Ài>ÌiÃÌÊiÛ>}i ÃÊÌ iÊÜÀ`Ê >ÃÊiÛiÀÊÃii°» ÌÊÌ iÊiiÀ>Ê ÕVÊÊ££È]ÊÀiÊiÊ>`ÊÜiÊÜiÀiÊ>``i`ÊÌÊÌ iÊÃÃ>ÀÞÊÀÃÌiÀ°Ê ÕÀ}ÊÌ >ÌÊÞi>ÀÊi>ÀÞÊfx]äääÊÜ>ÃÊÀiViÛi`ÊLÞÊÌ iÊÃÃiLiÃÊvÊ`Ê i>`µÕ>ÀÌiÀÃÊÌÊÃÕ« «ÀÌÊÜÀ`ÊÃÃÃ°Ê ÞÊÌ iÊ££Ê ÕV]ÊÃÃ>ÀÞÊ}Û}Ê >`ÊÀi>V i`ÊfÈÎ]äää°ÊÊÃÌiÀÊ «ÀiÃiÌÊ>ÌÊÌ >ÌÊ ÕVÊÜÀÌi]ʺ7 iÊ Ì iÃiÊw}ÕÀiÃÊÜiÀiÊÀi>`]ÊÌ iÊiÌÀiÊ>Õ`iViÊÀÃiÊÌÊ«À>ÃiÊ`ÊvÀÊÃÊ}À>VÕÃÊ«ÀÛð»Ê ÌÊÌ iÊÃiÛiÌ Ê ÕVÊÊ££]ÊÌ iÊÃÃiLiÃÊvÊ`ÊÛÌi`ÊÌÊiÃÌ>Là Ê>ÊÃÃÃÊ`i«>ÀÌ iÌÊÌÊ`ÀiVÌÊ>`ÊVÀ`>ÌiÊ>ÊÃÃ>ÀÞÊÌiÀiÃÌÃÊvÊÌ iÊiiÀ>Ê ÕV°Ê°,°ÊÜiÀÊÜ>ÃÊ ÃiiVÌi`Ê>ÃÊÌ iÊwÀÃÌÊÃiVÀiÌ>ÀÞÊ>`ÊÌÀi>ÃÕÀiÀÊvÀÊÌ ÃÊiÜÊ`i«>ÀÌiÌ° x / iÊ£ÓäÃÊ>`Ê£Îäà ÕÀ}ÊÌ iÊ£ÓäÃÊÌ iÊÀiÛÛ>ÊÌ >ÌÊ >`ÊLÀÕ} ÌÊÌ iÊÃÃiLiÃÊvÊ`ÊÌÊLi}ÊVÌÕi`Ê ÌÊëÀi>`Ê>ÀÕ`ÊÌ iÊÜÀ`°Ê ÞÊ£Ó£ÊÌ ÃÊÇÞi>À`Ê}ÀÕ«Ê >`Ê>ÊÌÌ>ÊvÊÓÎäÊÃÃ>ÀiÃÊ ÃiÀÛ}ÊÕ`iÀÊ>««ÌiÌ°ÊÕÀÌ iÀÀi]ÊÌ iÊi>`iÀÃÊvÊÌ iÊ}ÀÕ«ÊiÛÃi`Ê>ʺÜÀ`Ü`iÊ viÜà «ÊvÊ*iÌiVÃÌ>ÊLiiÛiÀûÊ>`ÊÛÌi`ÊÊÌ iÀÊ£Ó£Ê ÕVÊÌÊ>`«ÌÊÃÌi«ÃÊÌÜ>À`Ê Ì ÃÊ}>° ÀÊÌ iÊÌiÊÌ iÊÃÃiLiÃÊvÊ`ÊÜ>ÃÊvÀi`ÊÕÌÊ£Óx]Ê°Ê,°ÊÜiÀÊÜ>ÃÊÊÌ iÊvÀi vÀÌÊvÊÌ iÊ`i>̽ÃÊÃÃ>ÀÞÊivvÀÌ°ÊÃÊ ÀÃÌ>Ê Û>}iÊÜÊ/`>Þ½ÃÊ*iÌiVÃÌ>Ê Û>}i®ÊÜ>ÃÊiÊvÊÌ iÊ«>«iÀÃÊÌ >ÌÊÃÃÕi`ÊÌ iÊV>ÊÌÊ*iÌiVÃÌ>ÃÊÌÊ>ÌÌi`ÊÌ iÊÀ}>â>Ì>Ê iiÌ}ÊÊ££{° ÀÌ iÀÊÜiÀÊÜ>ÃÊv>ÀÃ} Ìi`ÊÊ ÃÊi>`iÀà «°ÊiÊÜ>ÃÊ>Êi>ÀÞÊ>`ÛV>ÌiÊvÊÌÀ>}Ê> Ì>ÃÊ>`ÊiÃÌ>Là }Ê`}iÕÃÊV ÕÀV iÃÊ>LÀ>`°ÊiÊ>ÃÊÃÌÀiÃÃi`ÊÌ iÊVVi«ÌÊÌ >ÌÊà Ã>ÀiÃÊà Õ`Ê}ÛiÊ«ÀÀÌÞÊÌÊ«Ài>V }ÊÌ iÊ}ëi° / ÃÊVÌÕi`Êi« >ÃÃÊÊiÛ>}iÃÊ>`ÊV ÕÀV Ê«>Ì}ÊÃÊiÊvÊÌ iÊÀi>ÃÃÊÌ iÊà ÃiLiÃÊvÊ`ÊÛiÀÃi>ÃÊV ÕÀV ÊiÝ«iÀiViÃÊÃÕLÃÌ>Ì>Ê}ÀÜÌ °Ê-iÊÌ iÀÊiÛ>}iV>Ê }ÀÕ«ÃÊÜ ÃiÊÃÃ>ÀÞÊvÀViÃÊ>ÀiÊÕV Ê>À}iÀÊÌ >ÊÕÀÃÊ >ÛiÊÃ>iÀÊ}ÀÜÌ ÊÀ>ÌiðÊ/ iÊ VÕÀÃiÊÃiÌÊLÞÊÕÀÊi>ÀÞÊi>`iÀÃÊ >ÃÊ«ÀÛiÊÌÊLiÊ>ÊivviVÌÛiÊÃÌÀ>Ìi}ÞÊvÀÊÜÀ`ÊiÛ>}iâ>Ì° /Ê`iÛi«Ê`}iÕÃÊ>Ì>ÊV ÕÀV iÃ]Ê«iiÀÃÊvÊÃÃÃÊÀiV}âi`ÊÌ iÊii`ÊvÀÊ ÌÀ>i`Êi>`iÀà «°Ê ÞÊÌ iÊ`£ÓäÃÊÌ iÞÊ >`ÊiÃÌ>Là i`Ê LiÊÃV ÃÊÊ >]Ê`>]Ê >«>]Ê }Þ«ÌÊ>`Ê LiÀ>°Ê/ ÃÊi« >ÃÃÊÊÌÀ>}Ê>Ì>ÃÊ >ÃÊVÌÕi`°ÊÀÊÌ iÊ>ÃÌÊviÜÊ `iV>`iÃÊÌ iÊÃÃiLiÃÊvÊ`Ê >ÃÊLiiÊÌ iÊi>`iÀÊ>}Ê>ÊiÛ>}iV>ÊÃÃÃÊÊÌ iÊÕ LiÀÊvÊÛiÀÃi>ÃÊ LiÊÃV ð Ê£Ó£Ê ÀÌ iÀÊÜiÀÊ>ÃÊ«À«Ãi`ÊÌÊiÃÌ>Là Ê>ÊLÕ`}iÌÊvÀÊi>V ÊÃÃ>ÀÞ°Ê/ ÃÊÜÕ`Ê >iÊ>ÊÀiÊiµÕÌ>LiÊ`ÛÃÊvÊvÕ`ÃÊ>`Ê>ÃÃÕÀiÊÌ >ÌÊi>V ÊÃÃ>ÀÞ½ÃÊL>ÃVÊii`ÃÊÜiÀiÊ iÌ°ÊÌÊÌ >ÌÊÌiÊÌÊÜ>ÃÊ`iV`i`ÊÌ >ÌÊf{äÊ>ÊÌ ÊÜ>ÃÊii`i`ÊÌÊÃÕ««ÀÌÊi>V ÊÃÃ>ÀÞ]Ê «ÕÃÊfÓäÊvÀÊi>V ÊÃÃ>ÀÞÊV `°Ê ÕÀ}ÊÌ ÃÊÌiÊÃÃ>ÀiÃÊ``ÊÌÊ>ÛiÀ>}iÊÀiViÛ}Ê f{äÊ>ÊÌ ]ÊLÕÌÊÃi ÜÊ`ÊiÌÊÌ iÀÊii`ð / iÊ«iÀ`ÊvÊ£Óx£ÓÊLÀÕ} ÌÊÃiÛiÀ>ÊV >}iÃÊÊi>`iÀà «°ÊÊ£ÓxÊ7° °Ê>ÕÝÊÜ>ÃÊ >««Ìi`ÊÃÃ>ÀÞÊÃiVÀiÌ>ÀÞÌÀi>ÃÕÀiÀ]ÊÃiÀÛ}ÊÜÌ Ê7°/°Ê>ÃÌ]ÊV >À>ÊvÊÌ iÊiiÀ>Ê ÕV°Ê iÊ*iÀ]ÊÜ Ê >`ÊViÊÌÊ-«À}wi`ÊÊ£ÓÈÊÌÊLiÊ>ÊLii«iÀÊvÀÊÌ iÊà ÃÃÊivvÀÌ]ÊLiV>iÊÃÃ>ÀÞÊÃiVÀiÌ>ÀÞÌÀi>ÃÕÀiÀÊÊ£ÓÇ°ÊiÊÃiÀÛi`ÊÀiÊÌ >ÊÎäÊÞi>ÀÃÊ>`Ê LiViÊÜÊÌ ÀÕ} ÕÌÊÌ iÊ*iÌiVÃÌ>ÊviÜà «Ê>Ãʺ À°Ê ÃÃð» 6>ÀÕÃÊ«À}À>ÃÊÜiÀiÊiÃÌ>Là i`ÊÌÊÃÕ««ÀÌÊ>`Êi>À}iÊÌ iÊÜÀ`ÊÃÃÃÊÕÌÀi>V ÊvÊ Ì iÊÃÃiLiÃÊvÊ`°Ê ÃÃ>ÀÞÊ° °Ê >]ÊÜÀ}Ê>}Ê-«>à ëi>}Ê«i«iÊ>}Ê Ì iÊ iÝVÊLÀ`iÀ]ÊÌÀ>Ã>Ìi`Ê*iÌiVÃÌ>ÊÌiÀ>ÌÕÀiÊÌÊ-«>à °Ê/`>ÞÊ viÊ*ÕLà iÀÃ]ÊÌ iÊ vÀi}>}Õ>}iÊ«ÕLà }Ê>ÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊvÀÊÀiÊÌ >ÊxäÊ Þi>ÀÃ]ÊvviÀÃÊ«ÕLà }ÊÃiÀÛViÃÊÌÊÃÃ>ÀiÃ°Ê viÊ*ÕLà iÀÃÊ >ÃÊÌÀ>Ã>Ìi`Ê>`Ê«À`ÕVi`Ê >ÌiÀ>ÃÊÊÈ{Ê>}Õ>}ið Ê£ÎäÊ>Ê«À>ÞiÀÊ«À}À>ÊÜ>ÃÊÌ>Ìi`ÊÌ >ÌÊiÀi`Ê>ÌÊi>ÃÌÊ£ä]äääÊÃÃÃÊ«À>ÞiÀÊ«>ÀÌ iÀðÊ/ ÃÊL>`ÊvÊÌiÀViÃÃÀÃÊÜ>ÃÊ>ÊÃÕÃÌ>}ÊvÀViÊÌÊÌ iÊÃÃiLiÃÊvÊ`ÊÃÃÃÊ «À}À>Ê`ÕÀ}ÊÌ iÊÀi>ÌÊ i«ÀiÃÃ°Ê ÞÊ£ÎÊÌ iÊÃÃiLiÃÊvÊ`Ê >`ÊÎnäÊÃÃ>ÀiÃÊ ÃiÀÛ}ÊÊ{xÊ>Ìð Èä / iÊ£{äÃÊ>`Ê£xäà ÕÀ}ÊÌ iÊi>ÀÞÊ£{äÃ]Ê7À`Ê7>ÀÊÊÃÌ««i`ÊÃÃ>ÀÞÊÜÀÊÊÃiÊ>Ài>ÃÊvÀÊÃiÛiÀ>Ê Þi>ÀðÊ1ViÀÌ>ÊÌÀ>ÛiÊ>`ÊVÕV>ÌÃÊ>vviVÌi`Ê>ÊÃÃ>ÀiÃ°Ê iÊ*iÀ]ÊiÝiVÕÌÛiÊ `ÀiVÌÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ]ÊÜÀÌi]ʺ*À>ÞiÀÊÃÊÕÀÊÞÊÀiÃÕÀVi°Ê7iÊ`ÊÌÊ ÜÊÜ >ÌÊ >À`à «ÃÊÌ iÞÊÕÀÊÃÃ>ÀiîÊ>ÀiÊi`ÕÀ}ÊÊÌ ÃÊÌiÊvÊ`>ÀiÃð»Ê ÀÌ iÀÊ *iÀÊV>i`ÊvÀÊÕÌi`Ê«À>ÞiÀÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊVÃÌÌÕiVÞÊvÀÊvÕÀÊ>ÀÊÃÃÃÊ ii`Ã\Ê£®ÊÌ >ÌÊÃÕ««ÞÊiÃÊLiÊ>Ì>i`ÊÌÊÃÃ>ÀiÃÊÃiÀÛ}ÊÊvÀV>]Ê`>]Ê >Ê>`Ê Ì iÊ-ÕÌ Ê*>VwVÆÊÓ®ÊÌ >ÌÊ`ÛiÊÃÌÀi}Ì ]Ê}À>ViÊ>`Êi`ÕÀ>ViÊLiÊ}ÛiÊÌÊÃÃ>ÀiÃÊÊ «ÀÃÊV>«ÃÆÊήÊÌ >ÌÊÃÃ>ÀÞÊÜÀÊLiÊÕ `iÀi`ÊÊiÜÊwi`ÃÊ«i}ÊÊ iÌÀ>Ê>`Ê -ÕÌ ÊiÀV>ÆÊ>`Ê{®ÊÌ >ÌÊ>ÊÀiÃiÀÛiÊvÕ`ÊLiÊLÕÌÊÕ«ÊÌÊiiÌÊÌ iÊiiÀ}iVÞÊii`ÃÊvÊà Ã>ÀiÃÊÊÌ iÊÜ>ÀÊ>Ài>ÃÊ>`ÊÌÊLiÊ>Û>>LiÊvÀÊÃÃÃÊ>`Û>ViÊÜ iÊÌ iÊÜ>ÀÊi`i`°Ê Ü}Ê7À`Ê7>ÀÊ]Ê>ÊLÕÀÃÌÊvÊÃÃÃÊ>VÌÛÌÞÊV>ÀÀi`ÊÃÃ>ÀiÃÊÌÊ>ÞÊiÜÊ wi`Ã°Ê ÃÃ>ÀiÃÊÀiÌÕÀi`ÊÌÊ >Ê>`ÊÃ>Ê*>VwVÊVÕÌÀiðÊÜiÛiÀ]ÊÊiÃÃÊÌ >ÊÌ ÀiiÊ Þi>ÀÃÊÌ iÊ ÀÃÌ>ÊV ÕÀV ÊÊ >ÊÜ>ÃÊÕÌ>Üi`]Ê>`Ê>ÞÊ ÀÃÌ>ÃÊÜiÀiÊ«iÀÃiVÕÌi`ÊvÀÊ Ì iÀÊv>Ì ° ÌÊLiV>iÊVÀi>Ã}ÞÊ>««>ÀiÌÊÌ >ÌÊÌ iÊÃÃ>ÀÞÊÕÌÀi>V ÊvÊÌ iÊÃÃiLiÃÊvÊ`ÊÜ>ÃÊ ÌÊiÝÌiÃÛiÊÌÊLiÊÃÕ«iÀÛÃi`ÊLÞÊÌ iÊÜÀ`ÊÃÃÃÊÃiVÀiÌ>ÀÞÊ>`Ê ÃÊ>ÃÃÃÌ>Ì°Ê,i}>Ê `ÀiVÌÀÃÊÜiÀiÊ>««Ìi`ÊvÀÊÌ iÊ>ÀÊ>Ài>ÃÊvÊÌ iÊÜÀ`°Ê/`>ÞÊÌ ÃÊ«VÞÊVÌÕiÃ]Ê>`ÊÀi }>Ê`ÀiVÌÀÃÊÛiÀÃiiÊÃÃÃÊivvÀÌÃÊÊvÀV>]ÊÃ>Ê*>VwV]Ê ÕÀ>Ã>]Ê ÕÀ«i]Ê >ÌÊiÀV>Ê >`Ê ÀÌ iÀÊÃ>° ÊÌ iÊ>ÌiÊ£xäÃÊ>Êii`ÊLiV>iÊ>««>ÀiÌÊvÀÊvÕ`ÃÊÌÊ>ÃÃÃÌÊÃÃ>ÀiÃÊÊiÛ>}iÃÊ ÕÌÀi>V iðÊÃ]ÊÃÃ>ÀiÃÊLÕÀ`ii`ÊvÀÊÕiÛ>}iâi`Ê>Ài>ÃÊii`i`Ê i«ÊÌÊÀi>V Ê}Ài>ÌÊ LVÃÊvÊ«i«iÊÜÌ ÊÌ iÊ}ëi°Ê/ÊiiÌÊÌ ÃÊii`ÊvÀÊ>ÊVÀi>Ãi`ÊiÛ>}iÃÌVÊÌ ÀÕÃÌ]ÊL>Ê µÕiÃÌÊÜ>ÃÊÌ>Ìi`°Ê Ê/ iÊwÀÃÌÊ>ÃÃÊiÛ>}iÃÊiiÌ}ÊëÃÀi`ÊLÞÊL>Ê µÕiÃÌÊÜ>ÃÊ i`ÊÊ-iÕ]Ê-ÕÌ Ê Ài>°Ê/ iÊ>iÊL>Ê µÕiÃÌÊÜ>ÃÊ>ÌiÀÊV >}i`ÊÌÊ`Ê iÜÃÊ ÀÕÃ>`ið®Ê/`>ÞÊ`Ê iÜÃÊ ÀÕÃ>`iÃÊvÀÊiÛ>}iÃÊ>`ÊV ÕÀV Ê«>Ì}Ê>ÀiÊ i`ÊÊ>ÃÌÊiÛiÀÞÊVÕÌÀÞÊÜ iÀiÊÜiÊ >ÛiÊÃÃ>ÀiðÊÕ`ÃÊÀ>Ãi`ÊvÀÊ`Ê iÜÃÊ ÀÕÃ>`iÃÊ i«Ê«>ÞÊvÀÊÀiÌ}Ê>Õ`ÌÀÕÃÊÀÊ ÃÌ>`ÕÃÊÊ>À}iÊVÌiÃÊÀÊvÀÊÌ iÊ«ÕÀV >ÃiÊvÊÌiÌÃÊÌÊÕÃiÊÊÌ iÀÊ>Ài>ð £ÈäÊ>`Ê£Çäà ÕÀ}ÊÌ iÃiÊ`iV>`iÃÊÌ iÊ«ÀLiÃÊvÊiÀV>ÊviÊÌi`i`ÊÌÊÌÕÀÊÌ iÊivvÀÌÃÊvÊÕV ÊvÊ Ì iÊ1°-°ÊV ÕÀV ÊÌÊ`iÃÌVÊ>vv>ÀðÊÜiÛiÀ]ÊÌ iÊÃÃiLiÃÊvÊ`ÊVÌÕi`ÊÌÃÊÃÃÃÊ ÕÌÀi>V Ê>ÀÕ`ÊÌ iÊÜÀ`° ÊÌ iÊ£ÈäÃ]ÊÌ iÊ>Ì>ÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊÜÌ ÊÜ V ÊÕÀÊÃÃ>ÀiÃÊÜÀi`Ê ÌÀ«i`ÊÊiLiÀà «]Ê>`ÊLÞÊÌ iÊi`ÊvÊÌ i£ÇäÃÊÌ iÊÜÀ`Ü`iÊiLiÀà «ÊÜ>ÃÊ`ÕL}Ê iÛiÀÞÊwÛiÊÞi>ÀðÊ/ ÃÊ>VViiÀ>Ìi`Ê}ÀÜÌ Ê«>Vi`ÊÌ iÊÃÃiLiÃÊvÊ`ÊÛiÀÃi>ÃÊV ÕÀV ÊÊÌ iÊ vÀivÀÌÊvÊiÛ>}iV>ÊÃÃð / iʼÈäÃÊ>`ʼÇäÃÊLÀÕ} ÌÊV >}iÃÊÊ>Ì>Ê}ÛiÀiÌÃ]Ê>`ÊÃÃÃÊ>VÌÛÌiÃÊÊÃiÊ VÕÌÀiÃÊ >`ÊÌÊLiÊ>ÌiÀi`ÊÌÊV«ÞÊÜÌ ÊÛ>Ài`ÊÀi}Õ>ÌÃ°Ê ÕÌÊÌ iÊÞÊ-«ÀÌÊi>Li`Êà Ã>ÀiÃÊÌÊ>iÊÌ iÃiÊ>`ÕÃÌiÌÃÊ>`ÊÌÀ>ÃÌÊiÌ `ÃÊvÊÃÌÀÞÊÌÊÌ iÊ>Ì>ÊV ÕÀV ]Ê «À«Ì}ÊV>ÊV ÕÀV iÃÊÌÊVÌÕiÊÌÊ}ÀÜ° Ê>ÃÌÊiÛiÀÞÊVÕÌÀÞÊÜ iÀiÊÃÃiLiÃÊvÊ`ÊÃÃ>ÀiÃÊÜÀ]ÊÌ iÞÊ >ÛiÊ«ii`Ê LiÊÃV ÃÊÊÌ iÊ>}Õ>}iÃÊvÊÌ iÊ«i«i°Ê ÕÀ}ÊÌ iʼÈäÃÊ>`ʼÇäÃ]ÊÌ iÊÀÃ}Êi`ÕV>Ì>Ê È£ iÛiÊÊ>ÞÊ>ÌÃÊ>`iÊÌ iÊiViÃÃÌÞÊvÊ>`Û>Vi`ÊÃV ÃÊiÛ`iÌ°Ê`Û>Vi`ÊÃV ÃÊÜiÀiÊ «ii`ÊÊiÛiÀÞÊ>ÀÊ>Ài>ÊvÊÌ iÊÜÀ`°Ê ÝÌiÃÊ«À}À>ÃÊ>ÃÊLiV>iÊ«>ÀÌÊvÊiiÌ}ÊÌ iÊ VÀi>Ãi`Êii`ÊvÀÊÌÀ>}Ê>Ì>ÊÃÌiÀð ÃÊÀiÊVÕÌÀiÃÊÜiVi`ÊÃÃ>ÀiÃÊ>`ÊÀiÊÃÃ>ÀiÃÊ«Ài«>Ài`ÊvÀÊÃiÀÛVi]ÊÀi }>Ê`ÀiVÌÀÃÊÜiÀiÊVÀi>Ã}ÞÊÕ`>Ìi`ÊLÞÊ>`ÃÌÀ>ÌÛiÊÌ>ÃðÊ/Ê} ÌiÊÌ iÀÊ>`Ê>`Ê }ÛiÊÀiÊ>ÃÃÃÌ>ViÊÌÊÃÃ>ÀÞÊv>iÃÊÊÌ iÊwi`]ÊiÝ«iÀiVi`ÊÃÃ>ÀiÃÊvÊ«ÀÛiÊ >LÌÞÊÜiÀiÊV ÃiÊÌÊLiViÊ>Ài>Ê`ÀiVÌÀÃ°Ê >V Ê>Ài>Ê`ÀiVÌÀÊÜ>ÃÊ}ÛiÊÛiÀÃ} ÌÊvÊ>Ê ÃÃiLiÃÊvÊ`ÊÃÃ>ÀiÃÊÃiÀÛ}ÊÊ>ÊViÀÌ>Ê}ÀÕ«ÊvÊVÕÌÀiÃÊÜÌ Ê>ÊëiVwVÊ>Ài>ÊvÊ Ì iÊÜÀ`° ÃÊÌ iʼÇäÃÊVÃi`]ÊÌ iÊÜÀ`ÊÃÃÃÊ«À}À>ÊVÌÕi`ÊÌÊ}>ÊiÌÕ°ÊvÌÃÊÌÊ ÜÀ`ÊÃÃÃÊÊ£ÇÊÌÌ>i`ÊfÎ{]xxÎ]x°Ê/ iÊÕLiÀÊvÊÛiÀÃi>ÃÊiLiÀÃÊ>`Ê>` iÀiÌÃÊ >««À>V i`Ê£äÊ°Ê ÃÃ>ÀiÃÊÜiÀiÊÜÀ}ÊÊ£äxÊ>ÌðÊ/ iÀiÊÜiÀiÊi>ÀÞÊÇx]äääÊ >Ì>ÊÃÌiÀÃÊ>`Ê£ää]äääÊÕÌÃÌ>ÌÃÊ>`Ê«Ài>V }Ê«Ìð £näÃÊ>`Ê£äà iÀV>ÃÊÛi`ÊÌÊÌ iʼnäÃÊV>Õ} ÌÊÊ>Ê«>À>`Ý°Ê7 iÊÌ iÞÊiÞi`ÊÌ iÊÜÀ`½ÃÊ } iÃÌÊ ÃÌ>`>À`ÊvÊÛ}]ÊÌ iÞÊÃ>ÜÊÌ iÀÊviÃÌÞiÊLiViÊVÀi>Ã}ÞÊÌ Ài>Ìii`ÊLÞÊy>Ì]ÊiiÀ}ÞÊ Ã ÀÌ>}iÃ]ÊiÛÀiÌ>Ê >â>À`ÃÊ>`ÊÌ iÊ«ÃÃLÌÞÊvÊÜ>À° ÊëÌiÊvÊÌ iÊ>̽ÃÊ«ÀLiÃ]Ê>ÊÀiiÜi`ÊÕÌ«ÕÀ}ÊvÊÌ iÊÞÊ-«ÀÌÊLi}>ÊÀi>V }Ê ÌÊ>ÞÊ>iÊ`i>ÌÃÊÌ >ÌÊÀiiVÌi`ÊÌ iÊwÀÃÌÊÕÌ«ÕÀ}Ê>ÌÊÌ iÊÌÕÀÊvÊÌ iÊViÌÕÀÞ°Ê ÌÊLÀÕ} ÌÊ>ÊëÀÌÊvÊLÀÌ iÀÞÊÛiÊ>`Ê>ÊVÀi>ÃiÊÊÃÃÃÊÌiÀiÃÌ°Ê}ÊÌ iÊÃÃi LiÃÊvÊ`]Ê>ÊLÕÀ`iÊÌÊ}iÌÊÌ iÊ}ëiÊÌÊÌ iÊLÃÊÜ Ê >ÛiÊiÛiÀÊ >`ÊÌ iÊ««ÀÌÕÌÞÊÌÊ ÜÊiÃÕÃÊ ÀÃÌÊ>ÃÊ->ÛÀÊ>VViiÀ>Ìi`ÊÌ iÊÃÃÃÊÕÌÀi>V ° ÊÌ iʼnäÃÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊLi}>ÊÃÌi««}ÊÕ«ÊÌÃÊÕÌÀi>V ÊÌÊ ÕÃÃ°Ê Ã>ÊÃÊiÊvÊÌ iÊ}Ài>ÌÊV >i}iÃÊÌÊ ÀÃÌ>ÊÃÃðÊÊxÇÊ>ÌÃÊvÊÌ iÊÜÀ`]Ê>Ê>À ÌÞÊvÊÌ iÊ«i«iÊ>ÀiÊ>` iÀiÌÃÊvÊÃ>°ÊÃÃiLiÃÊvÊ`ÊÃÃÃÊi>`iÀÃÊ>`ÊÃÃ>À iÃÊLi}>ÊÌÊÀiV}âiÊÌ >ÌÊVÛiÌ>ÊiÌ `ÃÊvÊiÛ>}iÃ]ÊÃÕV Ê>ÃÊ«i>ÀÊVÀÕÃ>`iÃÊ ÀÊÃÌÀiiÌÊÜÌiÃÃ}]ÊÜÕ`ÊÌÊLiÊivviVÌÛiÊÊ ÕÃÊVÕÌÀiÃÊiÛiÊvÊÌ iÞÊÜiÀiÊ>Üi`°Ê Ê ÕÃÊÜ ÊLiViÃÊ>Ê ÀÃÌ>ÊÃÊi`>ÌiÞÊÃÌÀ>Vâi`ÊLÞÊ ÃÊv>Þ°Ê/ iÀivÀi]Ê ÃÊ ÀiëÃiÊÌÊÌ iÊV>ÃÊvÊ ÀÃÌÊÃÊÀiÊiÞÊÌÊLiÊ«ÃÌÛiÊvÊ iÊV>ÊVÃ`iÀÊÌ iÊ}ëiÊÊÌ iÊ «ÀÛ>VÞÊvÊ ÃÊ iÊÀÊ>}ÊÕ`iÀÃÌ>`}ÊvÀi`ð ÊÌ iÊi>ÀÞʼnäÃÊÌ iÊ iÌiÀÊvÊ ÃÌÀÞÊÌÊ ÕÃÃÊ ®]Ê>ÊÃÌÀÞÊvÊÃÃiLiÃÊvÊ `Ê7À`Ê ÃÃÃ]ÊÜ>ÃÊiÃÌ>Là i`ÊÌÊÌÀ>Ê>`Ê>ÃÃÃÌÊÃÃ>ÀiÃÊÜ ÊÛiÊ>`Êà ÌiÀÊ>}Ê ÕÃðÊÊ>``Ì]Ê>Ê>ÌÜ`iÊ«À>ÞiÀÊ«À}À>ÊÜ>ÃÊ>ÕV i`ÊÊÌ iÊ1Ìi`Ê -Ì>ÌiÃ]ÊÀiVÀÕÌ}ÊÌ ÕÃ>`ÃÊvÊ«À>ÞiÀÊ«>ÀÌiÀÃÊÌÊ«À>ÞÊ>`Êv>ÃÌÊvÀÊÌ iÊVÛiÀÃÊvÊ ÕÃÃÊ ÌÊ ÀÃÌ°Ê 7Ì ÊÌ iÊÌiV }V>Ê>`Û>ViÃÊvÊÌ ÃÊ«iÀ`]ÊÜÀ`ÊÃÃÃÊi>`iÀÃÊÃ>ÜÊÌ iÊii`ÊÌÊ VÀ`>ÌiÊ>`Êi >ViÊÌ iÊÕÌÀi>V ÊvÊÌ iÊ}ëiÊÌ ÀÕ} Êi`>°Ê-ViÊ£n£]ÊÌiÀ>Ì>Ê i`>Ê ÃÌÀiÃÊ ®ÊÜÌ ÊvwViÃÊÜÊÊ >`À`]Ê-«>]Ê >ÃÊLÀÕ} ÌÊVÃ`iÀ>LiÊ«À} ÀiÃÃÊÌÊÌ iÊÕÌÀi>V ÊvÊÌ iÊ}ëiÊÌ ÀÕ} ÊÀ>`]ÊÌiiÛÃÊ>`ÊÌ iÀÊi`>°Ê Ê>ÃÃÃÌÃÊ ÃÃ>ÀiÃÊ>`Ê>Ì>ÊV ÕÀV iÃÊÜÌ ÊÌ iÊ«À`ÕVÌÊvÊ}ëiÊi`>ÊÌÃÊ>`ÊÌ iÊÌÀ>}ÊvÊ >Ì>Êi`>ÊÜÀiÀð Ê£nxÊÃ>Ê*>VwVÊÃÃÃÊi>`iÀÃÊÀiV}âi`ÊÌ >ÌÊÜÌ ÊÀiÊÌ >ÊiÊ >vÊvÊÌ iÊiÌÀiÊ ««Õ>ÌÊÛ}ÊÊÌ ÃÊ«>ÀÌÊvÊÌ iÊÜÀ`]ÊVÛiÌ>ÊiÌ `ÃÊvÊ«>Ì}Ê>`Ê >ÀÛiÃÌ}Ê ÜiÀiÊ>`iµÕ>Ìi°Ê/ iÀivÀi]ÊÌ iÞÊLi}>ÊÌ iÊ}ëiÊi`>ÊÕÌÀi>V ÊV>i`ÊÃ>Ê*>VwVÊÓäääÊ ÈÓ ÜÌ ÊÌ iÊ}>ÊvÊiÛ>}iâ}ÊÌ iÊÃÌÊ>`ÊÕÀÌÕÀ}ÊLiiÛiÀÃÊÌ ÀÕ} ÕÌÊÃ>°Ê / iÊii`ÊvÀÊÃÌÀiÃÊvÊV«>ÃÃ]ÊÜ V Ê >`ÊLiiÊ«ÀÛ`i`ÊLÞÊÌ iÊÃÃiLiÃÊvÊ`Ê vÀÊ>ÞÊÞi>ÀÃ]ÊLiV>iÊiÛiÊÀiÊÕÀ}iÌÊÊ>ÞÊÃÃÊwi`ÃÊ ViÀi`ÊV ÕÀV iÃÊ>`Ê `Û`Õ>ÃÊÊÌ iÊ1Ìi`Ê-Ì>ÌiÃÊÀi>V i`ÊÕÌÊÌÊ i«ÊÌ iÊ ÕÀÌ}]Ê Õ}ÀÞÊ>`ÊÃÕvviÀ}ÊÕ ÌÌÕ`iÃÊÌ ÀÕ} ÊÃÃiLiÃÊvÊ`Ê,iiv°Êi>Ì >ÀiÊ ÃÌÀiÃÊÜ>ÃÊvÕ`i`ÊÌÊ«ÀÛ`iÊ i`V>Ê>ÃÃÃÌ>ViÊÜ iÀiÛiÀÊii`i`ÊÌ ÀÕ} ÊÌ iÊ`ÃLÕÀÃiiÌÊvÊÌi>ÃÊvÊ ÀÃÌ>Êi`V>Ê «ÀviÃÃ>ð ÊÌ iÊ>ÌiʼnäÃÊÃÃiLiÃÊvÊ`Êi>`iÀÃÊ>`ÊLiiÛiÀÃÊLi}>ÊÌÊiÝ«iÀiViÊ>Ê}Ài>ÌÊÕÀ}i VÞÊvÀÊV«iÌ}ÊÌ iÊÌ>ÃÊvÊÌ iÊÀi>ÌÊ ÃðÊ/ ÃÊÃiÃiÊvÊÕÀ}iVÞÊLÀÕ} ÌÊÌ}iÌ iÀÊ ÃÃiLiÃÊvÊ`ÊviÜà «ÃÊvÀÊ>ÀÕ`ÊÌ iÊÜÀ`ÊÊ>ÊÌÊivvÀÌÊV>i`ÊÌ iÊ iV>`iÊvÊ >ÀÛiÃÌ°Ê ÕÀV iÃÊ>`ÊV ÕÀV Êi>`iÀÃÊvÀÊ>ÞÊ>ÌÃÊÀië`i`ÊLÞÊÃiÌÌ}Ê iV>`iÊvÊ >ÀÛiÃÌÊ}>ð / ÃÊ iV>`iÊvÊ>ÀÛiÃÌÊÀiëÃiÊ>`Ê«>ÀÌV«>ÌÊvÀÊVÕÌÀiÃÊ>ÀÕ`ÊÌ iÊÜÀ`Êi`ÊÌÊ Ì iÊvÕ`}ÊvÊÌ iÊ7À`ÊÃÃiLiÃÊvÊ`ÊiÜà «ÊÊ£nnÊLÞÊ°Ê* «Ê}>°Ê}>]Ê >ÊvÀiÀÊÃÃ>ÀÞÊÌÊ >]ÊÜ>ÃÊÜÀ`ÊÃÃÃÊiÝiVÕÌÛiÊ`ÀiVÌÀÊvÀÊ£x£n°ÊiÊ >ÃÊÃiÀÛi`Ê>ÃÊV >À>ÊvÊÌ iÊ7À`ÊÃÃiLiÃÊvÊ`ÊiÜà «ÊÕÌÊ£ÓÊÜ iÊ À°Ê > Û`Ê9}}Ê ]Ê«>ÃÌÀÊvÊ9`ÊÕÊëiÊ ÕÀV ÊÊ-iÕ]Ê-ÕÌ Ê Ài>]ÊÜ>ÃÊiiVÌi`°Ê1«Ê °Ê* «Ê}>½ÃÊÀiÌÀiiÌÊ>ÃÊiÝiVÕÌÛiÊ`ÀiVÌÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ]Ê ÀiÊ /À«iÌÌÊÜ>ÃÊiiVÌi`ÊÌÊÌ >ÌÊ«ÃÌÊ>`ÊÃiÀÛi`ÊvÀÊ£äÊÌʣǰ Ê"VÌLiÀÊ£{ÊÌ iÊ7À`ÊÃÃiLiÃÊvÊ`ÊiÜà «ÊiÌÊÊ-iÕ]Ê-ÕÌ Ê Ài>ÊvÀÊ Ì iÊnäÌ Ê>ÛiÀÃ>ÀÞÊViiLÀ>ÌÊvÊÌ iÊvÕ`}ÊvÊÌ iÊÃÃiLiÃÊvÊ`Ê>`Ê>Ê``iV>`iÊ iiÌ}ÊvÊÌ iÊ iV>`iÊvÊ>ÀÛiÃÌ°Ê ÀiÊÌ >Ê£ÊÊ«i«iÊ>`Ê{ÊÃÃiLiÃÊvÊ`Ê }iiÀ>ÊÃÕ«iÀÌi`iÌÃÊ}>Ì iÀi`ÊÊ-iÕÊvÀÊÌ iÊwÀÃÌÊ7À`ÊÃÃiLiÃÊvÊ`Ê }ÀiÃÃ°Ê / ÃÊwÛi`>ÞÊiiÌ}ÊVÕ>Ìi`ÊÜÌ ÊÌ iÊ>À}iÃÌÊ«À>ÞiÀÊiiÌ}ÊiÛiÀÊV`ÕVÌi`Ê>`ÊÜ>ÃÊ ÀiviÀÀi`ÊÌÊLÞÊ,iÛiÀi`Ê/ >ÃÊ °Ê/À>Ã]Ê1°-°ÊÃÃiLiÃÊvÊ`Ê}iiÀ>ÊÃÕ«iÀÌi`iÌ]ÊÌÊ LiʺÕ>à >i`ÞÊ*iÌiVÃÌ>»Ê>`ʺ>ÃÊ ÃÌÀVÊ>ÃÊÌ iÊ££{ÊÌÊ-«À}ÃÊiiÌ}ÊÌ >ÌÊvÕ`i`Ê Ì iÊÃÃiLiÃÊvÊ`°» ÕÀ}Ê>ÊiiÌ}ÊvÊÌ iÊiÝiVÕÌÛiÊvwViÀÃÊvÊÌ iÊ7À`ÊÃÃiLiÃÊvÊ`ÊiÜà «ÊÊ -iÕ]ÊÌ iÊ7À`ÊÃÃiLiÃÊvÊ`Ê,iivÊ>`Ê iÛi«iÌÊ}iVÞÊ7,®ÊÜ>ÃÊvÀi`Ê ÌÊÀië`ÊÌÊii`ÃÊvÀÊV«>ÃÃÊÃÌÀiÃÊ>ÀÕ`ÊÌ iÊÜÀ`° º/ iÊ7À`ÊÃÃiLiÃÊvÊ`ÊÃÊ>ÊV>À}]ÊÛ}Ê>`ÊÃÕ««ÀÌÛiÊviÜà «]»ÊÃ>`Ê À°Ê *ÀViÊÕiÀ>Ì>]Ê}iiÀ>ÊÃÕ«iÀÌi`iÌÊvÊÌ iÊ >>ÞÃ>ÊÃÃiLiÃÊvÊ`°Êº7 iÌ iÀÊÌ iÊ ii`ÊÃÊvÀÊw>ViÊÀÊÌi]ÊÌ iÊÜÀ`Ü`iÊÃÃiLiÃÊvÊ`ÊÜÊÀ>ÞÊÌ}iÌ iÀ]ÊÌÊÞÊÌÊ «Ài>V ÊÌ iÊ}ëiÊLÕÌÊ>ÃÊÌÊiiÌÊ Õ>Êii`ð» ÈÎ Óäääà / iÊ iV>`iÊvÊ>ÀÛiÃÌÊÕà iÀi`ÊÊ>ÊÜ>ÛiÊvÊÕ«ÀiVi`iÌi`Ê}ÀÜÌ ÊvÀÊÃÃiLiÃÊvÊ`Ê 7À`Ê ÃÃÃ]Ê>ÃÊ`V>Ìi`ÊLÞÊÌ ÃÊV >ÀÌ° ÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÀÜÌ Ê £äÊ,i«ÀÌÊ ÓäääÊ,i«ÀÌ Ê ÃÃ>ÀiÃÊ £]xnnÊ £]n£{ Ê ÕÌÀiÃÊ £Ó£Ê £ÈÓ Ê iLiÀÃÊ>`Ê` iÀiÌÃÊ £È]{£{]ÎÓÊ ÎÓ]ääÓ]{ÎÇ Ê ÕÀV iÃÊ>`Ê"ÕÌÃÌ>ÌÃÊ ££Ç]££xÊ Óää]{ÈÇ Ê >Ì>Ê ÃÌiÀÃÊ £££]äÇ{Ê £]Ó£Ç Ê LiÊ-V ÃÊ>`Ê ÝÌiÃÃÊ ÎÎäÊ £]ÇÇÇ Ê LiÊ-V Ê ÀiÌÊ ÎÎ]Ó{{Ê nÈ]ÎÎÓ Ê /Ì>ÊÛ}ÊÌÊ7À`Ê ÃÃÃÊ fnÈ]ÈnÈ]ä£nÊ f£{Ç]Ó£x]xÈn Ê Õi]ÊiiVÌi`Ê>ÃÊiÝiVÕÌÛiÊ`ÀiVÌÀÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÊ£Ç]Ê >ÃÊi`ÊÌ iÊÃÃ>ÀÞÊÕÌÀi>V ÊÌÊÌ iÊÓ£ÃÌÊViÌÕÀÞ°ÊÊÓääÎÊ VÌÀÊ,ijÊÀ`iÀÊvÀÊ ÀiÃÌÜ`]Ê iÌÕVÞ]ÊÜ>ÃÊiiVÌi`Ê>ÃÊÌ iÊwÀÃÌÊÜ>ÊÌÊÃiÀÛiÊÊÌ iÊ7À`Ê ÃÃÃÊ >À`°Ê ÊÓääxÊ À°ÊÊ ÕÌÀÊLiV>iÊ`ÀiVÌÀÊvÊÌiÀ>Ì>Ê-iÀÛViÊ ÃÌÀiÃÊ>`ÊÌ iÊÞÊ Ü>ÊÌÊÃiÀÛiÊ>ÃÊ>ÊiLiÀÊvÊÌ iÊ7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌii° ÀÜÌ ÊVÌÕiÃÊÕ>L>Ìi`°ÊÊÌ iÊÓää{Ê>Õ>ÊÀi«ÀÌ]Ê Ê ÕiÊÜÀÌi]ʺ/ ÃÊÞi>ÀÊÌ iÊ ÃÃiLiÃÊvÊ`ÊiÝVii`i`ÊÌÜÊiÃÌiÃ°Ê ÀiÊÌ >ÊÓxä]äääÊV}Ài}>ÌÃÊÜÊiiÌÊ Ì ÀÕ} ÕÌÊÌ iÊÜÀ`ÊÊÓ££Ê>ÌÃÊ>`ÊÌiÀÀÌÀiÃÊÌ >ÌÊV«ÀÃiÊÌ iÊ7À`ÊÃÃiLiÃÊvÊ `ÊiÜà «°Ê`ÊÀiÊÌ >ÊxäÊÊLiiÛiÀÃÊ}>Ì iÀÊÊÌ ÃiÊV ÕÀV iÃÊi>V Ê À`½ÃÊ >Þ°»Ê ÕÀ}ÊÓää£Ê>`ÊÓääÓ]ÊÌ iÊÃÃiLiÃÊvÊ`Ê}ÀiÜÊLÞÊ>Ê>ÛiÀ>}iÊvÊÎ{ÊiÜÊV ÕÀV iÃÊ `>Þ°Ê ÕÀ}ÊÌ >ÌÊÃ>iÊÌi]ÊV ÕÀV ÊiLiÀà «Ê}ÀiÜÊ>ÌÊ>ÊÀ>ÌiÊvÊÃiÛiÊ«iÀÊÕÌit / iÊ}Ài>ÌiÃÌÊiÛ>}iÃÊÌ iÊÜÀ`Ê >ÃÊiÛiÀÊÃiipÌ >ÌÊÜ>ÃÊÌ iÊ«À>ÀÞÊ}>ÊvÊÌ iÊwÀÃÌÊ ÃÃÃÊi>`iÀÃÊvÊÌ iÊÃÃiLiÃÊvÊ`°ÊÌÊÃÊÃÌÊÌ iÊ i>ÀÌÊVÀÞÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÌ`>Þ° / iÊÜÀ`ÊÃÃÃÊivvÀÌÃÊvÊÕÀÊvÕ`}Êi>`iÀÃÊ>`Êi>ÀÞ`>ÞÊÃÃ>ÀiÃÊÀi>]ÊvÀ }ÊÌ iÊvÕ`>ÌÊÕ«ÊÜ V ÊÌ`>Þ½ÃÊLiÌÌiÀiµÕ««i`]ÊLiÌÌiÀÃÕ««ÀÌi`Ê>`ÊLiÌÌiÀÌÀ>i`Ê ÃÃ>ÀiÃÊÜÊLÕ`°Ê/ iÊwiÀViÊ`i`V>ÌÊÌÊÜÀ`ÊiÛ>}iâ>ÌÊvÊÌ ÃiÊÃÃ>ÀÞÊ« iiÀÃÊÛiÃÊÊÊÌ iÊÃÃ>ÀÞÊëÀÌ°Ê/ ÃÊÃÃ>ÀÞÊëÀÌÊVÌÕiÃÊÌÊLiÊ>Ê>ÀÊ`ÀÛ}Ê vÀViÊÊÌ iÊÃÃiLiÃÊvÊ`° ÀÊ>ÊÀiÊV«iÌiÊ ÃÌÀÞÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ]ÊÜÀÌiÊ>`ÊÀiµÕiÃÌÊ>Ê V«ÞÊvÊÌÊÊÌ iÊ7À`\ÊÊÃÌÀÞÊvÊÃÃiLiÃÊvÊ`ÊÀi}Ê ÃÃð® È{ #URRENT 3TATISTICS OF !SSEMBLIES OF 'OD 7ORLD -ISSIONS !FRICA ÕÌÀiÃÊqÊ{nÊ Ê ÃÃ>ÀiÃÊqÊÓÎÊ Ê ÃÃ>ÀÞÊÃÃV>ÌiÃÊqÊÈÈÊ Ê Ài`iÌ>i`Ê>`Ê >ÞÊ ÃÌiÀÃÊqÊÎÓ]ääÓ Ê ÕÀV iÃÊ>`Ê*Ài>V }Ê*ÌÃÊqÊÎÈ]ÇÎ Ê iLiÀÃÊ>`Ê` iÀiÌÃÊqÊ££]ÓnÇ]x£Î !SIA 0ACIlC #OUNTRIES n ÃÃ>ÀiÃÊqÊÓÇäÊ Ê ÃÃ>ÀÞÊÃÃV>ÌiÃÊqÊnäÊ Ê Ài`iÌ>i`Ê>`Ê >ÞÊ ÃÌiÀÃÊqÊ£n]ÈÈ{ Ê ÕÀV iÃÊ>`Ê*Ài>V }Ê*ÌÃÊqÊÓä]Ó Ê iLiÀÃÊ>`Ê` iÀiÌÃÊqÊÎ]nä{]nn{ %URASIA ÕÌÀiÃÊqÊ{xÊ Ê ÃÃ>ÀiÃÊqÊÎäÇÊ Ê ÃÃ>ÀÞÊÃÃV>ÌiÃÊqÊÇxÊ Ê Ài`iÌ>i`Ê>`Ê >ÞÊ ÃÌiÀÃÊqÊ£Î]ÎÓ Ê ÕÀV iÃÊ>`Ê*Ài>V }Ê*ÌÃÊqÊ£Ó]£ÈÇ Ê iLiÀÃÊ>`Ê` iÀiÌÃÊqÊ£]xÎÇ]Óäx %UROPE ÕÌÀiÃÊÊÎÎ Ê ÃÃ>ÀiÃÊqÊÎÓÇÊ Ê ÃÃ>ÀÞÊÃÃV>ÌiÃÊqÊ£ÓÓÊ Ê Ài`iÌ>i`Ê>`Ê >ÞÊ ÃÌiÀÃÊqÊ£È]{£ Ê ÕÀV iÃÊ>`Ê*Ài>V }Ê*ÌÃÊqÊ£ä]{Ó Ê iLiÀÃÊ>`Ê` iÀiÌÃÊqÊÓ]£ÈÎ]n£Ó ,ATIN !MERICA ÕÌÀiÃÊqÊÎÇÊ Ê ÃÃ>ÀiÃÊqÊ{xxÊ Ê ÃÃ>ÀÞÊÃÃV>ÌiÃÊqÊ£{ÎÊ Ê Ài`iÌ>i`Ê>`Ê >ÞÊ ÃÌiÀÃÊqÊ£x{]Óä{ Ê ÕÀV iÃÊ>`Ê*Ài>V }Ê*ÌÃÊqÊ£Èn]ÇÎn Ê iLiÀÃÊ>`Ê` iÀiÌÃÊqÊÓÎ]Êäx£]näÓ .ORTHERN !SIA -Ì>ÌÃÌVÃÊ>ÀiÊÌÊ«ÕLà i`ÊvÀÊÌ ÃÊÀi}ÊvÀÊÃiVÕÀÌÞÊÀi>Ãð Èx 3%#4)/. -ISSIONARIES ÃÃ>ÀiÃÊ>iÊÌÊ«ÃÃLiÊvÀÊ>ÊLiiÛiÀÊÌÊ«>ÀÌiÀÊÊÌ iÊÀi `i«ÌÊvÊÃÌÊÃÕÃÊ>ÀÕ`ÊÌ iÊÜÀ`ÊÜÌ ÕÌÊi>Û}Ê ÃÊÀÊ iÀÊÜÊVÌÞ° i>ÀÊvÀi`]ÊÞÕÊ>ÀiÊ`}Ê>Ê}`ÊÜÀÊvÀÊ`ÊÊÌ>}ÊV>ÀiÊvÊ Ì iÊÌÀ>Ûi}ÊÌi>V iÀÃÊ>`ÊÃÃ>ÀiÃÊÜ Ê>ÀiÊ«>ÃÃ}ÊÌ ÀÕ} °°°ÊÀÊ Ì iÞÊ>ÀiÊÌÀ>Ûi}ÊvÀÊÌ iÊ À`]Ê>`ÊÌ>iÊiÌ iÀÊv`]ÊVÌ }]Êà iÌiÀ]Ê ÀÊiÞÊvÀÊÌ ÃiÊÜ Ê>ÀiÊÌÊ ÀÃÌ>Ã]ÊiÛiÊÌ Õ} ÊÌ iÞÊ >ÛiÊ «Ài>V i`ÊÌÊÌ i°Ê-ÊÜiÊÕÀÃiÛiÃÊà Õ`ÊÌ>iÊV>ÀiÊvÊÌ iÊÊÀ`iÀÊÌ >ÌÊ ÜiÊ>ÞÊLiViÊ«>ÀÌiÀÃÊÜÌ ÊÌ iÊÊÌ iÊ À`½ÃÊÜÀ° ÎÊ Êx]Çn]Ê/ ÈÈ 0!24 (OW !RE !SSEMBLIES OF 'OD -ISSIONARIES 3UPPORTED 7 >ÌÊ-ÞÃÌiÊvÊ-Õ««ÀÌÊÃÊ1Ãi`¶ ºÌÊÃiiÃÊÃÕV Ê>Êà >iÊvÀÊÃÃ>ÀiÃÊÌÊëi`ÊvÕÀÊÞi>ÀÃÊÛiÀÃi>ÃÊ>`ÊÌ iÊLiÊvÀVi`]Ê Õ«ÊÌ iÀÊÀiÌÕÀÊÌÊÌ iÊ1Ìi`Ê-Ì>ÌiÃ]ÊÌÊëi`Ê>ÊvÕÊÞi>ÀÊÛÃÌ}ÊÃVÀiÃÊvÊV ÕÀV iÃÊÌÊÀ>ÃiÊ ÃÕ««ÀÌÊvÀÊÌ iÀÊiÝÌÊÌiÀ°Ê/ iÀiÊÕÃÌÊLiÊ>ÊLiÌÌiÀÊÜ>Þ°» / ÃÊLiVÌÊÃÊÛVi`ÊvÀiµÕiÌÞÊLÞÊ«>ÃÌÀÃÊ>`Ê>ÌÞ°ÊÌÊÃÊ>ÊÀi>Ã>LiÊLÃiÀÛ>ÌÊ>`Ê `iÃiÀÛiÃÊ>ÊÀi>Ã>LiÊ>ÃÜiÀ° / ÀiiÊiÌ `ÃÊ>ÀiÊVÞÊi«Þi`ÊvÀÊÃÃ>ÀÞÊÃÕ««ÀÌ°Ê UÊÊ/ iÊ`i«i`iÌÊv>Ì ÊÃÞÃÌiÊi>ÛiÃÊiÛiÀÞÊÃÃ>ÀÞÊÌÊÀ>ÃiÊÜ >ÌÊ iÊÀÊà iÊV>ÊÜÌ Ê Ê}Õ>À>ÌiiÃ°Ê ÀÃÊÃi`ÊÌ iÀÊÃÕ««ÀÌÊ`ÀiVÌÞÊÌÊÌ iÊÃÃ>ÀÞ]Êi>Û}ÊÌ iÊà Ã>ÀÞÊÜÌ ÊÊ>ÃÃÕÀ>ViÊvÊ>ÊÃÌ>LiÊVi°Ê UÊÊ/ iÊLÕ`}iÌi`ÊÃÞÃÌiÊÛÛiÃÊV ÕÀV iÃÊÃi`}ÊÌ iÀÊÕ`iÃ}>Ìi`ÊvviÀ}ÃÊÌÊÌ iÀÊ `i>̽ÃÊ>Ì>ÊvwVi°Ê/ iÃiÊvÕ`ÃÊ>ÀiÊÌ iÊ`Û`i`Ê>}ÊÌ iÊÃÃ>ÀiÃÊ >`Ê«ÀiVÌÃÊ>VVÀ`}ÊÌÊÌ iÊLÕ`}iÌÊiÃÌ>Là i`ÊLÞÊÌ iÊÃÃÃÊÀ}>â>Ì°Ê/ ÃÊ ÃÞÃÌiÊÃÊ«iÀÃ>Ê>`ÊÀiiÛiÃÊÌ iÊ>ÛiÀ>}iÊV ÕÀV ÊiLiÀÊvÀÊ>ÞÊÃiÃiÊvÊ` Û`Õ>ÊÀiëÃLÌÞ° UÊÊ/ iÊÌiÀ>ÌÊiÌ `ÊvÊÀ>Ã}ÊÃÃ>ÀÞÊÃÕ««ÀÌÊÃÊ>Ê`wi`ÊÃÞÃÌi]Ê>ÊVL> ÌÊvÊv>Ì Ê>`ÊLÕ`}iÌ°ÊÌÊÃÊÕÃi`ÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>`ÊÀiµÕÀiÃÊ ÃÃ>ÀiÃÊÌÊÌÀ>ÛiÊ>}Ê1°-°ÊÃÃiLiÃÊvÊ`ÊV ÕÀV iÃÊÌÊÀ>ÃiÊÌ iÀÊw>V>Ê >`Ê«À>ÞiÀÊÃÕ««ÀÌ°Ê Ì ÞÊvviÀ}ÃÊ>ÀiÊÃiÌÊÌÊÌ iÊ>Ì>ÊvwVi]Ê`iÃ}>Ìi`ÊLÞÊ Ì iÊ`ÀÊvÀÊëiVwVÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊ«ÀiVÌð ÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÀiµÕÀiÃÊÌ >ÌÊ>ÊÃÃ>ÀiÃÊÀ>ÃiÊÌ iÀÊÜÊÃÕ««ÀÌ°Ê ÊiÊÃÊÃÕ««ÀÌi`ÊÌ ÀÕ} ÊÃÕLÃ`iÃ]ÊÃViÊÃÕV ÊvÕ`ÃÊ>ÀiÊiÝÃÌiÌ° 7 ÞÊ1ÃiÊ/ iÊÌiÀ>ÌÊ-ÞÃÌi¶ ÊÀiViÌÊÞi>ÀÃ]ÊÌ iÀÊÃÃÃÃi`}ÊÀ}>â>ÌÃÊ >ÛiÊV >}i`ÊvÀÊÌ iÊv>Ì ÊÃÞÃÌiÊ ÌÊÌ iÊLÕ`}iÌi`ÊÃÞÃÌi°Ê7Ì ÕÌÊiÝVi«Ì]ÊÌ iÞÊ >ÛiÊÃiiÊiÀÃÊÊÃÃÃÊ}Û}°ÊÌÊÌ iÊ Ã>iÊÌi]ÊÃÃÃÊ}Û}ÊVÌÕiÃÊÌÊVÀi>ÃiÊvÀÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ°Ê ÃÃ>ÀÞÊÌiÀ>Ì vviVÌÛiÊÃÃ>ÀiÃÊ`ÊÌÊÜÀÊ`i«i`iÌÞÊÊvÀi}Ê>`ðÊ/ iÞÊ>ÀiÊÃiÌÊLÞÊV ÕÀV iÃÊÌ >ÌÊà >ÀiÊÊÌ iÊLÕÀ`i]ÊÌ iÊÜÀÊ>`ÊÌ iÊÀiÜ>À`ðÊ/ iÊÃiÌÊ>`ÊÌ iÊÃi`iÀÃÊÕÃÌÊ>ÃÜiÀÊ Ì iÊV>ÊvÊÌ iÊÃ>iÊ >ÃÌiÀ]ÊiÛiÊÌ Õ} ÊÌ iÀÊ`ÀiVÌÊvÊÃÌÀÞÊ>ÞÊLiÊ`vviÀiÌ° ÌiÀ>Ì}ÊÃÃ>ÀiÃÊÌÀ>ÛiÊvÀÊV ÕÀV ÊÌÊV ÕÀV ÊÊ>ÊÀi}Õ>ÀÊÃV i`ÕiÊÌÊ«ÀÌiÊà ÃÃÊ>`ÊÀ>ÃiÊÌ iÀÊ«À>ÞiÀÊ>`Êw>V>ÊÃÕ««ÀÌ°ÊÌiÀ>ÌÊÃÊÛÌ>ÊvÀÊ>ÊÃÕVViÃÃvÕÊvÕÀÞi>ÀÊ ÌiÀÊvÊÜÀ`ÊÃÃ>ÀÞÊÃÌÀÞÊ>`ÊÀiµÕÀiÃÊ>LÕÌÊiÊÕÌÊvÊiÛiÀÞÊwÛiÊÞi>ÀÃÊvÊÃiÀÛVi° ÈÇ ÊÃÃiLiÃÊvÊ`ÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊÃÌÀiÃÊ>ÀiÊw>V>ÞÊ`i«i`iÌÊÊV ÌiÌÃÊvÊÌ ÞÊÃÕ««ÀÌÊvÀÊV ÕÀV iÃÊ>`Ê`Û`Õ>Ê`ÀÃ°Ê >V ÊÌiÀ>Ì}ÊÃà >ÀÞÊÃÊ}ÛiÊ>ÊÃÕ««ÞÊvÊVÌiÌÊvÀÃÊLÞÊÌ iÊ1°-°Ê,i>ÌÃÊ i«>ÀÌiÌ°Ê >V Ê`ÀÊÀÊ V ÕÀV ÊÃÊ>Ãi`ÊÌÊV«iÌiÊ>ÊvÀÊ>`ÊÃi`ÊÌÊÌÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃð Ê>``Ì]ÊÌ iÊÃÃ>ÀÞÊÃÊÀiµÕÀi`ÊÌÊÀ>ÃiÊ>ÊV>à ÊLÕ`}iÌÊvÀÊÌ>ÊiÝ«iÃiÃÊvÊv>Ài]Ê vÀi} Ì]Ê`ÕÌÞ]ÊiµÕ«iÌÊ>`Ê>}Õ>}iÊÃÌÕ`Þ°Ê/ iÊV>à ÊLÕ`}iÌÊÃÊÀ>Ãi`ÊLÞÊÃÃÃÊvviÀ}ÃÊ vÀÊV ÕÀV iÃ]ÊVÌÀLÕÌÃÊvÀÊ`Û`Õ>Ê`ÀÃÊ>`Ê>VVÕÕ>Ìi`ÊÃÕ««ÀÌÊvÀÊV}Ê VÌiÌÃ°Ê ÃÃ>ÀiÃÊ>ÀiÊÌÊVi>Ài`ÊvÀÊÌ iÊwi`ÊÕÌÊÌ iÞÊ >ÛiÊÀ>Ãi`ÊÌ iÀÊÀiµÕÀi`Ê LÕ`}iÌ° 7À`ÊiÛ>}iâ>ÌÊÀiµÕÀiÃÊÌi>ÜÀÊLiÌÜiiÊÌ iÊÃi`}ÊV ÕÀV ]ÊÃÃiLiÃÊvÊ`Ê 7À`Ê ÃÃÃÊ>`ÊÌ iÊÃÃ>ÀiÃÊÌÊÃi`ðÊ7iÊÕÃÌÊ>iÊViÀÌ>ÊÌ >ÌÊÃÃ>ÀiÃÊ>ÀiÊÌÊ Ìi`ÊÊÌ iÀÊÃÌÀiÃÊLiV>ÕÃiÊvÊÃÕvwViÌÊ«À>ÞiÀÊ>`Êw>V>ÊÃÕ««ÀÌÊ>ÌÊ i° iiwÌÃÊ/Ê/ iÊ V>Ê ÕÀV UÊÊÀÃÌ]ÊÌ ÃÊ«ÀViÃÃÊ}ÛiÃÊÌ iÊ>ÛiÀ>}iÊV ÕÀV ÊiLiÀÊÌ iÊ««ÀÌÕÌÞÊÌÊLiÞÊÌ iÊÀi>ÌÊ ÃÃÊÌ ÀÕ} Êw>V>Ê}Û}°Ê/ ÃiÊÛÛi`ÊLiViÊ«>ÀÌiÀÃÊÊÀi>V }ÊÌ iÊ ÃÌÊ>ÀÕ`ÊÌ iÊÜÀ`ÊqÊÜÌ ÕÌÊiÛiÀÊi>Û}Ê i° UÊÊ-iV`]ÊÃÃ>ÀÞÊÌiÀ>ÌÊLÀ>`iÃÊÌ iÊLiiÛiÀ½ÃÊ ÀâÃÊvÀÊÃiÀÛVi°Ê/ ÃÊV>ÊLiÊ iÝ«ÀiÃÃi`ÊÌ ÀÕ} ÊL>ÃÃ>`ÀÃÊÊ ÃÃÊ>`Ê *-°Ê-iiÊ«>}iÊ£nÊvÀÊÀiÊ`iÌ>i`Ê vÀ>Ì° UÊÊ/ À`]ÊÌ iÊÃÃ>ÀÞÊÛÃÌÊÌÊÌ iÊV>ÊV ÕÀV ÊVÀi>ÌiÃÊ>Ê>Ü>ÀiiÃÃÊvÊÌ iÊÃÌiÃÃÊvÊ >]ÊvÕÀÌ iÀÊVÀi>Ì}ÊÕÀ}iVÞÊvÀÊÌiÀViÃÃÀÞÊ«À>ÞiÀÊLÞÊÌ iÊV}Ài}>Ì° iiwÌÃÊ/Ê/ iÊ ÃÃ>ÀÞ UÊÀÃÌ]Êw>V>ÊÃÕ««ÀÌÊÃÊÃÌÀ}iÀÊLiV>ÕÃiÊvÊÌ iÊ«iÀÃ>ÊVÌ>VÌ° UÊÊ-iV`]ÊvÀi`à «ÃÊ>ÀiÊLÕÌÊÌ >ÌÊ>ÃÌÊ>ÊviÌi°ÊÊVV>Ã>ÊiÌÌiÀ]ÊV>À`ÊÀÊÃ>Ê}vÌÊ vÀÊ ÀÃÌ>ÃÊ>`ÊLÀÌ `>ÞÃÊÃÊÌ iÊ>``i`ÊÌÕV Êii`i`ÊLÞÊÌ iÊÃÃ>ÀÞÊÜ ÊÃÊv>ÀÊvÀÊ i° UÊÊ/ À`]ÊÌiÀViÃÃÀÞÊ«À>ÞiÀÊÃÊ>LÃÕÌiÞÊiÃÃiÌ>ÊvÀÊÌ iÊÃÕVViÃÃÊ>`ÊÜiLi}ÊvÊÌ iÊà Ã>ÀÞ°Ê/ iÊÃÌÀi}Ì ÊÊÜ}ÊÌ >ÌÊÌ iÀÃÊ>ÀiÊÃÕ««ÀÌ}Ê ÊÀÊ iÀÊÊ«À>ÞiÀÊÃÊi> ÃÕÀ>Li°Ê UÊÊÕÀÌ ]ÊÃÃ>ÀiÃÊÜ>ÌÊÌÊÀi«ÀÌÊÜ >ÌÊ`Ê >ÃÊ`iÊ`ÕÀ}ÊÌ iÀÊ>ÃÌÊÌiÀÊÊÌ iÊwi`°Ê / iÞÊiÞÊ}Û}Ê>ʺà >Ài `iÀÃÊÀi«ÀÌ°» Èn 0!24 !DVANTAGES OF 'IVING 4O -ISSIONS 4HROUGH 4HE ,OCAL #HURCH ÌÊ-iÌÃÊÊ`Ê Ý>«i UÊ iÜÊLiiÛiÀÃÊii`ÊÌÊÜÊÌ iÊ«ÀÌ>ViÊvÊÀi}Õ>ÀÊÃÃÃÊ}Û} UÊ ÕÀV Êi>`iÀÃÊÜ Ê}ÛiÊÌ ÀÕ} ÊÌ iÊV>ÊV ÕÀV ÊÃiÌÊÌ iÊiÝ>«iÊvÀÊÌ iÀÃÊÌÊvÜ ÌÊ VÕÀ>}iÃÊ"Ì iÀÃÊ/Ê*>ÀÌV«>Ìi UÊÊÛ}ÊÌÊÃÃÃÊÌ ÀÕ} ÊÌ iÊV>ÊV ÕÀV ÊÌÛ>ÌiÃÊ>`ÊiVÕÀ>}iÃÊÌ iÀÃÊÌÊ«>ÀÌV «>ÌiÊ ÌÊi«ÃÊ1ÃÊ i>ÃÕÀiÊ,iëÃiÊ/Ê7À`Ê ii` UÊÌÊ}ÛiÃÊ>ÊÌ>}LiÊÜ>ÞÊvÊV >ÀÌ}ÊÜ >ÌÊ>ÊV}Ài}>ÌÊÃÊ`}ÊÌÊÀi>V Ê>ÊÃÌÊÜÀ` UÊÌÊÀiÛi>ÃÊÜ iÌ iÀÊ>ÊV ÕÀV ÊÃÊ`}ÊÌÃÊ«>ÀÌÊvÀÊÜÀ`ÊiÛ>}iâ>Ì ÌÊVÀi>ÃiÃÊ vviVÌÛiiÃÃÊÊ-ÌiÜ>À`à « UÊÊ*}ÊÃÃÃÊÀiÃÕÀViÃÊ>iÃÊÌÊ«ÃÃLiÊvÀÊÌ iÊV}Ài}>ÌÊÌÊÀi>V Ê}>ÃÊÌ >ÌÊ>ÀiÊ Õ>ÌÌ>>LiÊÌÊ`Û`Õ>à UÊ/ iÀiÊÃÊÃÌÀi}Ì ÊÊÕÌÞ ÌÊ- ÜÃÊ w`iViÊÊ/ iÊ i>`iÀà «Ê`Ê ÃÃÃÊ"ÕÌÀi>V ÊÊ "vÊ/ iÊ ÕÀV UÊ ÃÃÃÊi>`iÀÃÊ«À>ÞiÀvÕÞÊVÃ`iÀÊ>««i>ÃÊvÀÊÌ ÞÊÃÕ««ÀÌÊ>`Ê«ÀiVÌÊii`à UÊ/ iÞÊ>ÀiÊLiÌÌiÀÊvÀi`Ê>`ÊÌ iÀivÀiÊ>LiÊÌÊ>iÊLiÌÌiÀÊ`iVÃà ÌÊ >LiÃÊ/ iÊ ÕÀV Ê/ÊVÀi>ÃiÊÌÃÊ*i`}iÃÊ/Ê ÃÃ>ÀiÃÊ`Ê``Ê iÜÊ ÃÃ>ÀiÃÊ >V Ê9i>À Û}Ê/ÊÃÃiLiÃÊ"vÊ`Ê7À`Ê ÃÃÃÊ"vviÀÃÊ/ iÊ iÃÌÊÊ VVÕÌ>LÌÞ UÊ"ÞÊxÊ«iÀViÌÊÃÊ`i`ÕVÌi`ÊvÀÊ>`ÃÌÀ>ÌÛiÊVÃÌà UÊ/ ÃÊi>ÃÊÌ >ÌÊxÊ«iÀViÌÊvÊvviÀ}ÃÊ>ÀiÊëiÌÊ>ÃÊ`iÃ}>Ìi` UÊ ÛiÀÞÊÃÃ>ÀÞÊÕÃÌÊÃÕLÌÊ`iÌ>i`ÊÀi«ÀÌÃÊvÊ>Êëi`} UÊ/ iÀiÊÃÊÊ } iÀÊiÛiÀÊvÊw>V>Ê>VVÕÌ>LÌÞ iiÛiÀÃÊ7 ÊÛiÊ/ÊÃÃiLiÃÊ"vÊ`Ê ÃÃÃÊ >Ê iÊ w`iÌÊÊ "vÊ/ iÊ ÃÌÀÞ½ÃÊÌi}ÀÌÞÊ UÊ"«iÀ>Ì>ÊiÝ«iÃiÃÊ>ÀiÊi«ÌÊ>ÌÊ>ÊÕ UÊ >V Ê«ÀiVÌÊÃÊ>Ê}ÌiÀÊÛiÃÌiÌ È iiÛiÀÃÊ >Ê iÊ-ÕÀiÊ"vÊ/ iÊ ÃÃ>ÀiýÊÌi}ÀÌÞÊ UÊ/ÊLiÊ}`ÊÃÌiÜ>À`Ã]ÊLiiÛiÀÃÊÕÃÌÊÜÊÜ ÊÌ iÞÊÃÕ««ÀÌ UÊÊ ÛiÀÞÊÃÃ>ÀÞÊÃÊ}ÛiÊVÃiÊÃVÀÕÌÞÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ º ÕÌÊÜiÊLiÃiiV ÊÞÕ]ÊLÀiÌ Ài]ÊÌÊÜÊÌ iÊÜ Ê>LÀÊ>}ÊÞջʣÊ/ iÃÃ>>ÃÊx\ £Ó]Ê-6® ÌÊÃÊ/ iÊ-«iÃÌ]Ê ÃÌÊ vviVÌÛiÊ7>ÞÊ/ÊÛiÊ/Ê ÃÃà UÊÌÊÃÊVÛiiÌÊÌÊ}ÛiÊÃÃÃÊvviÀ}ÃÊ>ÌÊ>Ê-Õ`>ÞÊÃiÀÛVi UÊÌÊiVÕÀ>}iÃÊVÃÃÌiVÞÊ>`ÊÀi}Õ>ÀÌÞ UÊÌÊi>ÌiÃÊÌ iÊ«ÃÃLÌÞÊvÊvÀ}iÌÌ}ÊÌÊ>Ê>ÊvviÀ} ÌÊ>ÃÊ LV>Ê*ÀiVi`iVi º"ÊiÛiÀÞÊ À`½ÃÊ >ÞÊi>V ÊvÊÞÕÊà Õ`Ê«ÕÌÊ>Ã`iÊÃiÌ }ÊvÀÊÜ >ÌÊÞÕÊ >ÛiÊi>Ài`Ê `ÕÀ}ÊÌ iÊÜii]Ê>`ÊÕÃiÊÌÊvÀÊÌ ÃÊvviÀ}oÊ ½ÌÊÜ>ÌÊÕÌÊÊ}iÌÊÌ iÀiÊ>`ÊÌ iÊÌÀÞÊÌÊ ViVÌÊÌÊ>Ê>ÌÊVi°ÊÊ7 iÊÊViÊÊÜÊÃi`ÊÞÕÀÊÛ}Ê}vÌÊÜÌ Ê>ÊiÌÌiÀÊÌÊiÀÕÃ>i»Ê£Ê ÀÌ >ÃÊ£È\Ó]Î]Ê/ ®° 0!24 (OW $OES 4HE 3YSTEM 7ORK UÊÊ"ViÊ>ÊÃÃ>ÀÞ½ÃÊVÕÌÀÞÊvÊ>ÃÃ}iÌÊÃÊ`iÌiÀi`]Ê>ÊLÕ`}iÌÊÃÊ«Ài«>Ài`ÊLÞÊÃÃi LiÃÊvÊ`Ê7À`Ê ÃÃÃ°Ê >V ÊÃÃ>ÀÞÊÕÃÌÊ >ÛiÊÃÕvwViÌÊV>à Ê>`ÊÃ}i`ÊV ÌiÌÊvÀÃÊvÀÊV>ÊV ÕÀV iÃÊ>`Ê`Û`Õ>ÃÊÌÊVÛiÀÊÌ iÊvÕÊLÕ`}iÌÊLivÀiÊVi>À >ViÊÜÊLiÊ}ÛiÊÌÊ«ÀVii`ÊÌÊÌ iÊwi`°ÊÊ UÊ/ iÊ>ÛiÀ>}iÊV>``>ÌiÊLÕ`}iÌÊÃÊ>LÕÌÊfx]ÓääÊÌ Þ°Ê UÊÊ/ iÊÃÃ>ÀÞÊÕÃÌÊÀ>ÃiÊfxääÊÊÌ ÞÊVÌiÌÃÊLivÀiÊ}}ÊÊÌ ÞÊÊ >Ü>Vi°Ê UÊÊ ÃÃ>ÀiÃÊÛÃÌÊV ÕÀV iÃÊÌÊV >i}iÊ«i«iÊvÀÊÃÃÃ]ÊÀ>ÃiÊiViÃÃ>ÀÞÊV>à ÊvviÀ}ÃÊ >`ÊÃiiÊÌ ÞÊÃÕ««ÀÌ°Ê/ iÊ«>ÃÌÀÊ>ÞÊà >ÀiÊÌ ÃÊii`ÊÜÌ ÊÌ iÊvwV>ÊL>À`ÊÀÊÌ iÊ ÃÃÃÊVÌÌiiÊvÀÊ>Ê`iVÃÊÜ iÌ iÀÊ>ÊÌ ÞÊVÌiÌÊV>ÊLiÊ>`iÊ>`ÊÊ Ü >ÌÊ>ÕÌ° UÊÊ ÕÀV iÃÊ>`Ê`Û`Õ>Ê`ÀÃÊÃi`ÊÌ ÞÊVÌiÌÃÊÌÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃðÊ7 iÊÃÕvwViÌÊVÌiÌÃÊ>ÀiÊÀiVÀ`i`]ÊÌ iÊÃÃ>ÀÞÊÃÊ}À>Ìi`ÊVi>À>ViÊ ÌÊi>ÛiÊvÀÊÌ iÊwi`°Ê iÃ}>Ìi`ÊvviÀ}ÃÊÃiÌÊÌÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÜÊ LiÊ«>Vi`ÊÊÌ iÊÃÃ>ÀÞ½ÃÊ>VVÕÌÊLÕÌÊÜÊÌÊLiÊÀiVÀ`i`Ê>ÃÊ>ÊÌ ÞÊVÌiÌÊ ÀÊVÕÌi`ÊvÀÊVi>À>ViÊÕiÃÃÊ>ÊVÌiÌÊvÀ]ÊÃ}i`ÊLÞÊÌ iÊV>ÊV ÕÀV ]Ê >ÃÊLiiÊ ÀiViÛi`ÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃ°Ê UÊÊ ÃÌÊÃÃ>ÀÞÊV>``>ÌiÃÊÀiµÕÀiÊÕ«ÊÌÊ£xÊÌ ÃÊvÊÌiÀ>ÌÊÌÊV«iÌiÊÌ iÀÊ LÕ`}iÌ° UÊ/ iÊV>``>ÌiÊÃÃ>ÀÞÊÜÊÛÃÌÊ>Ê>ÛiÀ>}iÊvÊ£ÎäÊV ÕÀV iÃÊ`ÕÀ}ÊÌiÀ>Ì° UÊ/ iÊ>ÛiÀ>}iÊÌ ÞÊVÌiÌÊ>`iÊÌÊÌ iÊÃÃ>ÀÞÊLÞÊÌ iÊV>ÊV ÕÀV ÊÃÊfxÎ°Ê Çä ÃÃ>ÀÞÊ ÌiÌÊÀà ÛiÀÞÊÃÃ>ÀÞÊÃÊ}ÛiÊ>ÊLÕ`}iÌ]ÊÌ>Ài`ÊÌÊÌ iÊVÕÌÀÞÊvÊ ÃÊÀÊ iÀÊ>ÃÃ}iÌÊ>`Ê ÃÌÀÞ°Ê i>À>ViÊÌÊi>ÛiÊvÀÊÌ iÊwi`ÊV>ÌÊLiÊ}ÛiÊÕÌÊÌ iÊLÕ`}iÌÊÃÊÀ>Ãi`° 6iÀL>ÊVÌiÌÃÊÌÊÌ iÊÃÃ>ÀÞÊ>ÀiÊÌÊÃÕvwViÌ°ÊÊÌ ÞÊVÌiÌÃÊÌÊà Ã>ÀiÃÊà Õ`ÊLiÊVÕV>Ìi`ÊÌÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÊÌ iÊ>««À«À>ÌiÊ VÌiÌÊvÀ°Ê iÊÃÕÀiÊÌÊV«iÌiÊ>ÊvÊÌ iÊvÀ>ÌÊÊÌ iÊvÀ°Ê ii«Ê>ÊV«ÞÊvÀÊ ÞÕÀÊwiÃÊ>`Ê>ÊÌ iÊÀ}>ÊVÌiÌÊvÀÊÌÊÜÀ`ÊÃÃÃÊÀÊ}ÛiÊÌÊÌÊÌ iÊÃà >ÀÞ°ÊvÊÞÕÊÕÃiÊÌ iÊ}ÊVÌiÌÊvÀ]ÊëÞÊÀiÛiÊÌ iÊÌ«Ê«>ÀÌÊvÀÊÞÕÀÊwið 7 iÊ7À`Ê ÃÃÃÊÀiViÛiÃÊÌ iÊvÀ]ÊÌÊÃÊ«ÃÌi`ÊÌÊLÌ ÊÌ iÊV ÕÀV ½ÃÊ>`ÊÌ iÊà Ã>ÀÞ½ÃÊÀiVÀ`ðÊ/ iÊÃÃ>ÀÞÊÃÊÌÊVi>Ài`ÊÌÊ}ÊÌÊÌ iÊwi`ÊÕÌÊ ÃÊÀÊ iÀÊLÕ`}iÌÊÃÊ V«iÌiÞÊÀ>Ãi`Ê>VVÀ`}ÊÌÊ7À`Ê ÃÃÃÊÀiVÀ`Ã°Ê Ì ÞÊVÌiÌÃÊà Õ`ÊLi}Ê i`>ÌiÞÊÀ>Ì iÀÊÌ >ÊÜ>Ì}ÊvÀÊÌ iÊÃÃ>ÀÞÊÌÊ}ÊÌÊÌ iÊwi`° 7 iÊÌ iÊVÌiÌÊvÀÊÃÊÃiÌÊÌÊ7À`Ê ÃÃÃ]ÊÌÊÃÊÀiVÀ`i`Ê>ÃÊ>ÊwÀÊÌ ÞÊÃÕ« «ÀÌ°Ê"ViÊÌ iÊÌ ÞÊVÌiÌÃÊÀi>V ÊÌ iÊLÕ`}iÌÊÌÌ>]ÊÌ iÊÃÃ>ÀÞÊÃÊ}ÛiÊVi>À>ViÊ ÌÊi>ÛiÊvÀÊÌ iÊwi`° ÌÊÃÊ i«vÕÊvÀÊV ÕÀV iÃÊÌÊ>iÊÌ iÀÊVÌiÌÃÊ>ÃÊÃÊ>ÃÊ«ÃÃLiÊÊÀ`iÀÊÌÊà ÀÌiÊ ÌiÀ>ÌÊÌi°Ê-iÊV ÕÀV iÃÊ>iÊ>ÊVÌiÌÊÌÊ>ÊiÜÊÃÃ>ÀiÃÊvÀÊÌ iÀÊ`ÃÌÀVÌÊ >ÃÊÃÊ>ÃÊÌ iÞÊ>ÀiÊ>««ÀÛi`° Ç£ ÃÃ>ÀÞÊ ÌiÌÊ iÀÌwV>Ìià 1«ÊÀiVi«ÌÊvÊÌ iÊÃ}i`ÊVÌiÌÊvÀ]ÊÜÀ`ÊÃÃÃÊ«iÀÃiÊiÌiÀÊÌ iÊVÌ iÌÊ>ÕÌÊÌÊÌ iÊÃÃ>ÀÞ½ÃÊÃÕ««ÀÌÊÃÌÊ>`ÊÃi`Ê>ÊVÌiÌÊViÀÌwV>ÌiÊÌÊÌ iÊV>Ê V ÕÀV °Ê/ iÃiÊViÀÌwV>ÌiÃÊ>ÀiÊi>ÌÊÌÊLiÊ`ë>Þi`ÊÊ>Ê«ÀiÌÊ«>ViÊÌÊÀi`ÊÌ iÊV }Ài}>ÌÊvÊÌ iÀÊÃÃ>ÀÞÊ«>ÀÌiÀÃÊ>`ÊÌÊvÌÊÌ iÊÕ«ÊÊ«À>ÞiÀ°Ê >ÞÊV ÕÀV iÃÊ«Ài«>ÀiÊ>ÊëiV>Ê>Ài>ÊÌÊ`ë>ÞÊÌ iÊVÌiÌÊViÀÌwV>ÌiÃÊ>`ÊÃÃ>ÀÞÊ iÜÃiÌÌiÀðÊ"Ì iÀÊV ÕÀV iÃÊ`ë>ÞÊÌ iÊViÀÌwV>ÌiÃÊÊÌ iÊÃ>VÌÕ>ÀÞÊÜ>Ã]Ê>}ÊÌÊ«ÃÃLiÊ vÀÊiLiÀÃÊÌÊ}ÊÌÊÌ iÊViÀÌwV>ÌiÃÊ>`ÊÌiÀVi`iÊvÀÊÌ iÊÃÃ>ÀiÃÊ`ÕÀ}Ê«À>ÞiÀÊÌi° ÇÓ -i`}Ê ÃÃ>ÀÞÊ-Õ««ÀÌ "ViÊ>ÊVÌiÌÊÃÊ>`i]Ê>ÊvviÀ}ÊvÀÊÜÊLiÊÃiÌÊÌÊÌ iÊ`À°Ê/ ÃÊVÌ>ÃÊÌ iÊ >i]Ê>VVÕÌÊÕLiÀÊ>`Ê>ÕÌÊvÊÌ iÊVÌiÌ°Ê/ iÊvviÀ}Êà Õ`ÊLiÊÃiÌÊi>V Ê Ì ]ÊÃViÊÌ iÊÃÃ>ÀÞÊ`i«i`ÃÊÊÌ >ÌÊÃÕ««ÀÌÊvÀÊ ÃÊÀÊ iÀÊÛi `° ÃÌÊV ÕÀV iÃÊÃi`ÊÌ iÀÊÃÃÃÊvviÀ}ÃÊ`ÕÀ}ÊÌ iÊwÀÃÌÊviÜÊ`>ÞÃÊvÊi>V ÊÌ ]ÊÀiyiVÌ }ÊÌ iÊ}Û}ÊvÊÌ iÊ«ÀiÛÕÃÊÌ °Ê-i`}ÊÌ iÊvviÀ}ÊÊÌ iÊÃ>iÊ`>ÌiÊi>V ÊÌ Ê>iÃÊ ÌÊi>ÃiÀÊÌÊÀiiLiÀ° >V ÊÌ ÊÃÃ>ÀiÃÊÀiViÛiÊ>ÊÃÌÊvÊV>à ÊÀiVi«ÌÃ]Êà Ü}ÊÌ iÊ>iÃÊvÊ>Ê`ÀÃ]Ê Ì iÀÊ>``ÀiÃÃiÃ]ÊÌ iÊ>ÕÌÃÊÌ iÞÊ}>ÛiÊ>ÃÌÊÌ Ê>`ÊÌ iÊÌÌ>Ê}ÛiÊÌÊ`>ÌiÊvÀÊÌ iÊV>i`>ÀÊ Þi>À° vÊ«ÃÃLi]ÊiVÃiÊÌ iÊLÕi>`Ü ÌiÊvviÀ}ÊvÀÊÜÌ Êi>V ÊÌ ½ÃÊvviÀ}°Ê-iiÊÃ>«iÊ >ÌÊÌ iÊi`ÊvÊÌ iÃiÊ}Õ`iið®ÊÊiÜÊ`ÀÊÃi`}ÊÃÃÃÊvviÀ}ÃÊvÀÊÌ iÊwÀÃÌÊÌiÊÜÊ ÌÊ >ÛiÊ>ÊvviÀ}ÊvÀ°Ê-«ÞÊÃÌÊÊ>ÊiÌÌiÀÊi>V ÊÃÃ>ÀÞ½ÃÊ>i]Ê>VVÕÌÊÕLiÀÊvÊ Ü®]Ê>`ÊÌ iÊ>ÕÌÊvÊÌ iÊvviÀ}ÊvÀÊi>V °Ê7ÀÌiÊÞÊiÊV iVÊvÀÊÌ iÊiÌÀiÊ>ÕÌ°Ê ÊÀiVi«ÌÊ>`Ê«Ài«ÀÌi`ÊvviÀ}ÊvÀÊÜÌ ÊiÛi«iÊÜÊLiÊÃiÌÊÜ iÊÌ iÊvviÀ}ÊÃÊ«À ViÃÃi`° ÕÀV Êi>`iÀÃÊà Õ`ÊVV>Ã>ÞÊÀiÛiÜÊÌ iÊiÞÊLi}ÊÃiÌÊÌÊiÃÕÀiÊÌ >ÌÊÊÃà >ÀÞÊ >ÃÊLiiÊÛiÀi`°Ê ÛiÀÞÊivvÀÌÊà Õ`ÊLiÊ>`iÊÌÊ>Ì>Êi>V ÊÌ ÞÊVÌiÌ°Ê / iÊÃÃ>ÀiÃÊ`i«i`ÊÊÌ iÃiÊvÕ`Ã]Ê>`ÊÀi«>V}ÊÃÌÊÃÕ««ÀÌÊÜ iÊÛiÀÃi>ÃÊÃÊ`vwVÕÌ°Ê /Ê`ÃVÌÕiÊÃÕ««ÀÌÊvÀÊ>ÊÃÃ>ÀÞÊÜ Ê >ÃÊÌiÀ>Ìi`Ê ÃÊÀÊ iÀÊÃÃÃÊ>««ÌiÌ]Ê Ã«ÞÊ>ÀÊÕÌÊÌ iÊ>iÊÊÌ iÊvviÀ}ÊvÀÊÃiÌÊLÞÊÜÀ`ÊÃÃð 7 iÊw>ViÃÊ>ÀiÊà ÀÌ]ÊVÃ`iÀÊÌ iÊ«ÌÃÊ>Û>>LiÊÌÊÞÕ°ÊÊÃÃÃÊVÛiÌ]ÊÕà }ÊÌ iÊv>Ì Ê«ÀÃiÊÃÞÃÌi]ÊÜÊi>ÀÞÊ>Ü>ÞÃÊ}iiÀ>ÌiÊ>``Ì>ÊVi°Ê ÇÎ >}iÃÊÊÌ ÞÊVÌiÌÃÊ>`iÊÊÌ iÊLÕi>`Ü ÌiÊvviÀ}ÊvÀÊ}iiÀ>ÞÊ`Ê ÌÊÀi>V ÊÌ iÊÜÀ`ÊÃÃÃÊvwVi°Ê/ iÃiÊvÀÃÊ>ÀiÊ«ÀViÃÃi`ÊLÞÊÌ iÊiiÀ>Ê ÕVÊ>VVÀ` }ÊÌÊÃÌ>`>À`Ê«ÀVi`ÕÀi°Ê >}iÃÊÊ`>ÀÊ>ÕÌÃÊÀÊ>``Ì>ÊVÌiÌÃÊà Õ`ÊLiÊ VÕV>Ìi`ÊÌÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÊ«Ê«i`}iÊvÀð >}ÊViÊÃiÛiÀ>ÊÌ ÃÊ>vÌiÀÊ>ÊÃÃÃÊVÛiÌÊÕÃÕ>ÞÊÃÊ>Ê`V>ÌÊÌ >ÌÊà ÃÃÊiÌ ÕÃ>ÃÊÃÊÌÊLi}Ê>Ì>i`°Ê-iiÊÌ iÊ>Õ>ÊvÀÊ/ iÊ Õi«ÀÌ]Ê Õ`}Ê Ã ÃÃÊ6Ão Ì ÊLÞÊ Ì ]ÊvÀÊ`i>ÃÊÊ>Ì>}ÊviÀÛÀÊ>`Ê`i`V>ÌÊÌÊÃÃð -iÌiÃÊÃÃÃÊViÊ`iViÃÊ`ÕiÊÌÊÌ iÊ`i«>ÀÌÕÀiÊvÊ`ÀÃÊÀÊ>ÊiVVÊ`Ü ÌÕÀÊÊ>ÊVÕÌÞ°Ê/ÀÞÊÌÊÌÊ`À«Ê>ÊÃÃ>ÀÞÊVÌiÌÊÕÌÊÌ iÊÃÃ>ÀÞÊ >ÃÊ ÀiÌÕÀi`Ê i°ÊÊÌ iÊÜÀÃÌÊV>Ãi]Ê«ÀÀ>ÌiÊÌ iÊ>Û>>LiÊiÃÊ>}ÊÌ iÊÃÃ>ÀiÃÊÌ iÊ V ÕÀV ÊÃÕ««ÀÌÃÊ>`ÊÜÀÌiÊÌÊi>V Êi]ÊÌi}ÊÌ iÊvÊÌ iÊ«ÀLi°Ê/ iÊÃÃ>ÀiÃÊV>ÊÌ iÊ «À>ÞÊ>LÕÌÊÌ iÊw>V>Êii`ÃÊvÊÌ iÊV}Ài}>ÌÊ>`ÊÜÊLiÊÀiiÛi`ÊÌÊÜÊÌ iÊÀi>ÃÊvÀÊ Ì iÊV >}i° Ç{ ->«iÊ"vviÀ}ÊÀ Çx 0!24 7HERE $OES 4HE -ONEY 'O 7 iÊ«i«iÊ i>ÀÊ ÜÊÕV ÊiÞÊ>ÊÃÃ>ÀÞÊÕÃÌÊÀ>Ãi]ÊÌ iÀÊÀiëÃiÊÃÊvÌi]ʺ7 ÞÊ `ÊÌ iÞÊ>iÊÃÊÕV ÊiÞ¶Ê ÞÊÃ>>ÀÞÊýÌÊÌ >ÌÊÕV t» / iÊ>ÃÜiÀÊÃ]ÊÌ iÞÊ`½ÌÊÀiµÕÀiÊÌ >ÌÊÕV ÊiÞÊvÀÊÌ iÀÊ«iÀÃ>ÊÃÕ««ÀÌ°ÊÃÌi>`]ÊÌ iÊ ÃÃ>ÀÞÊLÕ`}iÌÊÃÊ`Û`i`ÊÌÊÌÜÊ«>ÀÌÃ\Ê>Ê«iÀÃ>ÊLÕ`}iÌÊ>`Ê>ÊÜÀÊLÕ`}iÌÊÌ >ÌÊÃÊiµÕ>Ê ÌÊÌ iÊ>Õ>ÊLÕ`}iÌÊvÊ>ÞÊV ÕÀV iÃÊÊÌ iÊ1Ìi`Ê-Ì>Ìið >V ÊÃÃ>ÀÞÊÀiµÕÀiÃÊV>à ÊvÀÊÌÀ>ëÀÌ>ÌÊÌÊÌ iÊwi`Ê>`ÊvÀÊiÝ«iÃiÃÊVÕÀÀi`ÊÊ ÃiÌÌ}ÊÕ«Ê>Ê i°Ê/ iÊÌ ÞÊVÌiÌÊLÕ`}iÌÊVÛiÀÃÊ>ÊvÊÌ iÀÊiÝ«iÃiÃÊ`ÕÀ}ÊÌ iÀÊ ÌiÀÊÊÌ iÊwi`°Ê / iÊvÜ}ÊV >ÀÌÊà ÜÃÊÌ iÊÛ>ÀiÌÞÊvÊiÝ«iÃiÃÊVÕ`i`ÊÊÌ iÊÃÃ>ÀÞÊLÕ`}iÌ° ÃÃ>ÀiÃÊÜÀ}ÊÊ>À}iÊ«ÀiVÌÃÊ >ÛiÊ>ÊÌ À`Ê`ÛÃÊÊÌ iÀÊLÕ`}iÌÊÌÊ`V>ÌiÊ «ÀiVÌÃÊvÀÊÜ V ÊÌ iÞÊ>ÀiÊ>««ÀÛi`ÊÌÊÀ>ÃiÊvÕ`ðÊ/ iÀÊVi>À>ViÊÌÊÀiÌÕÀÊÌÊÌ iÊwi`ÊÃÊÌÊ `i«i`iÌÊÕ«ÊÌ iÊV«iÌÊvÊÌ iÃiÊvÕ`ð ÇÈ 0!24 !DDITIONAL &ACTS !BOUT -ONTHLY #OMMITMENTS ÃÜiÀÃÊ/ÊÀiµÕiÌÞÊÃi`Ê+ÕiÃÌÃÊLÕÌÊ Ì ÞÊ-Õ««ÀÌ ÕÀV iÃÊ>`Ê`Û`Õ>Ê`ÀÃÊà Õ`ÊÃÌ>ÀÌÊÃi`}ÊÌ iÀÊÌ ÞÊVÌiÌÃÊ>ÃÊÃÊ>ÃÊ «ÃÃLi°Ê ÃÃ>ÀÞÊV>``>ÌiÃÊÀiViÛiÊÌ ÞÊÃÕ««ÀÌÊ>ÃÊÃÊ>ÃÊÌ iÞÊLi}ÊÌiÀ>Ì]Ê>`Ê ÛiÌiÀ>ÊÃÃ>ÀiÃÊVÌÕiÊÌÊÀiViÛiÊÃÕ««ÀÌÊvÀÊÌ iÀÊ>VVÕÌÊÜ iÊÊÌ iÊ1Ìi`Ê-Ì>ÌiÃ°Ê ÊÌ ÞÊVÌiÌÊà Õ`ÊLiÊ>`iÊvÀÊ>Ê«iÀ`ÊvÊiÃÃÊÌ >ÊwÛiÊÞi>ÀðÊ/ ÃÊÜÊ>ÜÊ Ì iÊÃÃ>ÀÞÊÌÊV«iÌiÊ ÃÊÀÊ iÀÊÌiÀ>Ì]ÊÃiÀÛiÊvÕÀÊÞi>ÀÃÊÛiÀÃi>ÃÊ>`ÊÀiÌÕÀÊÌÊÌ iÊ 1Ìi`Ê-Ì>ÌiÃÊvÀÊ>Ì iÀÊÞi>ÀÊvÊÌiÀ>Ì°Ê ÃÌÊV ÕÀV iÃ]Ê ÜiÛiÀ]Ê>iÊVÌiÌÃÊ ÜÌ ÊÌ iÊÌiÌÊvÊVÌÕ}ÊÃÕ««ÀÌÊ>ÃÊ}Ê>ÃÊÌ iÊÃÃ>ÀÞÊÃÊÕ`iÀÊ>««ÌiÌ°Ê ÀÃÊV>ÊVÀi>ÃiÊÌ iÊ>ÕÌÊvÊÌ iÀÊVÌiÌÃÊLÞÊV«iÌ}Ê>ÊiÜÊVÌiÌÊ vÀ°Ê/ iÞÊ>ÞÊ>ÃÊÌvÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊLÞÊiÌÌiÀ]Êv>Ý]Êi>ÊÀÊ« i]Ê ÕÌ}ÊÌ iÊV >}iÊÊÌ iÀÊVÌiÌðÊ/ iÞÊà Õ`ÊÀiyiVÌÊÌ iÊVÀi>Ãi`Ê>ÕÌÊÊÌ iÀÊ vviÀ}ÊvÀÊÜ iÊÌ iÞÊÃi`ÊÌ iÀÊvviÀ}ÊÌ iÊiÝÌÊÌ ° vÊVÀVÕÃÌ>ViÃÊ>iÊÌÊ«ÃÃLiÊvÀÊ>ÊV ÕÀV ÊÀÊ`Û`Õ>ÊÌÊ ÀÊ>ÊVÌiÌ]ÊÌ iÞÊ Ã Õ`ÊÌvÞÊÌ iÊÃÃ>ÀÞÊ>`ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>ÃÊÃÊ>ÃÊ«ÃÃLi°Ê 7À`ÊÃÃÃÊÜÊV >}iÊÌ iÊÀiVÀ`ÃÊÌÊÀiyiVÌÊÌ Ã°Ê ÕÀV ÊLÕ`}iÌÃÊÃiÌiÃÊÀiµÕÀiÊÀiiÛ>Õ>Ì]Ê>`ÊÃiÊVÌiÌÃÊÕÃÌÊLiÊ`iVÀi>Ãi`°ÊÊ / iÊV ÕÀV ÊV>Ê`iÌiÀiÊÜ V ÊÃÃ>ÀÞÊVÌiÌÃÊV>ÊLiÊV >}i`ÊÜÌ ÊÌ iÊi>ÃÌÊ >ÕÌÊvÊ`iÌÀiÌÊÌÊÌ iÊÃÃ>ÀÞÊ«À}À>ÊLÞÊVÌ>VÌ}ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>`ÊÀiµÕiÃÌ}Ê>Êw>V>Ê>>ÞÃÃÊÌÊ>ÃÃÃÌÊÊ>}Ê`iVÃÃÊÌ >ÌÊÜÊ>vviVÌÊ VÌiÌÊV >}iðÊ/ iÊÀi«ÀÌÊ«>ViÃÊÌ iÊ`À½ÃÊÃÃ>ÀÞÊÃÌÊÊÌ ÀiiÊV>Ìi}ÀiÃ\ÊÊÕÀ }iÌ]Ê`iÀ>ÌiÊÀÊw>V>ÞÊÃÌ>Li°ÊÊ"vÊVÕÀÃi]ÊÌ iÊw>Ê`iVÃÊÀi>ÃÊÜÌ ÊÌ iÊ`À°ÊvÊ ÌÊLiViÃÊiViÃÃ>ÀÞÊÌÊ`iVÀi>ÃiÊ>ÊÃÃ>ÀÞ½ÃÊÃÕ««ÀÌ]ÊÌÀÞÊÌÊ>iÊÌ iÊ>`ÕÃÌiÌÊÜ iÊÌ iÊ ÃÃ>ÀÞÊÃÊÊÌ iÊ1Ìi`Ê-Ì>ÌiÃÊvÀÊÌiÀ>Ì°Ê/ ÃÊÜÊ}ÛiÊ ÊÀÊ iÀÊÌ iÊ««ÀÌÕÌÞÊÌÊ Ài«>ViÊÌ iÊÃÌÊVÌiÌÊiÃiÜ iÀi° -iÌiÃÊ>ÊV ÕÀV Ê >ÃÊ>ÊÃÕÀ«ÕÃÊvÊvÕ`ÃÊÊÌÃÊÃÃÃÊ>VVÕÌ°Ê- Õ`ÊÌÊVÀi>ÃiÊÌÃÊ }Û}ÊÌÊ>ÊÃÃ>ÀiÃÊÊÌÃÊÃÕ««ÀÌÊÃÌÊÀÊÌÊëiVwVÊiöÊ"ÀÊà Õ`ÊÌÊ>``ÊÃÃ>À iÃÊÌÊÌÃÊÃÕ««ÀÌÊÃÌ¶Ê iVÊÜÌ ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃðÊ-iÊÃÃ>ÀiÃÊ>ÞÊ ÕÀ}iÌÞÊii`Ê>ÊVÀi>ÃiÊÊÌ ÞÊÃÕ««ÀÌ]ÊÜ iÊÌ iÀÃÊ>ÞÊ >ÛiÊ>`iµÕ>ÌiÊÃÕ««ÀÌ°Ê7À`Ê ÃÃÃÊ«iÀÃiÊÀÊÌ iÊ 9 ÊV>Ê«ÀÛ`iÊ>iÃÊvÊÃÃ>ÀiÃÊVÕÀÀiÌÞÊii`}Ê>``Ì >ÊÃÕ««ÀÌ° "VV>Ã>ÞÊV>ÊV ÕÀV ÊÀiVÀ`ÃÊ>ÀiÊÃÌ°Ê ÕÀV iÃÊ>ÞÊÀiµÕiÃÌÊ>ÊiÜÊÃÌÊvÊÌ ÞÊV ÌiÌÃÊvÀÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃðÊvÊ>ÊV ÕÀV ÊÃÊÃÃ}ÊVÌiÌÊViÀÌw V>ÌiÃÊvÀÊÃÃ>ÀiÃÊÌÊÃÕ««ÀÌÃ]ÊÀÊvÊÕ«`>Ìi`ÊViÀÌwV>ÌiÃÊ>ÀiÊii`i`]Ê`½ÌÊ`ië>À°Ê*ÀÛ`iÊ ÜÀ`ÊÃÃÃÊÜÌ ÊÌ iÊ>iÃÊvÊÌ iÊÃÃ>ÀiÃÊvÀÊÜ ÊÞÕÊii`ÊiÜÊViÀÌwV>ÌiÃÊ>`ÊÌ iÊ VÕÀÀiÌÊ>ÕÌÊÃiÌÊÌ ÞÊvÀÊi>V ÊÃÃ>ÀÞ° 7 >ÌÊ >««iÃÊÜ iÊ>ÊÃÃ>ÀÞÊ`iöÊ7 iÊ>ÊÃÃ>ÀÞÊ`iÃ]Ê>Ê`i>Ì ÊÌViÊ>««i>ÀÃÊÊ /`>Þ½ÃÊ*iÌiVÃÌ>Ê Û>}i° ÇÇ 7 >ÌÊvÊ>ÊÃÃ>ÀÞÊÌiÀ>ÌiÃÊ ÃÊÀÊ iÀÊÃÃ>ÀÞÊV>ÀiiÀÊÀÊÀiÌÀiöÊ7 iÊ>ÊÃà >ÀÞÊÌiÀ>ÌiÃÊ ÃÊÀÊ iÀÊÃÃ>ÀÞÊV>ÀiiÀÊÀÊÀiÌÀiÃ]ÊiÌÌiÀÃÊ>ÀiÊÃiÌÊÌÊvÀÊ`ÀÃÊvÊÌ iÊ V >}iÊÊÃÌ>ÌÕð vÊ>ÊV ÕÀV ÊÀÊ`Û`Õ>Ê`ÀÊv>ÃÊLi `ÊÊÃi`}ÊÌ ÞÊVÌiÌÃ]ÊÃÊÌÊ«ÃÃLiÊ ÌÊV iVÊ ÜÊÕV Ê >ÃÊLiiÊ}Ûi¶Ê7À`ÊÃÃÃÊ«iÀÃiÊV>ÊV iVÊÌ ÃÊÀÊ ÌÀLÕÌÀÊ -iÀÛViÃÊV>Ê«ÀÛ`iÊ>ÊV«iÌiÊÀiVÀ`ÊvÊ>Ê}Û}ÊÌÊÃÃiLiÃÊvÊ`ÊÃÌÀið vÊ>Ê`ÀÊV>ÌÊ>iÊÕ«ÊÌ iÊà ÀÌv>ÊÊ}Û}ÊLÕÌÊÜà iÃÊÌÊVÌÕiÊÃÕ««ÀÌ}Ê>Êà Ã>ÀÞ]Ê iÊÀÊà iÊV>ÊLi}ÊÃÕ««ÀÌÊÜÌ ÊÌ iÊVÕÀÀiÌÊÌ Ê>`ÊVÌÕiÊvÀÊÌ >ÌÊÌiÊ vÀÜ>À`Ê>ÃÊÌ iÊ À`Ê«ÀÛ`ið ÃÌvÛ}Ê >} >V ÊÞi>À]ÊÕÃÕ>ÞÊÊ"VÌLiÀ]ÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÃi`ÃÊ>ÊVÃÌvÛ}Ê >}°Ê/ iÊ«ÕÀ«ÃiÊvÊÌ iÊ«>ViÌÊÃÊÌ Àiiv`\ £°ÊÊ/Ê}ÛiÊV ÕÀV iÃÊ>Ê««ÀÌÕÌÞÊÌÊVÀi>ÃiÊÌ iÀÊ}Û}ÊÌÊii«Ê«>ViÊÜÌ Ê}L>ÊVÃÌ vÊÛ}Êv>VÌÀð Ó°Ê/Ê«ÀÛ`iÊÜÀ`ÊÃÃÃÊÜÌ Ê>ÊÕ«Ì`>ÌiÊÃÌÊvÊi>V ÊV ÕÀV ½ÃÊVÕÀÀiÌÊ}Û}° ΰÊ/Ê>ÜÊÜÀ`ÊÃÃÃÊÌÊÀiÛiÊ>VÌÛiÊ`ÀÊVÌiÌð / iÊVÃÌvÛ}Ê«>ViÌÊÌÊÞÊ«ÀÛ`iÃÊÜÀ`ÊÃÃÃÊÜÌ Ê>VVÕÀ>ÌiÊvÀ>Ì]ÊLÕÌÊÌÊ >ÃÊÃÊ>ÊVÛiiÌÊÀiëÃiÊÌ° Ê>Õ>ÊVÃÌvÛ}ÊÀiÛiÜÊvÊ>ÊÃÃ>ÀÞÊVÌiÌÃÊÜÊii«Ê>ÊV ÕÀV ½ÃÊÃÕ««ÀÌÊ VÕÀÀiÌÊ>`Ê i«ÊÃÃ>ÀiÃÊL>ÌÌiÊiÛiÀVÀi>Ã}ÊLÕ`}iÌÃÊ`ÕiÊÌÊÜÀ`Êy>Ì° 0!24 3TEPS TO "ECOMING A -ISSIONARY ««Ìi`ÊÃÃ>ÀiÃÊVÌÌi`ÊÌÊ}ÌiÀÊÃiÀÛViÊ>ÀiÊÌ iÊÃÌÀi}Ì ÊvÊÌ iÊÃÃiLiÃÊvÊ `Ê7À`Ê ÃÃÃÊÕÌÀi>V °Ê ÃÃ>ÀiÃÊÜ ÊÛiÊ>}ÊÌ iÊ«i«iÊÌÊÜ ÊÌ iÞÊà ÌiÀÊ«À`ÕViÊÌ iÊÃÌÊivviVÌÛiÊÀiÃÕÌðÊ/ iÞÊi>ÀÊÌ iÊ>}Õ>}iÊ>`ÊVÕÌÕÀiÊ>`Ê`iÌvÞÊÌ i ÃiÛiÃÊÜÌ ÊÌ iÊ«i«iÊ>ÃʺÛ}Êi«ÃÌiûÊvÊiÃÕÃÊ ÀÃÌ° ÃÃ>ÀiÃÊÕÃÌÊLiÊvÕÞÊVÌÌi`ÊÌÊÌ iÊ À`ÊvÊÌ iÊ >ÀÛiÃÌ]ÊiÝ«iÀiVi`ÊÊÌ iÊÜÀÊ vÊÃÌÀÞ]ÊÃiÃÌÛiÊÌÊÜÊ>`Ê`ÊÃÊÜ]ÊyiÝLiÊÌÊ >`iÊÌ iÊ`ÛiÀÃÌiÃÊvÊviÊÛiÀÃi>ÃÊ >`Ê>`iµÕ>ÌiÞÊÌÀ>i`ÊÌÊiiÌÊÌ iÊV >i}iÃÊÌ iÞÊÜÊv>Vi° ««Þ}ÊÀÊ ÃÃ>ÀÞÊ-iÀÛVi / iÊwÀÃÌÊÃÌi«ÊÌÜ>À`Ê>ÊLiV}ÊÜÀ`ÊÃÃ>ÀÞÊÃÊÌ>iÊLÞÊ`ÊÀ>Ì iÀÊÌ >ÊÌ iÊ«Ìi Ì>ÊÃÃ>ÀÞ°Ê/ >ÌÊwÀÃÌÊÃÌi«ÊÃÊÌ iÊÜÌiÃÃÊvÊÌ iÊÞÊ-«ÀÌÊ`ÀiVÌ}Ê>Ê«iÀýÃÊviÊÌÜ>À`Ê ÜÀ`ÊÃÃÃ°Ê >``>ÌiÊÃiiVÌÊ>`Ê>««ÀÛ>ÊLÞÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊÃÊ L>Ãi`ÊÊÌ ÃÊ«ÀiÃiÆÊÌ iÀivÀi]ÊÌ iÊÃÃiLiÃÊvÊ`Ê`iÃÊÌÊÀiVÀÕÌÊÃÃ>ÀiÃÊÀÊÃiÀÛiÊ >ÃÊ>ÊV>ÀiiÀÊ}Õ`>ViÊÃiÀÛVi° / iÊÃiV`ÊÃÌi«ÊvÀÊÌ iÊ«ÌiÌ>ÊÃÃÃÊV>``>ÌiÊÃÊÌÊVÌ>VÌÊÌ iÊ*iÀÃiÉ>ÞÊ viÊ i«>ÀÌiÌÊvÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃðÊ/ iÊiÌÌiÀÊà Õ`ÊÌÀ`ÕViÊÌ iÊ>««V>Ì]Ê iÝ«>Ê ÃÊÀÊ iÀÊV>ÊÌÊÃÌÀÞÊ>`ÊÕÌiÊëiVwVʵÕ>wV>Ìð Çn +Õ>wV>Ìà "ÞÊÀ`>i`ÊÃÌiÀÃÊ>`ÊiLiÀÃÊvÊÌ iÊÃÃiLiÃÊvÊ`Ê>ÞÊLiÊVÃ`iÀi`ÊvÀÊ}i iÀ>Ê®ÊÜÀ`ÊÃÃÃÊÃiÀÛVi°ÊÊÃÌÊV>ÃiÃ]ÊV>``>ÌiÊÃÃ>ÀiÃÊ>ÀiÊiÝ«iVÌi`ÊÌÊ >ÛiÊ >ÊiÃÌ>Là i`ÊÀi>Ìà «ÊÜÌ ÊÌ iÀÊÀiëiVÌÛiÊ`ÃÌÀVÌÃÊLivÀiÊ>««Þ}ÊvÀÊÛiÀÃi>ÃÊÃÌÀÞ°Ê / ÃiÊ>««Þ}ÊvÀÊ>««Ìi`ÊëiV>Ê-®Ê>ÀiÊ>Ãi`ÊÌÊVÌ>VÌÊÌ iÀÊ`ÃÌÀVÌÃÊÌÊLÌ>Ê>Êëi V>ÊÃÌiÀ>ÊViÃi° ««V>ÌÃÊvÀÊÌ iÊ ÃÃ>ÀÞ/À>}Ê /®Ê«À}À>ÊÕÃÌÊ}ÛiÊiÛ`iViÊvÊ>ÊVi>ÀÊ ÃiÃiÊvÊ`½ÃÊ`ÀiVÌÊi>`}ÊÌ iÊÌÊÜÀ`ÊÃÃ>ÀÞÊÃiÀÛVi]Ê`iV>ÀiÊÌiÌÃÊÌÊLi ViÊV>ÀiiÀÊÃÃ>ÀiÃÊ>`Ê >ÛiÊiÝ«iÀiViÊÊiÛ>}iÃ°Ê /Ê>««V>ÌÃÊ>ÀiÊ>VVi«Ìi`Ê LiÌÜiiÊ>}iÃÊÓ£Ê>`ÊÓn°Ê `Ài Õ«iÃÊÜÌ ÊÀiÊÌ >ÊÌÜÊV `ÀiÊ>ÀiÊÀiµÕÀi`ÊÌÊ`iÃÌÀ>ÌiÊiÝViiÌʵÕ>wV>ÌÃÊ vÀÊÃÃ>ÀÞÊÃiÀÛViÊiµÕÛ>iÌÊÌÊÌ iÊëiVwVÊ>ÃÃ}iÌ®ÊÊÀ`iÀÊÌÊÕÃÌvÞÊÌ iÊ>``i`ÊÀÃÊ >`ÊiÝ«i`ÌÕÀiÊvÊÌiÊ>`ÊvÕ`ÃÊvÀÊÌ iÊv>Þ°Ê Õ«iÃÊÜÌ ÊÀiÊÌ >ÊÌ ÀiiÊV `ÀiÊ>V V«>Þ}ÊÌ iÀÊ«>ÀiÌÃÊÛiÀÃi>ÃÊÀÊÜÌ ÊV `ÀiÊ>««À>V }ÊÌ iÀÊÌiiÃÊ>ÀiÊÌÊ>`ÛÃi`ÊÌÊ >««ÞÊvÀÊÃÃ>ÀÞÊÃiÀÛVi° / ÃiÊi}LiÊvÀÊ /ÊÃÌ>ÌÕÃÊVÕ`iÊÃ}iÃÊÀÊ>ÀÀi`ÊVÕ«iÃÊÜÌ ÊÕ«ÊÌÊiÊV `°Ê«« V>ÌÃÊà Õ`Ê >ÛiÊ>ÊÕ`iÀ}À>`Õ>ÌiÊ`i}Àii]Ê«ÀiviÀ>LÞÊÊ Li]ÊÌ i}Þ]Ê«>ÃÌÀ>ÊÃÌÀÞÊÀÊ ÃÃðÊ/ iÞÊ>ÃÊ>ÞÊ >ÛiÊ>««ÀÛi`ÊiµÕÛ>iÌÊi`ÕV>ÌÊÊ>ÊëiVwVÊ>Ài>ÊvÊÌÀ>}° ««V>ÌÊ* >Ãi vÊÌ iÊ>««V>ÌÊiiÌÃÊÌ iÊÀiµÕÀiiÌÃÊvÀÊÜÀ`ÊÃÃ>ÀÞÊÃiÀÛVi]ÊÌ iÊ*iÀÃiÉ>ÞÊ viÊvwViÊÜÊVÌ>VÌÊ ÃÊÀÊ iÀÊ`ÃÌÀVÌÊvwViÊLivÀiÊÃi`}Ê>««V>ÌÊvÀð Ê>``ÌÊÌÊV«iÌ}ÊÌ iÊ>««V>ÌÊvÀÃ]ÊÌ iÊ>««V>ÌÊÕÃÌÊÃÕLÌÊ>ÊLÀivÊ>ÕÌL }À>« Þ]ÊV >À>VÌiÀÊÀiviÀiViÃ]Ê i>Ì Ê ÃÌÀÞÊvÀ>ÌÊ>`Êi`ÕV>Ì>ÊÌÀ>ÃVÀ«ÌÃ°Ê Ài`ÌÊ Ài«ÀÌÃÊ>ÀiÊÀ`iÀi`ÊLÞÊÌ iÊ*iÀÃiÉ>ÞÊ viÊvwVi° / iÊV«iÌi`Ê>««V>ÌÊvÀÃÊ>ÀiÊiÛ>Õ>Ìi`ÊLÞÊÌ iÊ`ÀiVÌÀÊvÊ*iÀÃiÉ>ÞÊ viÊ>`Ê Ì iÊ>««À«À>ÌiÊÀi}>Ê`ÀiVÌÀÊ`i«i`}ÊÊÌ iÊ>««V>̽ÃÊ>Ài>ÊvÊÌiÀiÃÌ®°Ê7 iÊÌ iÊwiÊ ÃÊiÛ>Õ>Ìi`]Ê>ÊvÀ>Êi`ÀÃiiÌÊÃÊÀiµÕiÃÌi`ÊvÀÊÌ iÊ>««V>̽ÃÊ`ÃÌÀVÌ°ÊvÊÌ iÊiÛ>Õ>ÌÃÊ >ÀiÊv>ÛÀ>LiÊ>`ÊÌ iÊ`ÃÌÀVÌÊ}ÛiÃÊi`ÀÃiiÌ]ÊÌ iÊ>««V>ÌÊ«ÀViÃÃÊVÌÕið "ViÊ>Ê>««V>ÌÊÃÊ>««ÀÛi`ÊvÀÊ«ÀViÃÃ}]ʵÕiÃÌ>ÀiÃÊ>ÀiÊÃiÌÊÌÊÌ iÊ`Û`Õ>ÃÊ ÃiiVÌi`Ê>ÃÊÀiviÀiViðÊ/ iÊ>««V>ÌÊÕÃÌÊ >ÛiÊ>Ê i>Ì ÊiÝ>>ÌÊLÞÊ>Êi`V>Ê«ÀviÃÃ>Ê >`Ê>Ê«iÀÃ>ÊÌiÀÛiÜÊÜÌ ÊÌ iÊ`ÀiVÌÀÊvÊ*iÀÃiÉ>ÞÊ viÊÀÊ>Ì iÀÊvÀi}Êà ÃÃÊÀi«ÀiÃiÌ>ÌÛi° vÊ>Ê`V>ÌÃÊ>ÀiÊv>ÛÀ>Li]ÊÌ iÊ>««V>ÌÊÃÊÛÌi`ÊÌÊÌ iÊÃÃiLiÃÊvÊ`Ê i>`µÕ>À ÌiÀÃÊÊ-«À}wi`]Ê ÃÃÕÀ]ÊvÀÊvÕÀÌ iÀÊÀiÌ>Ì]ÊÌiÃÌÃÊ>`ÊÌiÀÛiÜðÊiÊÀÊà iÊ>ÃÊÜÊ >ÛiÊ>Ê«iÀÃ>ÊÌiÀÛiÜÊÜÌ ÊÌ iÊ7À`Ê ÃÃÃÊ ÝiVÕÌÛiÊ ÌÌii°ÊÌÊÌ ÃÊÌiÊÌ iÊ VÌÌiiÊÜÊÀiÛiÜÊÌ iÊ>««V>ÌÊ>ÌiÀ>Ã]Ê i>Ì ÊÀi«ÀÌÃ]ÊÀiviÀiViÃÊ>`Ê`ÃÌÀVÌÊi`ÀÃi iÌ°ÊÊ>``Ì]ÊÌ iÊVÌÌiiÊÌiÀÛiÜÃÊÌ iÊ>««V>ÌÊÀi}>À`}ÊëiVwVÊÃÌÀÞ]Ê«iÀÃ>Êvi]Êà Ã>ÀÞÊV>}Ê>`Ê>Ê>««À«À>ÌiÊwi`ÊvÊÃiÀÛVi° vÊÌ iÊ>««V>̽ÃÊÌiÀÛiÜÊÜÌ ÊÌ iÊ ÝiVÕÌÛiÊ ÌÌiiÊÃÊÃ>ÌÃv>VÌÀÞ]Ê iÊÀÊà iÊÃÊÀiV i`i`ÊÌÊÌ iÊ7À`Ê ÃÃÃÊ >À`ÊvÀÊV>``>ÌiÊ>««ÀÛ>° / iÊ7À`Ê ÃÃÃÊ >À`ÊV>ÀivÕÞÊÀiÛiÜÃÊÌ iÊwiÊvÊi>V ÊV>``>ÌiÊÀiVi`i`ÊLÞÊ Ì iÊ ÝiVÕÌÛiÊ ÌÌii°ÊvÊÌ iÊ`iVÃÊvÊÌ iÊ7À`Ê ÃÃÃÊ >À`ÊÃÊ«ÃÌÛi]ÊÌ iÊ>« «V>ÌÊLiViÃÊ>Ê>««ÀÛi`ÊÃÃ>ÀÞÊV>``>ÌiÊ>`ÊLi}ÃÊÌ iÊÌiÀ>ÌÊ«ÀViÃðÊvÊ Ç Ì iÊ`iVÃÊÃÊi}>ÌÛi]ÊÌ iÊ>««V>ÌÊÃÊ`ii`Ê>`ÊÌ iÊV>``>ÌiÊÕÃÌÊÀi>««ÞÊÌÊÀiViÛiÊ vÕÀÌ iÀÊVÃ`iÀ>Ì°Ê ÃÃ>ÀÞÊ««ÌiÌ "vwV>Ê>««ÌiÌÊÌÊÜÀ`ÊÃÃ>ÀÞÊÃiÀÛViÊÃÊ}À>Ìi`ÊLÞÊÌ iÊiÝiVÕÌÛiÊ`ÀiVÌÀÊvÊ ÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>vÌiÀÊÌ iÊV>``>ÌiÊ >ÃÊV«iÌi`Ê ÃÊÀÊ iÀÊLÕ`}iÌÊ>`Ê i`>ÌiÞÊ«ÀÀÊÌÊÌ iÊÃÃ>ÀÞ½ÃÊ`i«>ÀÌÕÀiÊvÀÊÌ iÊwi`°Ê ÃÃ>ÀÞÊ >Ìi}Àià >ÀiiÀÊÃÃ>ÀiÃÊ>ÀiÊV>ÃÃwi`ÊÊiÊvÊÌ iÊvÜ}ÊV>Ìi}ÀiÃ\Ê£®ÊV>``>ÌiÊÃÃ>ÀÞ]Ê Ó®Ê>««Ìi`Ê}iiÀ>]ÊήÊ>««Ìi`ÊëiV>Ê>`Ê{®ÊÃÃ>ÀÞÌÀ>}° £®ÊÊ >``>ÌiÊ ÃÃ>ÀÞÊÊ ®\Ê >``>ÌiÊÜ ÊÃÊ>««ÀÛi`ÊLÞÊÌ iÊ7À`Ê ÃÃÃÊ >À`ÊvÀÊV>ÀiiÀ]Ê}iiÀ>ÊÃÃ>ÀÞÊ>««ÌiÌʮʫÀÀÊÌÊ`i«>ÀÌ}ÊvÀÊÌ iÊwi`° Ó®ÊÊ««Ìi`Ê ÃÃ>ÀÞÊÊiiÀ>Ê®\Ê"À`>i`ÊÃÌiÀÃÊvÕÞÊi`ÀÃi`ÊLÞÊÌ iÀÊ ÀiëiVÌÛiÊ`ÃÌÀVÌÃÊ>ÞÊLiÊ>««Ìi`ÊÌÊ}iiÀ>ÊÃÃ>ÀÞÊÜÀ°Ê/ ÃiÊÜ Ê>««ÞÊvÀÊ ÃÃ>ÀÞÊ>««ÌiÌÊ`ÊÃÊÜÌ ÊÌ iÊvÕÊÌiÌÊvÊ`iÛÌ}Ê>ÊviÌiÊÌÊÜÀ`Ê ÃÃÃÊÃiÀÛVi° ήÊÊ««Ìi`Ê ÃÃ>ÀÞÊÊ-«iV>Ê-®\Ê*i«iÊÜÌ ÊëiV>âi`ÊÛV>Ì>ÊÃÃÊ«ÀÌiÀÃ]Ê }ÕÃÌÃ]ÊÕÀÃiÃ]ÊÌi>V iÀÃ]ÊiÌV°®Ê>ÞÊLiÊ>««Ìi`ÊÌÊëiV>ÊÃÃ>ÀÞÊÃiÀÛViÊ>ÌÊÌ iÊ `ÃVÀiÌÊvÊÌ iÊ ÝiVÕÌÛiÊ ÌÌiiÊ>`ÊÌ iÊ7À`Ê ÃÃÃÊ >À`°Ê/ iÃiÊÃà >ÀiÃÊ>ÀiÊiÝ«iVÌi`ÊÌʵÕ>vÞÊvÀÊ>ÊëiV>âi`ÊViÃi]ÊÀiViÛiÊÌ iÊi`ÀÃiiÌÊvÊÌ iÀÊ `ÃÌÀVÌÃÊ>`ÊiÌiÀÊ>ÊviÌiÊvÊÃÃ>ÀÞÊÃiÀÛVi° {®ÊÊ ÃÃ>ÀÞ/À>}Ê/®\Ê ÃÃ>ÀiÃÌÀ>}ÊÜÀÊÕ`iÀÊÌ iÊ`ÀiVÌÊÃÕ«iÀÛÃÊ vÊ>ÊÛiÌiÀ>ÊÃÃ>ÀÞ°Ê/ ÃÊ«À}À>ÊÃÊÌi`i`ÊÌÊ«ÀÛ`iÊVÀÃÃVÕÌÕÀ>ÊÃÌiÀ>Ê iÝ«iÀiViÊvÀÊÞÕ}Ê>`ÕÌÃÊÜ ÊÃ>ÌÃvÞÊÌ iÊi`ÕV>Ì>ÊÀiµÕÀiiÌÃÊvÀÊÃÃ>ÀÞÊ ÃiÀÛViÊLÕÌÊ>VÊÃÌiÀ>ÊÌÀ>}°Ê1«ÊÌ iÊÃÕVViÃÃvÕÊV«iÌÊvÊÌ ÃÊ«À}À>]Ê Ì iÊÌiÀÊ>ÞʵÕ>vÞÊvÀÊLÌ ÊÀ`>ÌÊ>`ÊvÕÊÃÃ>ÀÞÊ>««ÌiÌ° "Ì iÀÊÃÃ>ÀÞÊV>Ìi}ÀiÃÊVÕ`i £®ÊÊ-«iV>ÊÃÃ}iÌÊ-®\Ê >``>ÌiÃÊ>ÀiÊ}ÛiÊ>ÃÃ}iÌÃÊvÊëiV>ÊÛiÀÃi>ÃÊÃÌÀÞÊ vÀÊÕ«ÊÌÊvÕÀÊÞi>ÀÃÊÕ`iÀÊ>ÊÃ}i`Ê>}ÀiiiÌÊÜÌ ÊÜÀ`ÊÃÃÃÊ>`ÊÌ iÊi`ÀÃi iÌÊvÊÌ iÀÊ`ÃÌÀVÌð Ó®ÊÊ7ÞVvviÊ LiÊ/À>Ã>ÌÀÊ7 ®\Ê >``>ÌiÃÊÜ Ê>ÀiÊi`ÀÃi`ÊLÞÊÌ iÊ7À`Ê ÃÃÃÊ >À`ÊÌÊLiÊ«>ÀÌÊvÊÌ iÊ>}ÀiiiÌÊLiÌÜiiÊÌ iÊÃÃiLiÃÊvÊ`Ê7À`Ê ÃÃÃÊ>`Ê 7ÞVvviÊ LiÊ/À>Ã>ÌÀð ήÊÊ- ÀÌ/iÀÊ ÃÌiÀÊLÀ>`Ê-/®\Ê"À`>i`ÊÃÌiÀÃÊÜ ]ÊÜÌ ÊÜÀ`ÊÃÃÃÊ>`Ê `ÃÌÀVÌÊ>««ÀÛ>]ÊVV>Ã>ÞÊÌÀ>ÛiÊÛiÀÃi>ÃÊvÀÊÃÌÀÞÊvÀÊ«iÀ`ÃÊvÊÌÜÊÜiiÃÊÌÊ ÃÝÊÌ Ã° {®ÊÊ,iÌÀi`Ê ÃÃ>ÀÞÊ, ®\Ê ÃÃ>ÀiÃÊÜ Ê>ÀiÊÈxÊÞi>ÀÃÊ`Ê>`Ê`ÊÌÊ«>ÊÌÊV ÌÕiÊ>VÌÛiÊÃÃ>ÀÞÊÃiÀÛVi° x®ÊÊ- ÀÌ/iÀÊ ÃÃ>ÀÞÊÃÃV>ÌiÊ *®\Ê6ÕÌiiÀÃÊÜ Ê>ÀiÊ>««ÀÛi`ÊLÞÊÌ iÊ`ÀiVÌÀÊvÊ *iÀÃiÉ>ÞÊ viÊÌÊ>ÃÃÃÌÊÃÃ>ÀiÃÊÊ>Êà ÀÌÌiÀÊL>ÃÃÊÊÌ iÊÃÃÊwi`° È®ÊÊ ÃÌiÀ>Ê ÃÌÊ ®\Ê ÃÃ>ÀiÃÊÜ Ê`iV`iÊÌÊÌÊVÌÕiÊÀÊÀiÌÕÀÊÌÊ>VÌÛiÊà Ã>ÀÞÊÃiÀÛVi° nä ««i`ÝÊ£ 0OLICY 3TATEMENT FOR THE -ISSIONS !WARENESS 4EAM IN THE ,OCAL #HURCH / iÊvÜ}ÊÃiVÌÊ >ÃÊLiiÊ«Ài«>Ài`Ê>ÃÊ>ÊÃi«>À>ÌiÊ`VÕiÌ]Ê`iÃ}i`ÊÌÊ>ÃÃÃÌÊÊÌ iÊvÀ >ÌÊvÊ>ÊvwV>Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>° *ÕÀ«Ãi / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Êà >Ê >ÛiÊÌ iÊ}iiÀ>ÊÛiÀÃ} ÌÊvÊ«ÀÌ}Ê>`ÊVÀ`>Ì }Ê>ÊÃÃÃÊ>VÌÛÌiÃÊÜÌ ÊÌ iÊV>ÊV}Ài}>Ì°ÊÌÊà >Ê«ÀÛ`iÊÃÃÃÊi`ÕV>Ì]Ê Ã«À>ÌÊ>`ÊÌÛ>Ì°ÊÌÊà >Êi>`ÊÌ iÊV}Ài}>ÌÊÊÀiV}â}ÊÌ iÊLLV>ÊÀiëà LÌÞÊvÊiÛiÀÞÊLiiÛiÀÊÌÊLiÊ>Ê«>ÀÌV«>ÌÊÊvÕw}ÊÌ iÊÀi>ÌÊ Ãð À>ÌÊ>`Ê,i>Ìà « / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÃÊ>ÕÌ Àâi`ÊLÞÊÌ iÊvwV>ÊV ÕÀV ÊL>À`Ê>`ÊÃÊ>i>LiÊÌÊ Ì iÊ«>ÃÌÀÊ>`ÊÌ iÊL>À`° / iÊ«>ÃÌÀÊÜÊÃiÀÛiÊ>ÃÊV >À>ÊvÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÀÊ iÊ>Þ]Ê>ÌÊ ÃÊV Vi]Ê >ÃÃ}ÊÌ >ÌÊÀiëÃLÌÞÊÌÊ>Ì iÀÊÌi>ÊiLiÀ° / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊÜÊLiÊV«ÀÃi`ÊvÊÊiÃÃÊÌ >ÊwÛiÊÀÊÀiÊÌ >ÊÃiÛiÊ iLiÀðÊÌÊi>ÃÌÊiÊÀi«ÀiÃiÌ>ÌÛiÊvÀÊÌ iÊvwV>ÊL>À`ÊÜÊLiÊVÕ`i`° / iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>]Ê>ÃÊiViÃÃ>ÀÞ]Ê>ÞÊ>iÊVÌÌiiÊ>ÃÃ}iÌÃÊÃÕV Ê>ÃÊÃiV ÀiÌ>ÀÞ]ÊÃÕLVÌÌiiÊV >À]ÊiÌV° -iiVÌÊvÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê iLiÀà / iÊiLiÀÃÊvÊÌ iÊvwV>ÊL>À`ÊÜÊÃiiVÌÊÌ iÀÊÀi«ÀiÃiÌ>ÌÛi° ÊÌ iÀÊiLiÀÃÊÜÊLiÊ>Ìi`ÊLÞÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊiLiÀÃÊ>`ÊÀ>Ìwi`ÊLÞÊ Ì iÊvwV>ÊL>À`° i}Ì ÊvÊ/iÀ /i>ÊiLiÀÃÊà Õ`ÊLiÊÜ}ÊÌÊÃiÀÛiÊvÀÊ>Ê«iÀ`ÊvÊÌ ÀiiÊÞi>ÀðÊ/ iÞÊ>ÞÊÃiÀÛiÊ >``Ì>ÊÌiÀÃÊÜ iÊÀiVi`i`ÊLÞÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê>`ÊÀ>Ìwi`ÊLÞÊÌ iÊ vwV>ÊL>À`° +Õ>wV>ÌÃÊvÀÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê iLiÀà ÊÌi>ÊiLiÀÃÊà Õ`ÊiiÌÊÌ iÃiʵÕ>wV>ÌÃ\ UÊ/ iÞÊÕÃÌÊLiÊ>VÌÛiÊiLiÀÃÊÊÌ iÊV>Ê>ÃÃiLÞ° UÊÊ/ iÞÊÕÃÌÊLiÊv>Ì vÕÊÊÌ iÀÊÃÕ««ÀÌÊvÊÌ iÊV>ÊV ÕÀV ÊÜÌ ÊÌ iÀÊw>ViÃ]ÊV«iÀ> ÌÊ>`Ê>ÌÌi`>Vi° UÊ}iÊà Õ`ÊÌÊLiÊ>Êv>VÌÀÊvÀÊÃiÀÛ}ÊiÝVi«ÌÊ>ÃÊÌÊÀi>ÌiÃÊÌÊV ÕÀV ÊiLiÀà «° n£ UÊÊ >V Ê ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊiLiÀÊà Õ`ÊLiÊÜ}ÊÌÊ`iÛÌiÊÊiÃÃÊÌ >ÊÃÝÊÌÊ i} ÌÊ ÕÀÃÊÌ ÞÊÌÊ«ÀiÃVÀLi`Ê`ÕÌið UÊ/ iÞÊÕÃÌÊLiÊvÊ>ÊV«iÀ>ÌÛiÊëÀÌ]ÊÜ}ÊÌÊvÜÊ>ÃÊÜiÊ>ÃÊi>`° UÊÊ >V ÊiLiÀÊÕÃÌÊ>viÃÌÊ>ÊÛiÊvÀÊÌ iÊÃÌ°Ê/ iÊ`i«Ì ÊvÊÌ >ÌÊÛiÊà Õ`ÊLiÊV wÀi`ÊLÞÊÌ iÀÊ`i`V>ÌÊÌÊ«À>ÞÊvÀÊÃÃ>ÀiÃÊ>`ÊÌ iÀÊ}iiÀÕÃÊÌ ÞÊv>Ì Ê «ÀÃiÊ}Û}°Ê ÊiÊà Õ`Ê >ÛiÊÌ iÊ«ÀÛi}iÊvÊ>}Ê`iVÃÃÊvÀÊÌ iÊ`ÃLÕÀÃi iÌÊvÊÃÃÃÊvÕ`ÃÊvÊ iÊÀÊà iÊÃÊÌÊ>Ê}iiÀÕÃÊ}ÛiÀÊÌÊÌ >ÌÊvÕ`° ÕÌiÃÊvÊÌ iÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i> ÃÃÃÊÜ>ÀiiÃÃÊ/i>ÊiLiÀÃÊÜÊLiÊÀiëÃLiÊÌÊV>ÀÀÞÊÕÌÊÌ iÃiÊ`ÕÌiÃ\ UÊÊ/ iÞÊÜÊ>ÌÌi`ÊÌ ÞÊiiÌ}ÃÊÜ iÀiÊÌ iÞÊÜÊÀiÛiÜÊÃÃ>ÀÞÊVÀÀië`iVi]Ê >iÊÌiÊvÊÀiµÕiÃÌÃÊvÀÊLÌ Êw>V>Ê>`Ê«À>ÞiÀÊ>ÃÃÃÌ>ViÊ>`]ÊÜ iÊ>««À«À>Ìi]Ê Ã >ÀiÊÌ iÃiÊii`ÃÊÜÌ ÊÌ iÊV}Ài}>Ì°ÊÊÊ UÊÊ/ iÞÊÜÊ>`ÃÌiÀÊ>ÊÃÃÃÊvÕ`ÃÊ}ÛiÊÌÊÌ iÊV>ÊV ÕÀV ]ÊiÝVi«ÌÊÌ ÃiÊvÕ`ÃÊ }ÛiÊÌÊÌ iÊ`i«>ÀÌiÌÃÊvÀÊÌ iÀÊÃÃ>ÀÞÊ«À}À>ÃÊ-/ ]Ê ]ÊiÌV°®° £°ÊÊ/ iÞÊÜÊ`iÌiÀiÊÜ V ÊÃÃ>ÀiÃÊ>`Ê«ÀiVÌÃÊÜÊLiÊÃÕ««ÀÌi`Ê>`ÊÌ iÊ >ÕÌÃÊÌ >ÌÊÜÊLiÊ}Ûi° Ó°ÊÊ/ iÞÊÕÃÌÊ>VÌÊÀiëÃLÞÊÊ>}ÊÌ ÞÊVÌiÌÃÊÌÊÃÃ>ÀiÃÊvÀÊÃÕ« «ÀÌ]ÊÜ}ÊÌ >ÌÊÌ iÊÃÃ>ÀÞÊÕÃÌÊ`i«i`ÊÊÌ ÃÊÌ ÞÊ«i`}iÊvÀÊ ÃÊÀÊ iÀÊV«iÌiÊÌiÀÊvÊÃiÀÛViÊÕÃÕ>ÞÊvÕÀÊÞi>Àî°Ê ΰÊÊ/ iÞÊÜÊiÃÕÀiÊÌ >ÌÊÃÃÃÊVÌiÌÃÊ>ÀiÊ`ÃLÕÀÃi`ÊÌ ÞÊ>`ÊÌ >ÌÊ>Ê>V VÕÀ>ÌiÊÀiVÀ`ÊÃÊi«ÌÊvÊ>ÊiÝ«i`ÌÕÀiÃÊ>`ÊÀiVi«ÌÃÊvÊÃÃÃÊvÕ`ð UÊ/ iÞÊÜÊ>Ì>ÊVÕV>ÌÊÜÌ ÊÃÃ>ÀiÃÊÊÌ iÊÃÕ««ÀÌÊÃÌ° £°Ê/ iÞÊÜÊii«Ê>ÊVÕÀÀiÌÊwiÊÊi>V ÊÃÃ>ÀÞ° Ó°ÊÊ/ iÞÊÜÊii«ÊÕ«ÊÌÊ`>ÌiÊÊÌ iÊ>ÃÃ}iÌÊ>`ÊÌÞ«iÊvÊÃÌÀÞÊvÀÊ>ÊÃÃ>À iÃÊÃÕ««ÀÌi`]Ê>ÃÊÜiÊ>ÃÊÌ iÀÊVÕÀÀiÌÊÃÌ>ÌÕÃÊÜ iÌ iÀÊÊÌ iÊwi`ÊÀÊÌiÀ>Ì}®° UÊÊ/ iÞÊÜÊLiÊÀiëÃLiÊvÀÊ«>}Ê>`ÊV`ÕVÌ}Ê>Ê>Õ>ÊÃÃÃÊVÛiÌÊ >`ÊÀiViÛ}Êv>Ì Ê«ÀÃið UÊ/ iÞÊÜÊ«>ÊÌ iÀÊëiV>ÊÃÃÃÊi« >ÃiÃÊ>ÃÊii`i`° UÊÊ/ iÞÊÜÊV«iÀ>ÌiÊÜÌ ÊÌ iÊ«>ÃÌÀÊÊÌ iÊÃV i`Õ}ÊÃÃ>ÀÞÊëi>iÀÃÊÌ ÀÕ} ÕÌÊ Ì iÊÞi>À° UÊÊ/ iÞÊÜÊLiÊÀiëÃLiÊvÀÊ«ÀÌ}ÊÃÃÃÊÌ ÞÊÊ>ÊÀ}ÊÜÀà «ÊÃiÀÛViÊ `iÃ}>Ìi`ÊLÞÊÌ iÊ«>ÃÌÀ° UÊÊ/ iÞÊÜÊ>Ì>Ê>Ê>VÌÛiÊÃÃÃÊLÕiÌÊL>À`ÊÜÌ ÊVÕÀÀiÌÊViÀÌwV>ÌiÃÊ>`Ê« Ì }À>« ÃÊÀi«ÀiÃiÌ}Ê>ÊÌ iÊÃÃ>ÀiÃÊ>`ÊÃÌÀiÃÊÃÕ««ÀÌi`° UÊÊ/ iÞÊÜÊ>ÃÃÃÌÊ>Ê}ÀÕ«ÃÊÜÌ ÊÌ iÊV>ÊV}Ài}>ÌÊÊ«ÀÌ}ÊÌ iÀÊÃÃÃÊ i« >ÃiðÊ/ ÃÊVÕ`iÃÊ ÞÃÊ>`ÊÀÃÊ ÃÃ>ÀÞÊ ÀÕÃ>`iÊ ®]Ê-«ii`ÊÌ iÊ } Ì]Ê } ÌÊvÀÊÌ iÊ ÃÌÊ>`Ê7i½ÃÊ ÃÌÀið UÊÊ/ iÞÊÜÊ>iÊiÛiÀÞÊivvÀÌÊÌÊ>ÌÌi`Ê`ÃÌÀVÌÊ>`ÊÜÀ`ÊÃÃÃëÃÀi`ÊiÛiÌÃ]Ê ÃÕV Ê>ÃÊ`ÃÌÀVÌÊÃÃÃÊÀ>iÃ]ÊÜÀ`ÊÃÃÃÊÞÃ]ÊiÌV° UÊÊ/ iÞÊÜÊ>ÃÃÃÌÊÌ iÊ«>ÃÌÀ]Ê>ÃÊÀiµÕiÃÌi`]ÊÊ>ÞÊ>VÌÛÌiÃÊÌ >ÌÊÜÊi >ViÊÌ iÊëÀÌÊvÊ ÃÃÃÊÜÌ ÊÌ iÊV>ÊV}Ài}>Ì° nÓ ««i`ÝÊÓ !VAILABLE 2ESOURCES &ROM 7ORLD -ISSIONS UÊÊ", , Ê, -"1, Ê / , -\Ê >Ê{£Ç®ÊnÈÓÎ{Óä]ÊiÝÌiÃÊÓäÈ£ÊÀÊÓäÇ£]Ê ÀÊÌÊvÀii]Ê£Ênää®ÊnnÈxÈn°ÊÊvÀiiÊV>Ì>}ÊÃÊ>Û>>LiÊÊÀiµÕiÃÌ°Ê/ iÊV>Ì>}ÊV>Ê>ÃÊ LiÊÛiÜi`ÊiÊ>ÌÊÜÀ`ÃÃð>}°À}ÊLÞÊÃiiVÌ}ʺÀiÃÕÀViûÊvÀÊÌ iÊiÕ°ÊiÀiÊ ÞÕÊV>Ê>ÃÊw`Ê>Ê`Ü>`>LiÊÀ`iÀÊvÀ° UÊÊ6 "-Ê £®Ê/ iiÊ6`iÊÊ6-ÊÀÊ 6 Ê>Õ>®Ê Ó®Ê/ ÀiiÊÛ`iÃÊ/ÜÊÌÊ/ Àii ÕÌiÊ «ÃÊ Ê iÜÃLÀi>ÊqÊÀÊ`ÕÌÃÊ }à Ê>`Ê-«>à ÊVÕ`i`®Ê Ê7À` i>ÌÊqÊÀÊ/iiÃÊ Ê }ÊÎÈäÊqÊÀÊ `ÀiÊ ÊÊÊÊ-ÕLÃVÀ«Ì\Ê"iÊÛ`iÊVÌ>}Ê>ÊÌ ÀiiÊÃi}iÌîÊÃÊ>i`ÊÌ ÞÊvÀÊf{nÊ«iÀÊÞi>À° UÊÊ, Ê "7 " Ê/ -\Ê £®ÊÊ7À`Ê ÃÃÃÊ7iLÊÃÌi\ÊÜÀ`ÃÃð>}°À}Ê 1ÃiÊÌ iʺ+ÕVÊ >Û}>Ì»ÊiÕÊÌÊ>VViÃÃ\ Ê °Ê ÌiÌÊ >À`ÃÊ>Ì Ê*ÀÃiÊ >À`ÃÊ>`Ê ÌiÌÊÀÃ®Ê Ê °Ê- ÀÌÌiÀÊ *-®Ê>««V>ÌÊ«>ViÌÊ Ê °Ê7À`Ê ÃÃÃÊ}Ê>ÀÌÊ Ê °Ê7À`Ê ÃÃÃÊÌ iiÊ>ÀÌÊÃÕÌ>LiÊvÀÊ>Ê7iLÊ«>}iÊÀÊiÜÃiÌÌiÀ®Ê Ê °Ê7À`Ê>«ÊL>V}ÀÕ`ÃÊÜÌ ÊVÀi`ÊÀi}î ÊÊÊÊÊÊÊÓ®ÊÊ ÃÃÃÊÜ>ÀiiÃÃÊ/i>Ê7iLÊÃÌi\Ê>Ì°vÀ>>ÌðVÊ 1ÃiÊÌ iʺ >Õ>ûÊ>`ʺÀÊ }Ài}>ÌûÊLÕÌÌÃÊÌÊ>VViÃÃ\ Ê °ÊÌÊÊ/ iÊ7À`ÊiÃÌ>Là }Ê>ÊÃÃÃÊÕÌÀi>V ÊÊÌ iÊV>ÊV ÕÀV ®Ê Ê °Ê*ÀÛiÊ ÃÃÃÊ ÛiÌÃÊ`i>ÃÊ`i>ÃÊvÀÊ«>}Ê>ÊÃÃÃÊVÛiÌ®Ê Ê °Ê*ÜiÀ*ÌÊ«ÀiÃiÌ>ÌÊ-iÀiÃÊ£ÊvÀÊÌ iÊV}Ài}>Ì®Ê Ê °Ê*ÜiÀ*ÌÊ«ÀiÃiÌ>ÌÊ-iÀiÃÊÓÊÌÊ>ÃÃÃÌÊ>`ÊvÀÊÌ iÊÃÃÃÊVÌÌii®Ê Ê °Ê*ÜiÀ*ÌÊ«ÀiÃiÌ>ÌÊ-iÀiÃÊÎÊÕÃÌÀ>Ìi`ÊÃiÀÃÊÊÃÃÃÊ>`ÊÃÕÜ}®Ê ÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊ >Õ>ÃÊ>`Ê*ÜiÀ*ÌÊ«ÀiÃiÌ>ÌÃÊ>ÀiÊ>Û>>LiÊÊ }à Ê>`Ê-«>à ÊÊÊÊÊÊÊÊ£nÊ*ÜiÀ*ÌÊ«ÀiÃiÌ>ÌÃ]Ê«Ài«>Ài`ÊvÀÊÌ iÊV>ÊV ÕÀV ]ÊV>Ê>ÃÊLiÊ«ÕÀV >Ãi`ÊÊ ÊvÀÊ>Ê>ÊV >À}i°Ê"À`iÀÊLÞÊV>}Ê{£Ç®ÊnÈÓÓÇn£]ÊiÝÌiÃÊÓäxä° UÊÊ Ê/"Ê*,9 ,Ê ÃÃ>ÀÞÊ« ÌÊ`ÀiVÌÀÞÊ*ÕLà i`ÊÌÜViÊÞi>ÀÞ®°Ê >ÊLiÊÕÃi`Ê>ÃÊ>Ê`>ÞÊ}Õ`iÊvÀÊ «À>Þ}ÊvÀÊÃÃ>ÀiÃÊ`Û`Õ>Þ° UÊ/ Ê 1 *, /Ê- , -ÊqÊ,iÃÕÀViÊ>Õ>ÃÊ>Û>>LiÊÊLÌ Ê }à Ê>`Ê-«>à ® Ê6ÕiÊ£ÊqÊ Õ`}Ê ÃÃÃÊ i>`iÀà «ÊÊÌ iÊ V>Ê ÕÀV Ê Ê6ÕiÊÓÊqÊ Õ`}Ê ÃÃÃÊ-Õ««ÀÌÊ7Ì Ê>Ê ÃÃÃÊ ÛiÌÊ Ê 6ÕiÊÎÊqÊ Õ`}Ê ÃÃÃÊ6ÃÊoÊ Ì ÊLÞÊ Ì nÎ UÊÊ --" -Ê/"1 Ê- , Ê ÌiÀ>VÌÛiÊ`ë>ÞÊÌ >ÌÊ«ÀiÃiÌÃÊvÀ>ÌÊ>LÕÌÊVÕÌÀiÃÊ>`ÊÃÃ>ÀiÃ°Ê Ê >\ÊÜÀ`ÌÕV ÃVÀiiJ>}°À}ÊÀÊÛÃÌÊi\ÊÜÀ`ÌÕV ÃVÀii°>}°À} UÊÊ "" -Ê iÀiÃÊvÊÌ iÊ>Ì Ê6ÕiÃÊ£]ÊÓÊ>`ÊήÊ>`ÊÌ iÀÊLÃÊVÌ>}ÊëÀ}ÊÃÌÀiðÊ/Ê À`iÀÊÃiiÊV>Ì>}ÊÀÊ7À`Ê ÃÃÃÊ7iLÊÃÌi° UÊÊ/" 9½-Ê* / "-/ Ê 6 ]Ê7À`Ê ÃÃÃÊ `ÌÊ ÀÃÌÊ-Õ`>ÞÊi`ÌÊi>V ÊÌ °Ê/ÊÀ`iÀÊV>Ê£Ênää®ÊÈ{£{Î£ä° UÊÊ --" -Ê " 6 /" Ê ÊÊ "8Ê ÛiÀÞÌ }Êii`i`ÊÌÊV`ÕVÌÊ>ÊÃÃÃÊVÛiÌÊÊ>ÊV ÕÀV ÊvÊÕ«ÊÌÊnäÊÊ>ÌÌi`>Vi°Ê ÀÊV ÕÀV iÃÊ >Û}Ê>ÊwÀÃÌÌiÊÃÃÃÊVÛiÌÊÀÊÌ iÊwÀÃÌÊiÊÊÃiÛiÀ>ÊÞi>ÀÃ°Ê >Ê {£Ç®ÊnÈÓÓÇn£]ÊiÝÌ°ÊÓäxä° "/ ,Ê-"1, - UÊÊ -Ê ÊÀi«ÕÌ>LiÊwÀÊÌ >ÌÊÃÕ««iÃÊy>}ÃÊvÀÊiÛiÀÞÊ>ÌÊÃÊ"â>ÀÊ>}Ê ÃÌÀLÕÌÀðÊ"À`iÀÊ y>}ÃÊÀÊ>ÊV>Ì>}ÊLÞÊV>}Ê{£Ç®ÊnnÈÎxÓ{° n{ Building Missions Support C. THE BLUEPRINT SERIES Volume 2 %XLOGLQJ« with an Annual Missions Convention A step-by-step guide to assist local church leadership in planning and conducting a successful missions convention Created by Paul Brannan Assemblies of God World Missions 1445 North Boonville Avenue Springfield, MO 65802-1894 Building Missions Vision D. CONTENTS ACKNOWLEDGMENTS……………………….…………….……….…..………. 5 INTRODUCTION...... 6 SECTION 1 - WHERE DO WE START? ...... 7 Part 1 - Lay the Foundation ……………………………………….………... .9 The Importance of a Missions’ Team…………………………..…..……….9 Keep the Team Involved...………………………………………..…..…….. 9 Make Sure Leadership Attends All District and National Missions’ Activities…………………...………………….……………… 10 An Annual Convention Is a Must ………………………………….………. 10 Part 2 - Identify the Tools That Are Readily Available to You………………………….……………..…………11 From World Missions……………………………..……………..………….. 11 From our Partners………………………….,…...…………………..……… 12 SECTION 2 - MISSIONS SUNDAY – WINDOW ON THE WORLD…………. 13 Part 1 – Missions Sunday Is A Key to Success…………….…………… 14 An Annual Missions Convention Is Not Enough……...………….……… 14 A Successful Missions Sunday Doesn’t Just Happen……….……….… 14 The Monthly Presentation for Missions Sunday Should Be a Highlight for That Service…………………..……….……………. 14 Missions Sunday Is Not a Penny March……………..…………….…..… 15 Part 2 - Ideas to Make Every Missions Sunday Special……..………... 16 Utilize the Pentecostal Evangel………………………………………….... 16 Use the monthly DVD, Newsbreak……………………………………….. 16 Pray Around the World……………………………………………………... 16 Keep the Congregation Informed About Faith Promise Giving………… 17 Send a Monthly Letter with a Missions Offering Envelope……………... 17 Send a Quarterly Receipt of Faith Promise Giving…………………...... 17 Purchase Flags Representative of the Nations Where You Support Missionaries……………………………………………….. 17 Call a Missionary Family……………………………………………………. 17 Include Your Youth with Music and Drama………………………………..17 Share Excerpts from Missionaries’ Letters……………………………….. 17 Give Opportunities for Personal Testimonies…………………………….. 17 Vary the Focus of Your Window on the World from Month to Month…………………………………………………… 18 Additional Ideas for “Window on the World”……………………………… 19 2 Part 3 - Plan Missions Sundays for a Year at a Time…………………… 20 The Advantages of Planning Ahead…………………………………...... 20 Annual Planner……………………………………………………….……… 21 Sample Missions Sunday Program……………………………………….. 24 Planning for the Year……………………………………………………….. 25 Pre-Convention Planning…………………………………………………… 31 SECTION 3 - WHAT ELSE CAN WE DO TO INCREASE MISSIONS VISION?...... 38 Part 1 – Plan A Mid-Year Mini-Convention……………………………….. 39 Part 2 – Schedule Frequent Missionary Speakers……………………… 40 At least quarterly……………………………………………………………. 40 Schedule Missionaries to Speak In Different Types of Services………………………………………………………… 40 Missionaries Are Not a Pulpit Supply……………………………………… 40 Part 3 – Coordinated Prayer for Missionaries Is A Key Element…………………………………………………….. 42 Make Prayer for Missions a Regular Part of Church Life……………….. 42 Encourage Private Prayer for Missions…………………………………... 42 Equip Your Congregation for More Effective Prayer ……………………. 42 Part 4 – Create an Attractive Missions Display………………………….. 44 Where Should It Be Located?...... 44 What Is Needed to Create a “World Harvest” Display?...... 44 Part 5 – Develop A Strong Missions Section In The Church Library……………………………………………………. 45 Part 6 – Plan a Missions Trip……………………………………………….. 47 Ambassadors In Mission (AIM)……………………………………………. 47 MAPS Construction Teams………………………………………………… 48 Prayer Task Force…………………………………………………………... 49 Part 7 – Introduce Support Ministries to Encourage Giving……………50 Boys and Girls Missionary Crusade (BGMC)…………………………….. 50 Speed the Light ……………………………………………………………… 50 Light for the Lost……………………………………………………………... 50 Women’s Ministries………………………………………………………….. 50 Senior Adult Ministries……………………………………………………… 51 Part 8 – Keep the Missionaries before the People……………………….52 Missionary Directory………………………………………………………… 52 Missionary Calendar………………………………………………………… 52 Call to Prayer………………………………………………………………… 52 Keep the Missionaries before the Congregation – Literally……………..52 3 Part 9 – Offer Classes on Missions………………………………………… 53 An Elective in Sunday school or Small Study Group……………………. 54 New Convert’s Class………………………………………………………... 54 Membership Class……………………………… ……………………….. … 55 Part 10 – Don’t Overlook the Children…………………………………….. 56 Ideas, Ideas and More Ideas……………………………………………. … 56 It’s Not Just About Money……………………………………………….. … 61 Part 11 – Keep the Youth Focused On Missions…………………………63 Ideas in Brief…………………………………………………………………. 63 Is It Just Another Project Or Are They Being Established In The Faith?...... 67 Part 12 – Pastor, You Are the Key to Success……………………………68 Plan Sufficient Time In The Missions’ Sunday…………………………… 68 Participate In Monthly Missions’ Team Meetings………………………… 68 Schedule a Missionary Speaker, At Least Quarterly……………………. 69 Preach On Missions, Soul-Winning or Evangelism At Least Once Each Quarter…………………………………………… 69 Set the Example in Prayer, Giving and Caring For The Lost…………………………………………………………….… 69 Part 13 – Put Missions on the Platform, Not in the Budget!...... 71 4 ACKNOWLEDGMENTS When I began to write this manual, I wanted to create a tool that would be of assistance to that pastor and missions team that felt they needed something more to help them build and maintain a clear missions vision within their congregation. They were already convinced of the need, they were just searching for the right tools. I set out to create such a manual. With forty-four years of world missions involvement, having served as a missionary, missionary administrator, district missions director and currently as the coordinator for the Missions Awareness Team, and having conducted hundreds of missions conventions in your churches, my life has been eternally affected by the tens of thousands of experiences during those years. I am indebted to each person who has touched my life in a meaningful way. I am grateful to those who believed in me so many years ago, for because of them, many doors of ministry were opened to Betty and me. I am even grateful, now, for those who didn’t believe in me, because they motivated me to try a little harder and, at times, I needed that. They say that no man is an island. That became very obvious as I came to the latter part of this manual. I reached a point where I needed ideas. Not for me. Ideas to share with you. Ideas for ministry with the children and others for the youth. Where do you get these ideas? Where else, but from the ones who are ministering successfully to the children and the youth. Here is where I owe a huge debt that I will never be able to repay to my life’s partner, my treasured wife, Betty. She called scores and scores of churches, pastors, children’s pastors and youth pastors. She spent long hours over many days seeking ideas from many parts of the country. We are grateful for all who responded. I trust that their ideas will spark an idea or two of your own. Each person who contributed ideas is listed with their submission. This is a combination manual/workbook since Section 2 is design for planning your Missions Sunday presentations for a full year. May the Lord bless its use. Not every idea will work in every group. That was never the intent, but by sharing ideas we expand our vision and broaden our horizon. May we join together in praying, “Lord, send revival to our children and our youth, and give us wisdom to lead them in their commitment to reach a dying world!” Your partner in the harvest, 5 INTRODUCTION Jesus gave the Great Commission, not only to the corporate body, but also to each individual believer. His assignment was so important that all four Gospels and the book of Acts include this command. If the Holy Spirit thought Jesus’ command was important enough to repeat five times, it should be important enough to get our attention. The purpose of the church is missions. Our mandate and responsibility are to make certain that the gospel reaches every corner of this earth. Unfortunately, two-thirds of the U. S. Assemblies of God churches are not taking advantage of the tools and helps made available to assist them in building strong missions awareness within the congregation and preparing the membership to reach the world for Christ. What a tragedy! The following five elements are absolutely necessary for building a solid base for missions in the local church: 1. A missions team 2. An annual missions convention 3. A well planned presentation for Missions Sunday every month 4. Frequent missionary speakers 5. A regular missions’ prayer emphasis The pastor can’t do it alone, nor should he. Creating a missions team will make the pastor’s load lighter and create a more effective world outreach. Volume 1 of the “Blue Print Series” entitled Building Missions Leadership in the Local Church is available to assist you in creating an effective missions’ team. The missions convention, the cornerstone for any successful effort to establish missions in the local church, seeks to broaden vision and increase knowledge of world need. Its primary result is a personal commitment from each believer to support missions each month with their faith promise. Volume 2, Building Missions Support with an Annual Missions Convention, will guide you, step by step in planning and conducting a successful convention. This, Volume 3, Building Missions Visions Month by Month focuses on keeping missions before the congregation all year. The well planned Missions Sunday presentation helps fan the flame that was ignited when they made their monthly faith promise commitment. This manual will assist you in planning a full year of Missions Sundays at the same time, making for a more balanced approach and assuring that each presentation is well prepared. Additional ideas are shared that can be implemented throughout the year to keep missions’ interest high. Regularly scheduled prayer for missions is critical to the success of missions, both at home and abroad. Volume 4, Building Missions Effectiveness through Prayer, contains scores of ideas used by other congregations in making their missions prayer emphasis a key part of their missions outreach. 6 Frequent missionary visits personalize missions, giving it a face. Their visits help believers see that reaching a lost world is about people, not programs. The passion for soul-winning shared by missionaries motivates many to prayer and is instrumental in leading many others into future missionary service. Volume 5, Building Missions Partnership through the Missionary Visit, will help you get the most from each missionary’s visit. Every worthwhile effort should include at least one goal. The steps we take to realize that goal are called strategy. So strategy is the vehicle that will hopefully lead us to our goals, both short-term and long-term. The five necessary elements for building missions are simple and the goal is equally simple. We want to involve every believer in fulfilling the Great Commission by giving, praying or going. This manual/workbook will guide you in preparing effective missions Sunday presentations, keeping missions exciting and fresh throughout the year. Allow the Holy Spirit to guide you as you read the following pages. Let God show you the steps necessary to transform your congregation into a “Great Commission Church”. 7 SECTION 1 Plans fail for lack of counsel, but with many advisers they succeed. Proverbs 15:22 NIV Commit to the LORD whatever you do, and your plans will succeed. Proverbs 16:3 NIV 8 PART 1 LAY THE FOUNDATION The Importance Of A Missions Team The primary purpose of the church is to spread the gospel. That is called missions. All else is or should be built around that central purpose. And let’s face it. The pastor can’t do it alone! Many churches have a missions committee. The problem with committees is that the very word committee suggests a group seated in a circle talking, talking, and talking. But we need more that talk. We need action. That is why I like to call it a missions team. The word team suggests action or movement, cooperation, excitement and winning: Get the idea? An active missions team will help the pastor cast vision for reaching a lost world. A missions team can involve a large part of the congregation in missions through delegation. The benefits are two-fold: Much more is accomplished and criticism is minimized because people don’t criticize what they are involved in doing. For more information on how to build a missions team and guidelines for its functions, see volume 1, Building Missions Leadership in the Local Church. Keep The Team Involved Throughout The Year The missions team is not a group that meets occasionally to rubberstamp plans already made by the pastor or board. They are a hands-on work force ready to assist the church leadership in creating opportunities for the membership to move into obedience to the Great Commission. The team will be working throughout the year on the planning, not only of their next missions convention, but also of the conventions for two or three years in advance. They will constantly fine-tune their Missions Sunday program and coordinate their weekly or monthly prayer program for missions. The list goes on and on, but I’m getting ahead of myself. In short, the missions team will assure that the five essential elements for building missions in the local church are in place. Let me think. What were those five elements again? 1. An active missions team 2. Annual missions convention (See volume 2, Building Missions Support with an Annual Missions Convention ) 3. Monthly missions Sunday (See Section 2 of this manual) 4. Regularly scheduled prayer for missions (See volume 4, Building Missions Effectiveness through Prayer 5. Frequent missionary speakers (See volume 5, Building Missions Partnership through the Missionary Visit ) 9 Make Sure Missions Team Members Attend All District And National Missions’ Activities It is difficult to develop a world vision when you know nothing about the rest of the world. The best way to open the world to your team members is to take trips to the mission field. The next best way is to attend those meetings conducted on both the district and national levels that bring the mission field to you. Well, maybe not all of it, but enough so that you begin to get a glimpse of what it is like. When you begin to see the need, that is when a burden begins to form and then a vision. Why do you think Jesus said, “Look at the fields that are white, ready to harvest”? They had to see the need first before they would feel the need. Once the team has “seen” the need, they can carry that vision back to the church and expose the congregation to a new way of seeing the world. In other words, they will begin to see the world as Jesus sees it! An Annual Missions Convention Is A Must Speaking frankly, it is sometimes difficult to convince a pastor to conduct a first-time missions convention in his church. But, do you know what is almost as difficult? Getting that pastor to conduct a convention the next year! He usually gives one of two reasons for not conducting a second convention. He said it was too much work meaning he and his wife tried to do it all. Or, they were just too busy. Translated that means, they waited too long and the calendar filled up with things. Not necessarily important things, just things. I wouldn’t go so far as to say that it does no good to conduct a convention if you don’t continue the following year. It is obvious, however, that the major impact of that convention dissipates quickly and little fruit will remain. When church leadership determines to bring their congregation into obedience to Christ’s command, that commitment is long-term. It should be from now until Jesus comes. Not from now until finances are bad or from now until we go into a new building program. Not from now until we change pastors but from now until He breaks the clouds of glory! After all, He didn’t request that we reach the world. He commanded it! 10 PART 2 IDENTIFY THE TOOLS AVAILABLE TO YOU When making plans for missions Sunday it is helpful to know what tools are available to make your efforts more effective. AGWM is constantly searching for new ideas and creating new materials for your use. Listed below are some of the items available to you. Some are free of charge while other items are provided at minimal cost to your church. FROM WORLD MISSIONS • Toll Free Number to order catalogs and materials: 1 (800) 988-6568 Or call (417) 862-3420, extensions 2061/2071 • DVD ANNUAL Theme Video (DVD) MONTHLY 2-4 Minute Clips Newsbreak – For Adults Newsbreak – Translated into Spanish WorldBeat – For Teens Go 360 – For Children Annual subscription $48: DVD mailed monthly includes all 4 formats • PowerPoint Presentations Can be downloaded by topics at homepage: mat.forallnations.com or you can purchase a CD with 17 PowerPoint presentations prepared for the local church. Collection #1 is for the congregation. Collection #2 is to assist and inform the missions committee and Collection #3 contains illustrated sermons on missions and soul-winning. Order your copy by calling (417) 272-6095. • Web Site worldmissions.ag.org Downloadable items on Web site under “Quick Navigation” tab: 1. Commitment Cards (Faith Promise Cards and Pledge Forms) 2. Short-term (MAPS) Application Packet 3. MAPS Builders 4. World Missions Clip Art • CATALOG And ORDER FORM Viewable at worldmissions.ag.org/resources/resources.cfm (Order Form is downloadable) • Call To Prayer Missionary Photo Directory (Published twice yearly) • Resource Manual Into All the World (Available in both English and Spanish) Practical Helps for Pastors and Missions Committees 11 • The Blueprint Series Volume 1, Building Missions Leadership in the Local Church Volume 2, Building Missions Support with an Annual Missions Convention Volume 3, Building Missions Vision, Month By Month Volume 4, Building Missions Effectiveness through Prayer Volume 5, Building Missions Partnership through the Missionary Service The Checklist Manual – A digest of the five manuals listed above. Five PowerPoint presentations are available for teaching purposes and may be secured by calling (417) 272-6095. Note: All of the above materials are available in both English and Spanish. • Missions Touch Screen Displays Countries and Missionaries Active in World Missions E-mail: [email protected] • Books Heroes of the Faith series (Volumes 1 – 5) – see catalog • Today’s Pentecostal Evangel, World Missions Edition First Sunday Edition each month: Call 1 (800) 641-4310 • Missions Convention In A Box Everything needed to conduct a Missions Convention in a church of up to 75-80 in attendance. (For churches having a first-time Missions Convention or the first one in at least three years) Call (800) 988-6568 FROM OUR PARTNERS (SUPPORT MINISTRIES) • BOYS and GIRLS MISSIONARY CRUSADE (BGMC) An excellent selection of video clips and CDs are available, presenting missions from a child’s perspective. Call (417) 862-2781, ext. 4009 or check bgmc.ag.org • Light for the Lost To order training materials and promotional supplies call 1 (800) 988-0292 Or visit their web site at lftl.ag.org • Mission America Convention materials and resources promoting U.S. Missions are now available by calling 1 (800) 988-6568 where you may order your convention materials for both U.S. and World Missions. • Speed the Light To obtain promotional materials, call (417) 862-2781, ext. 4029 or log on to youth.ag.org • Women’s Ministries For resources call (417) 862-2781, ext. 4060 or check their on-line store at womensministries.ag.org 12 SECTION 2 Jesus said, “ …open your eyes and look at the fields ready for harvest now. Already, the one who harvests is being paid and is gathering crops for eternal life. So the one who plants and the one who harvests celebrate at the same time. John 4:35-37 NCV 13 PART 1 MISSIONS SUNDAY IS A KEY TO SUCCESS An Annual Missions Convention Is Not Enough The average pastor believes that if their church conducts an annual missions convention, the congregation is missions minded. But experience shows that within three months following the convention, monthly faith promise income will experience a sharp decline when a consistent effort is not made to keep missions before the congregation. The primary cause of decreased faith promise giving through the year is a failure to keep missions fresh and exciting. A well-planned monthly Missions Sunday will help maintain a high level of faith promise giving throughout the year, possibly even exceeding the faith promise commitments made during the convention. A Successful Missions Sunday Doesn’t Just Happen Unfortunately most churches put little or no planning into their missions Sunday presentations. In many cases it becomes nothing more than an announcement that it is missions Sunday and your faithful giving is appreciated. But it is difficult for the congregation to maintain a high level of commitment to missions if it is not a priority to church leadership. Missions Sunday seems to come around so often that it catches many leaders by surprise, and unfortunately, unprepared. Why not plan your missions Sunday program for a full year at one time? There are several advantages: 1. Your program will be well planned. 2. Planning a full year at a time will help you cover all the bases, giving balance to the presentations. 3. It will remove the monthly pressure for those responsible for planning missions Sunday. 4. It will educate and inspire the congregation. 5. A well planned missions Sunday will keep the people excited about supporting missions with their monthly faith promises, thus maintaining active most of the faith promises made during the annual convention. The Monthly Presentation For Missions Sunday Should Be A Highlight For That Service The monthly missions Sunday presentation does not require the whole service. It may vary in length from 3 to 10 minutes according to the material used. It should be given a prominent place in the worship service schedule, communicating its importance. Giving the monthly missions slot a name, such as “Window on the World” will help define its purpose. Local circumstances and customs will influence your decision as to which Sunday of the month is preferable. Most churches have chosen the first Sunday of each month for their “Window on the World”. 14 Although you are not obligated to choose the first Sunday, there are advantages to doing so. The World Edition of the Pentecostal Evangel, released for use on the first Sunday of each month, is prepared by Assemblies of God World Missions. The theme each month is underscored with additional material in Newsbreak, a monthly DVD available by subscription. The use of these quality tools will enhance your monthly presentation while educating and motivating the congregation. Missions Sunday Is Not A Penny March It is a focus on a lost world and it deserves our best, not our leftovers! A well-planned “Window on the World” each month will help train the congregation in planned giving, making their faith promises, committed at the missions convention, a reality and not an empty pledge. The ultimate success of the faith promises raised at the annual missions convention will be determined by how effectively the monthly missions Sunday presentations are planned! 15 PART 2 IDEAS TO MAKE MISSIONS SUNDAY SPECIAL Utilize The Pentecostal Evangel • Coordinate your “Window on the World” focus with the theme of the world edition of The Pentecostal Evangel released on the first Sunday of each month. • The theme of the monthly world edition is coordinated with the theme of the monthly videos available from AGWM. Use The Monthly DVD Produced By AGWM • Experience has shown that monthly missions giving will be as much as 30% higher when the monthly DVD is shown prior to receiving the faith promise giving. • There are three presentations available by subscription each month: 1. News Break – This is created for missions Sunday. 2. World Beat – A missions clip prepared especially for youth by youth. 3. Go 360 – Children are not forgotten since a monthly missions presentation is available just for them. • All three of these items are available on DVD for a subscription price of $48 yearly. A Spanish clip is available each month. To order video subscriptions call (417) 862-3420. Pray Around The World 1. Africa 2. Asia Pacific 3. Eurasia 4. Europe 5. Northern Asia 6. Latin American and the Caribbean 7. Specialized Ministries • Share a request from each region and have corporate prayer. • Publish these requests in the bulletin on Missions Sunday. 16 Keep The Congregation Informed About Faith Promise Giving • Publish the current missions giving in the bulletin each Missions Sunday. • Share faith-building words to encourage continued support for missions. Send A Monthly Letter With A Missions Offering Envelope If sent the week before Missions Sunday, it will serve as a strong reminder of their faith promise and will encourage faithfulness in giving. Send A Quarterly Receipt Of Faith Promise Giving It is amazing how this will affect faithfulness in giving. It serves as a reminder without the sense of nagging. Purchase Flags Representative Of The Nations Where You Support Missionaries • Display a flag from a different nation each month for “Window on the World” • Make that nation your prayer focus for the day. • Flags are readily available from many suppliers and can be purchased in a variety of sizes and qualities. A partial list of suppliers follows, but no endorsement is made, although each has been used with satisfaction by some of our churches. Ozark Flag Distributors, www.ozarkflag.com (800) 288-3101 Frontier Flags, www.frontierflags.com (800) 658-0413 Flags, Etc. Inc. [email protected] (650) 343-3017 Call A Missionary Family • Call the missionary in advance and set up the phone appointment. • Amplify the conversation through your sound system so the congregation can hear. • Project their photo on the screen while talking with the missionaries. • Interview the family. • Ask for their prayer needs and have the congregation pray for them while the missionaries are still on the line. Include Your Youth With Music And Drama • Use a skit with a missions theme. • Present a human video with a missions song. • Don’t forget mime. • The more people who get involved, the more successful your effort to build missions awareness. Share Excerpts From Missionaries’ Letters • This can be done on a limited basis. 17 • Share excerpts only when the content is so exciting and so urgent that it should not be ignored. • All missionary newsletters should be posted on your “World Harvest” bulletin board. Give Opportunities For Personal Testimonies • Share a testimony from a member who has experienced divine blessing and provision resulting from making a “Faith Promise”. • The congregation will better identify with the pew than with the pulpit. • Others will be inspired to faithfulness by these examples of victory. Vary The Focus Of Your “Window On The World” From Month To Month Some months you may wish to focus on regions of the world such as Africa, Asia Pacific, Europe, Eurasia or Latin America/Caribbean. Some months you may wish to spotlight ministries such as Boys and Girls Missionary Crusade or Speed the Light. Of course, you will want to take advantage of the monthly video series NewsBreak. It Will Take Some Planning, But It Will Be Well Worth Your Effort • Both giving and missions awareness will increase. • You will be blessed because of your obedience to Christ’s command. • Begin your planning with confidence. God’s Word assures us that our efforts are not in vain when we lead our people in generous giving as a life-style. One man gives freely, yet gains even more; another withholds unduly, but comes to poverty. A generous man will prosper; he who refreshes others will himself be refreshed. Proverbs 11:24-25 (NIV) Whatever We Do For The Master Deserves To Be Done The Right Way! Whatever you do, work at it with all your heart, as working for the Lord, not for men, since you know that you will receive an inheritance from the Lord as a reward. It is the Lord Christ you are serving. Colossians 3:23-24 (NIV) SO, LET’S PLAN “WINDOW ON THE WORLD” AS THOUGH IT WERE A LIFE OR DEATH MATTER… IT MAY BE, YOU KNOW. 18 ADDITIONAL IDEAS FOR “WINDOW ON THE WORLD” 19 PART 3 PLAN MISSIONS SUNDAYS FOR A YEAR AT A TIME The Advantages Of Planning Ahead We usually get just about what we plan for. I know that’s not good grammar, but it communicates a truth. Most church leadership has the best of intentions following the missions convention. They hope missions giving will be fairly stable during the year, but they really won’t be surprised if it begins to drop. To be truthful, past experience leads them to expect it. They really intend to keep enthusiasm up throughout the year with a well- planned “Window on the World” each month, but as the year rushes by, they just don’t find the time. The month just goes by too quickly. It seems they hardly finished last month’s missions Sunday and here it comes again! Don’t feel alone! It happens to hundreds of pastors and leaders across America. Instead of giving up or beating yourself up, let’s find a way out of the dilemma. There is a simple solution. You have a missions team so it’s time to put them to work. If you don’t have a team it is time to form one, now. Have the missions team do the major part of the planning for a full year of “Windows on the World” at one time. That’s right. The team can create the framework or the general plans for 12 months of missions presentations at one sitting. There are several advantages. Let’s look at a few: 1. Seeing the year as a whole, they can plan a more balanced program. 2. It will give them time to include items that they might not be able to include when planning month by month. 3. It reduces the stress of preparing something at the last minute. 4. Each team member has ample time to prepare for their participation. 5. Each “Window on the World” can be a quality presentation. When the team has done this, they can rest assured they have joined their hands with God’s purpose of redeeming mankind. How? They are inspiring and motivating faithfulness on the part of the people of their congregation in their faith promise giving. That is no small thing! And the pastor can rest assured that the time set aside for missions during each “Window on the World” is one of the best investments of time every month! 20 ANNUAL PLANNER Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be 21 ANNUAL PLANNER Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be 22 ANNUAL PLANNER Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be Month Our missions team will meet this month on Our missionary speaker(s) this month will be Our feature for missions Sunday “Window on the World” this month will be 23 PRESENTATION FOR MISSIONS SUNDAY, , 200 Month Date Missions News (For the latest missions news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 24 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 25 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 26 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 27 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 28 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 29 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 30 IT IS TIME TO CHECK YOUR PLANS FOR YOUR NEXT CONVENTION Set dates for the convention Our convention will include the dates from ______to ______ Prepare schedule Our convention will consist of the following: Type of service Date Speaker Confirm speakers: ______for for for Be sure to order your Missions Convention Planning Kit now from Assemblies of God World Missions, U. S. Relations 1445 Boonville Avenue Springfield, MO 67802 Or call: 1 (800) 988-6568 or (417) 862-3420 For step-by-step assistance in planning your convention, ask for Volume 2, Building Missions Support With an Annual Missions Convention. 31 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 32 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 33 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 34 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 35 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 36 PRESENTATION FOR MISSIONS SUNDAY, ,200 Month Date Missions News - For the latest mission’s news, prayer requests and testimonies go to www.worldmissions.ag.org Missions Prayer Needs: Today’s Focus: Available Resources: Faith Promise Giving Faith Promise total for the year ……… Missions giving due to date……..…… Missions offerings received to date… Excess or shortfall……… Receive the Missions Offering 37 SECTION 3 Do you not say, 'Four months more and then the harvest'? I tell you, open your eyes and look at the fields! They are ripe for harvest. John 4:35 NIV That night Paul had a vision. He saw a man from Macedonia in northern Greece, pleading with him, "Come over here and help us." Acts 16:9 NLT 38 Part 1 PLAN A MID-YEAR CONVENTION Many churches have found that conducting a mini-convention six months after the annual convention gives a big boost to the overall missions effort. These pastors say they conduct a mid-year convention for usually for one of two reasons: either their church exists in a very transient area such as military bases, etc. or the church is growing rapidly and they don’t want to wait many months to expose the new converts or members to the faith promise plan. Those coming into the church a month or two following the annual convention would have to wait as long as eight to ten months before having an opportunity to make a faith promise. There is, undoubted, a third benefit for every church, even those not located in transient areas nor experiencing great growth. A mid-year mini-convention will renew the missions focus for the individual believer and encourage each one to be faithful in their faith promise giving. Some churches plan a full schedule of activities similar to their annual convention, meaning that their faith promises are set up for six month periods, but most use the concept to give a boost, continuing with the yearly faith promise challenge. In either case, those making a faith promise during the mini- convention would understand that it would be effective until their next convention. The average mid-year convention will occupy one Sunday, usually with no banquet. This would be a great opportunity, however, to have a “Partners Banquet” for all who made a faith promise during the annual convention. It would be a smaller group but it would recognize the importance of those who carry the missions vision there in the local congregation. One missionary speaker may be invited to receive faith promises on Sunday morning and remain to speak again on Sunday evening if the church has a Sunday evening service. Others will invite a separate speaker for the evening service or to attend house meeting, as the case may be. There would be little additional cost involved except for speakers since you could use the same theme materials used in the annual convention just six months earlier. Another idea is to save all of the theme materials from year to year and recycle them two or three years down the road for the mini-convention. 39 Part 2 SCHEDULE FREQUENT MISSIONARY SPEAKERS Of all the elements necessary for building a strong missions vision in the local church, inviting missionary speakers is by far the easiest. It really doesn’t require a lot of creativity or extra work. It only requires a few phone calls and some basic provisions for the visiting missionaries. Last year well over 5,000 Assembly of God congregations were deprived of a missionary visit because the leadership of those churches did not make provision for that vital ministry to their congregations. To say that one believes in missions but never invites a missionary speaker is an incredible contradiction! If the pastor doesn’t lead the congregation into obedience to Christ’s command to reach the whole world, who will? And what will happen to the pastor who fails in this responsibility? It is a fearful thought! Schedule A Missionary At Least Quarterly The missions convention with the faith promise challenge is the cornerstone for building missions vision within a congregation, but its results will dissipate quickly if steps are not taken to keep missions interest high. Having frequent missionary speakers in your church is one of those steps. Scheduling a missionary once each quarter should be a minimum, not your goal. Exposing your congregation to representatives from four different areas of the world during the year could certainly not be considered overload. Schedule Missionaries To Speak In Different Types Of Services Not everyone in your congregation attends all of the services. Let’s assume that you have the typical Sunday morning and evening plus Wednesday evening service schedule. Some may be absent from the sanctuary every Sunday morning because they are working with the children. Others are committed to the nursery every Sunday evening. Still others work with Royal Rangers and Missionettes on Wednesdays. If you consistently schedule your missionary speakers for Sunday evening, those who only attend on Sunday mornings plus those committed to other church ministry during that time will never hear a missionary message. That is why it is important to occasionally schedule a missionary for each type of service, thus giving exposure to all of those who are a part of your congregation. Missionaries Are Not A Pulpit Supply The presence of the pastor is critical when the missionary visits. The rhythm is broken when the missionary has to minister in the pastor’s absence. The purpose of the missionary’s visit is not only to minister to the congregation, but also to interact with the pastor concerning finances and monthly support. This is not possible when the pastor is absent. 40 Even when the pastor has made every arrangement for the missionary, it is still awkward. Let’s face it. The pastor’s absence can communicate a lack of concern. When the missionary comes to your church, show the congregation just how important missions really is to you as pastor. Having missionaries come throughout the year is a key to a successful missions outreach. Missionaries impart vision and burden, qualities needed by the local congregation. A missionary visit should never be considered an interruption but rather an opportunity. With foresight and planning, most churches could have a missionary visit each month. If finance is a concern, money can be budgeted from the faith promise giving to subsidize the missionaries’ offerings. When an unexpected scheduling conflict arises, rather than canceling the missionary service, make room for the missionary to give a ten-minute presentation. Utilize your missionary guests in your Sunday school classes as well. Don’t forget other occasions such as men’s breakfasts, house meetings and fellowship groups. Always give your congregation the opportunity to respond to the missionary appeal with a generous offering. Both your congregation and the missionary will be blessed. Remember, were it not for the missionary visit, you and your congregation would have no way to obey the Great Commission other than to sell everything and go yourselves to the “regions beyond”! Maybe you ought to praise God for the missionary visit! For more information on how to get the most from the missionary visit, order volume 5, Building Missions Partnership through the Missionary Visit. 41 PART 3 COORDINATED PRAYER FOR MISSIONARIES IS A KEY ELEMENT We become partners with our missionaries when we support them either by giving monthly support or by praying for them on a regular basis. When we fail to give, the missionary feels the effects of that loss. When we fail to pray, we weaken the missionary’s effectiveness. There is no question about it. Our missionaries depend on us to support them in prayer. As leaders we have a responsibility to do more than share an urgent request that we receive in a newsletter. We must approach prayer for missionaries as their lifeline! When we look at prayer for the missionaries as the most important thing that we can do for the missionaries it will change our attitude about prayer. (For an in depth guide on this subject, order volume 4 of the Blueprint Series, Building Missions Effectiveness through Prayer.) Make Prayer for Missions a Regular Part of Church Life • Publish the names of the missionaries that you support in your bulletin on a rotating basis. • Include missionary requests in your prayer list or in your weekly bulletin. • Pray publicly for urgent missionary needs. • Distribute a list of the missionaries supported by your church including the names of their children, ages and special days. • Form missions prayer groups for each region of the world or, if the church is not large enough for several groups, focus your intercession on a different region each month. • Place pictures of missionaries around the walls of the sanctuary with details of their location and ministry. During special prayer the people can move from one area to another, interceding for the missionaries by name and need. Encourage Private Prayer for Missions It’s not enough to direct the congregation in corporate prayer for missions and missionaries. Church leadership must, not only encourage, but also equip church membership for effective intercessory prayer for missions in their private devotions. This can be done by providing them with: • Frequent updated prayer lists of missionary needs • A subscription for each family for the Call to Prayer for World Missionaries (see description below) • A free copy of the Missionary and Chaplain Prayer Guide for U.S. Missionaries for each family (see description below) Equip Your Congregation for More Effective Prayer For decades church leadership has encouraged the membership to pray for missionaries, but few tools were provided to make those prayers knowledgeable 42 and effective. Now AGWM has made available a variety of tools that will assist those members who are serious about becoming prayer intercessors for missions and missionaries. • Subscribe To Call To Prayer For Every Family. This magazine is published twice yearly and contains the pictures of each of the mission- aries on the date of their birth. In the course of a year you will have prayed for every missionary in Assemblies of God World Missions. Included also is a section with the names and birth dates of the missionaries’ children (MKs). • Enroll In The Free E-Mail Service Prayernet. Current prayer requests for missionaries, the missionary work, crises and disasters are made available through the offices of World Missions and can be secured by subscribing on-line: [email protected] Missionary prayer needs are forwarded daily as received. These can be shared on prayer lists, in prayer groups or in regular services as deemed necessary. • Subscribe To Intercessor &World Report This one page weekly fax or e-mail publication provides urgent missionary and country prayer needs and short articles about missionary ministries a round the world. Sent on Tuesday afternoons, it is an ideal tool to inspire a congregation to pray for missions, especially during midweek services. Articles can be read from the pulpit, included in the church bulletin or posted in the church. (See Part 2 for more information on how to order these and other materials.) Prayer Materials Produced By U.S. Missions • Missionary and Chaplains Prayer Guide The Prayer Guide is a pictorial directory of U.S. missionaries and chaplains, according to their birth dates, and includes spouses and children. Free • U.S. Missions Prayer Team Weekly E-Mail Join the U.S. Missions prayer team and receive weekly prayer needs and praise reports from your U.S. missionaries and chaplains. To subscribe, e-mail [email protected] . 43 PART 4 CREATE AN ATTRACTIVE MISSIONS DISPLAY It is not difficult to determine the place that missions holds in the life of the congregation just by a casual stroll through the lobby and hallways, in an extremely large number of churches, unfortunately, there will be no evidence of missions at all. Others will have a bulletin board and/or missionary commitment certificates displayed, but with little care and in an area seen by few people. It is a delight to enter a church and see an attractive missions display prominently placed in such a way that says, “Missions is a priority here!” It doesn’t require a fortune to create such a display, but it does require a real heart for missions. WHERE SHOULD IT BE LOCATED? • A clean wall in a well-trafficked area in the lobby. • It must be well lighted and attractive. WHAT IS NEEDED TO CREATE A “WORLD HARVEST” DISPLAY? • A bulletin board for newsletters from missionaries and other late-breaking missions news, etc. • Assign a missions team member to update the materials at least bi- weekly. • Surround it with the certificates of monthly support for the missionaries. • Include a curio case for curios from missionaries and missions trips made by the church. • Use globe wall art as the centerpiece of the display. • Listed below is information that will assist you in securing a wall sculpture for your missions display. Brass Hemispheres New World Globe Wall #100269 #38268 www.cowboyindian.com www.blair.com Price: $380 Price: $99.99 44 PART 5 DEVELOP A STRONG MISSIONS SECTION IN THE CHURCH LIBRARY This is the information age. Resource material is available everywhere on every subject imaginable. But wait. Did I say, “Every subject, everywhere?” What about missions in the church library? Too often it is a subject totally overlooked or so outdated that it is embarrassing. If we have to apologize for our section on missions in our library, we need to do something about it! Listed below are books recommended for the missions section in your church library. Assemblies of God Authors. Heroes of the Faith Series – AGWM Heroes of the Faith 1 - $2 Heroes of the Faith 2 - $3 Heroes of the Faith 3: Sacrifice and Triumph - $3 Heroes of the Faith 4: Compelled by Compassion - $3 Heroes of the Faith 5: When God Breaks Through - $4.50 High Adventure in Tibet – David Plymire – AGWM - $2 Reign of Terror – Reign of Grace – Jerry Falley – AGWM - $3 All of the books listed below this line may be purchased by our churches at a discount at 4 Wrd Book Connection in Springfield, Missouri, a ministry operated by Gary Flokstra. Their telephone is (417) 862-4448 and Fax is (417) 863-9994 E-mail [email protected] Website: www.4wrd.org Eye on Europe – Greg Mundis Missions in the Age of the Spirit – John V. York Partnership in Missions – Morris Williams People of the Spirit – Gary McGee Strategy of the Spirit – J. Philip Hogan, Everett A. Wilson The Essential J. Philip Hogan – Byron Klaus, Doug Peterson The Globalization of Pentecostalism – Murray Dempster, Byron Klaus, Doug Peterson The Indigenous Church – Melvin Hodges The Missionary Family – Betty Jo Kenney Other Books of Great Value Healing the Broken Family of Abraham: New Life for Muslims – Don McCurry Ismael, My Brother – Anne Cooper Jesus in Beijing – David Aikman Missions in the Third Millennium: 21 Key Trends for the 21st Century – Stan Guthrie Operation World – Patrick Johnstone, Jason Mandryk – Bethany House 45 Spiritual Leadership: Moving People on to God’s Agenda – Henry and Richard Blackaby The Church is Bigger Than You Think: Structures and Strategies for the Church in the 21st Century – Patrick Johnstone The Missions Addiction: Capturing God’s Passion for the World – David Shibley Be Sure to Include Audio-Visual in the Missions Section Your Library Newsbreak, WorldBeat and go 360 A good place to start is to catalog these videos, received on DVD each month by subscription, after they have been shared with the appropriate age groups. Their information and inspiration value will continue for many months, but their historic value will last for years. World Focus CD This CD presents a summary of each country where the Assemblies of God is involved in missions work. A great resource tool! Support Ministries Be sure to save and catalog all audio-video materials received from our Support Partners after their initial use. 46 PART 6 PLAN A MISSIONS TRIP An annual missions convention, well-planned missions Sundays and frequent missionary speakers all help bring the needs of a dying world into focus, but there is nothing that will make a more powerful and permanent impact than a trip to the mission field. Of course not everyone can go, but for those who do, it brings a transformation. They will never be the same! In fact, once they have experienced missions, however briefly, they want to go again and again. Many will take vacation time and pay their own expenses just to feel that they are serving God during this week or ten days each year. Upon the return of the team, give the team a Sunday evening service to share their missions’ experiences. Their new enthusiasm and passion for the lost will influence many others. Missions giving should increase as a result of the clearer focus on the mission field. Many churches will sponsor one or more trips each year, both in the U.S. and overseas. Maybe you can’t sponsor a trip each year, but you could sponsor a smaller group every two or three years. Give it a try. If that is still not within your reach, partner with another church or go on a district sponsored trip. It won’t happen unless you make it happen. So just do it! Listed below are some of the groups within the Assemblies of God that sponsor missions’ trips. Pick the one that best meets the needs of your congregation and give them a call today. AMBASSADORS IN MISSION (AIM) Since 1966, thousands of Assemblies of God youth have been involved in evangelistic ministry through Ambassadors in Mission, an outreach of the national Youth Department. During one to two week terms of service, young people use puppetry, drama, music, mime, crusades and one-on-one witnessing to tell others about Christ. AIM teams work closely with missionaries and national pastors to integrate new converts into local churches. We know another agency that is sponsoring a youth trip overseas. Won’t it give the same result if we send our young people with them? What do you really know about the agency? What do you know about their doctrine? What do you know about those who will be in charge of your teenagers? What will the circumstances be on the field? If you can’t know the answers to all of these questions, then you had better know the reputation of those who will be in charge on the field. That is where the Assembly of God missionaries excel. You may not know each one of them personally, but you know their reputation and that is important when you send to the foreign field your most valued treasures – your young people! 47 MAPS CONSTRUCTION TEAMS What is MAPS CONSTRUCTION? MAPS CONSTRUCTION exists to serve the church by… • Working with AGWM missionaries in assessing building needs • Locating people and finances to assist in overseas construction projects • Accelerating the spread of the gospel by building churches, Bible schools and other ministry centers around the world • Providing opportunities for U.S. believers to participate in the worldwide spiritual harvest MAPS CONSTRUCTION helps missionaries by assisting with… • Strategic planning, architectural and engineering services • Providing construction teams • Providing ministry teams • Financial resources MAPS CONTRUCTION makes U.S. churches and believers aware of missions ministry around the world by… • Sharing the ongoing need for workers and finances for a variety of construction projects. In most cases teams provide funds for all materials used while working on the project. • Providing opportunities for U.S. believers to become actively involved in world missions by joining a construction team. Most teams range from 12 to 15 people. • Linking church teams to AGWM missionaries who will supervise and coordinate the building project. The entire team can be from one church or from multiple congregations. To ensure that U.S. teams and overseas missionaries have a positive experience during MAPS CONSTRUCTION trips, AGWM has established these guidelines: All team members must • Be at least 18 years old. • Be believers in good standing with the local church and agree to all policies set forth by AGWM. All MAPS CONSTRUCTION teams must • Be registered with the MAPS Construction office. To register, call (417) 862-2781, extension 2067. • Be under the direct supervision of an AGWM missionary. • Obtain overseas insurance – a requirement when working with an AGWM missionary. We have a group wanting to do some construction work overseas. Can we accomplish the same thing if we go with another denomination or a para-church group? That’s a good question. Although we are certainly not opposed to the work of other missions agencies, the truth is, you just don’t know 48 what kind of situation you are going to find when you get to the field. Too many times, those who have gone with other groups have discovered their mistake only when it was too late. Some have returned with horror stories about what happened on their trip. Or worse yet, our own missionaries have told us of teams from A/G churches have come to the field and built buildings, not just for non- Pentecostal churches, but churches that oppose Pentecost. Now, that is just wrong and it doesn’t have to happen. Can we work directly with the missionary on the field without working with the offices in Springfield? When you attempt to by-pass the coordinating office and work directly with the missionary, you put that missionary under tremendous pressure. The missionary knows that they are to receive approval and coordination for every project and every group who comes to their field. This places that missionary in a position of knowing what they must do, but not wanting to offend their supporting church. When a group goes out without going through MAPS Construction, they do not have the advantage of the overseas insurance. On more than one occasion uninsured team members have become extremely ill or have died on the field, necessitating expensive transportation costs that might have been covered had proper provision been made. There are rules, but they are not arbitrary. AGWM has a long track record and the rules have been established for the protection of everyone involved. PRAYER TASK FORCE Each year Prayer Task Force teams, coordinated under the supervision of a Task Force representative of AGWM, travel to other nations. Their purpose is to offer support to missionaries and the work of missions in a particular location through the team’s ministry of prayer and fasting and to assist in evangelism efforts. Team members must be mature, dedicated Christians, 16 years or older. Both singles and couples are welcome. Teams are composed of ministers and laity. Men’s and Women’s Ministries groups, church organizations, and Light-for-the- Lost teams often participate in Prayer Task Force teams. These teams are needed to work with missionaries in countries or areas where new doors of opportunity have opened for evangelism or where resistance to the gospel has made ministry difficult. Any individual or group desiring to participate on a Prayer Task Force team should contact the Missions Awareness Team Office, 1445 N. Boonville, Springfield, MO 65802-1894 or call 417-862-2781, Ext. 2050. 49 PART 7 INTRODUCE SUPPORT MINISTRIES TO INCREASE PARTICIPATION Boys and Girls Missionary Crusade BGMC as it is usually called is best known for Buddy Barrel, used by the children to collect coins, which are then brought to place in the missionary offerings. Now, for the rest of the story, as Paul Harvey would say. Since 1949 Boys and Girls Missionary Crusade has served as the children’s missions education and fund-raising program of the Assemblies of God. Sponsored by the Assemblies of God Children’s Ministries Agency/Boys and Girls Missionary Crusade, it provides free children’s missions education curriculum and resources to participating churches. Money given by children to BGMC provides missionaries with funds to translate and print literature, purchase Sunday school materials, Bibles and children’s evangelism materials, and provide libraries and textbooks for overseas Bible schools. Speed the Light The Speed the Light program of the national Youth Department has involved Assemblies of God young people in giving to world missions since 1944. Speed the Light funds provide transportation and communication equipment to missionaries, enabling them to take the gospel farther and faster. Youth from across the United States commit their personal funds to faith promise giving, as well as hold fund-raisers and collect donations, to purchase equipment for missionaries. The money raised has provided hundreds of missionaries with cars, trucks, motorcycles, horses and other means of transportation. Light for the Lost Light for the Lost is a ministry of Assemblies of God laymen that provides evangelism literature for use around the world. LFTL literature is used by missionaries in witnessing door-to-door, in marketplaces, and during evangelism and church planting efforts. Often literature is mailed to areas where missionaries cannot go. Since its inception Light for the Lost has raised more than $216,000,000 for literature for evangelism. Women’s Ministries The Women’s Ministries Department was founded with the purpose of ministering to missionaries and their families through prayer and the provision of material goods. Since 1925, women across the United States have given generously to supply household needs for missionaries. Their gifts have also provided items, such as beds, curtains and kitchen appliances, for Bible schools and children’s homes around the world. 50 Senor Adult Ministries Senior adults are a vital and growing facet of the church. Increasingly, they are becoming involved in world missions through their prayers and financial gifts. By joining their efforts to specific causes overseas, senior adults within a church, a section or a district are raising funds to expand the Kingdom and are interceding for specific needs faced by nations, national believers and individual missionaries. 51 PART 8 KEEP THE MISSIONARIES BEFORE THE PEOPLE Most people will not remember a missionary who spoke for 25 minutes (or maybe just 10 minutes) four or five years ago. That missionary has little hope of being remembered in prayer unless he or she is kept before the congregation. There are many creative ways of doing this. The benefits that accrue for the missionary are not just through prayer but also by being remembered on special days and receiving encouraging notes from time to time. Partnerships develop that can last a lifetime and it all started because leadership kept the names and faces of the missionaries before the congregation on a regular basis. Missionary Directory Many churches produce a directory containing the photographs of the missionaries that they support along with details of their family, type and place of ministry. This serves as a great prayer tool as well. Of course, printing a directory is beyond the budgetary possibilities of many smaller churches. They say, however, “Where there is a will, there is a way”. Numerous churches request a quantity of prayer cards from each of the missionaries that they support. Once collected, they punch a hole in each card and run a key chain through each set of cards. When finished they give a set of prayer cards to each church family to use in their prayer time. The cost? Almost nothing. The Impact? Immeasurable! Missionary Calendar It is not unusual for our churches to now print their own calendars with the date of activities for the coming year. Some smaller churches even include the birthdays of their members. If your church prints a calendar, why not include the birthdays of the missionaries supported by the church? This gives one more opportunity to be reminded that they are our partners, although far removed from us. Call to Prayer Published semiannually, Call to Prayer, is a pictorial directory of world missionaries – listed according to their birth dates – which can be used as a daily guide for praying for individual missionaries. The two issues each year form a directory of all missionaries with AGWM. It is another great tool for keeping the missionaries before your congregation. Why not subscribe for each family in your church? Keep the Missionaries before the Congregation – Literally Many churches are now taking advantage of the time prior to the beginning of the service, while people are beginning to gather, to project the pictures of the missionaries on the screen with information concerning their field, ministry and family. These are placed on a loop and repeat until time for other announcements or the beginning of the service. Now, that is a great idea! 52 PART 9 OFFER CLASSES ON MISSIONS If we truly want our people to be missions minded, then we have to make missions a priority in the agenda of our church. It is easy enough to see what part missions occupies in the church program by simply looking over an average three month schedule of church services and activities. During those three months, how often was missions represented and to what degree? Unfortunately, in far too many churches, there will be none. How do we know? Because last year over 2,000 Assembly of God churches gave nothing to World Missions! In many other churches the only mention would be a passing reference to the fact that it is missions Sunday. O.K. So the world is not perfect, but can we dream of what might be? Wouldn’t it be great if, in addition to an annual missions convention and a well-planned monthly missions Sunday, we had some other resources that we could use from time to time to help us teach missions to our congregation? Although not an abundant assortment, the materials that we have found are excellent in content and can be used to good advantage. Listed here are some recommended resources. Under each type of setting you will find suggested uses of the material. Books Missions: Home and Abroad by Delmer Guynes - GPH Develop a passion for missions. Examine the Great Commission, biblical role models, people and church patterns, intercessory prayer, the Holy Spirit, and the will of God. 13 studies. Missions: Home and Abroad Student Guide Item #02TW0126 Price: $2.50 Missions: Home and Abroad Leader Guide Item #02TW0226 Price: $9.95 Into All the World by Joyce Wells Booze – AGWM A history of Assemblies of God World Missions from its inception until the decade of the 80’s. (74 pages) Price: $2.50 Building Missions Leadership in the Local Church by Paul Brannan – AGWM - A five page digest of the above history is included in this manual under the title A History of Assemblies of God World Missions by Joyce Wells Booze Price: $4.50 Mission Statement – AGWM A five page booklet that gives an explanation of reaching, planting, training and touching – the Assemblies of God missions statement. Price: 15¢ each Audio-Visual Video – The Pillars of Our Mission – AGWM Explores the Lord’s command to make disciples of all nations, and the key pillars of our mission: reaching, planting, training and touching. What distinguishes our 53 mission is not merely our obedience to each of the four mandates, but how all four work together. Running time 5:50 Price: $10 Video – Newsbreak Don’t forget Newsbreak, sent monthly by subscription for just $48 annually. These 2- to -3 minute DVD presentations present the work of Assemblies of God missionaries and the overseas fellowship. A Spanish clip is included each month. CD – Missions Faith Promise PowerPoint Presents the implementation and follow-through of the Faith Promise plan. It is accompanied with a shorter and a longer narration. Price: $10 World Focus CD – AGWM This CD has summaries of each country where the Assemblies of God is involved with missions work. Price: $3 An Elective in Sunday School or Small Study Group Since Missions: Home and Abroad is written with 13 lessons, it is ideal for use as a quarterly for an elective in either a Sunday school class or a small group study. Into all the World could be used by the leader as a resource to give information concerning the formation and growth within our own movement, or the five page history digest, History of Assemblies of God World Missions, could be reproduced and distributed to each student. It would be great to flavor this series with an occasional Newsbreak video, giving current information about what is happening now on the field. Including the six minute video The Pillars of Our Mission in one of the classes would help the participants understand, not only our methods, but our biblical mandate for being involved in missions. Handing out the Missions Statement during this class would give them something tangible, containing the same information, which they can study more carefully at home. New Convert’s Class The new convert’s class is another matter, since it is usually limited to, at most, two or three hours. Even if the time devoted to training new converts is of longer duration, there are many subjects that must be taught during that period to help establish the new believer in the faith. Although time will be limited, we must include missions in the lesson plan. If not, the new believer has no way of knowing that we believe that missions is a priority! We can at least communicate two points: (1) Why we get involved in missions, and (2) How we get involved personally in missions. To answer why we get involved, we can use the six minute video, The Pillars of Our Mission. This will help them understand the biblical reasons why. To answer how we can get involved, we need to keep it simple at this point. A brief explanation of our annual missions convention, the faith promise plan and monthly missions Sunday should help them understand the participation of the individual believer. 54 Membership Class The membership class usually offers the same challenge as the new convert’s class in terms of time limitations. It is absolutely essential that we share with the potential members their responsibilities in the area of missions. Simply stated, Jesus commanded the Church to evangelize the world. In becoming members of this body of believers, they are accepting their responsibility to join with the body in praying and giving in order to fulfill the mandate of Christ! That issue should not be debatable! We need to answer the same two issues that were mentioned when discussing the new convert’s class: why and how. The why could be handled exactly the same as suggested in the new convert’s class above. This gives a solid biblical basis and also shows the methods used to follow those mandates. That will answer the “why”. We must be more specific in presenting how the new members will become involved. There should not be any ambiguity. Everyone needs to understand from the beginning what is expected from them in terms of missions commitment. Here is where we explain about Faith Promises. The Missions Faith Promise PowerPoint CD can be adapted to the time available to explain how millions of believers are fulfilling the Great Commission every month with their faithful giving. We must help them realize that it is not about money, it is about commitment! It is not about the amount, it is about obedience! 55 PART 10 DON’T OVERLOOK THE CHILDREN While speaking to children’s pastors and leaders, most have referred to BGMC as a critical component of their teaching, promotion and the raising of funds for missions. This comes as no surprise. Thank God for all the committed workers at each level of BGMC. There are other ideas as well. Some are general in nature. Some were mentioned repeatedly and others were so obvious that they were not mentioned at all. Let’s take a look first at some of the more obvious ideas and then you will find listed in some detail a few excellent ideas with the name of the church and the person who submitted the information in case you wish to inquire further. Ideas, Ideas and More Ideas • Show the go 360 video every month on Missions Sunday • Use Buddy Barrel and promotional materials from BGMC (See variation of this theme in the notes from James River about the M and M mini tube). • Sing missions songs and choruses • Have missionaries speak to the children and give altar calls, or • Have the missionary’s spouse or older child speak in children’s church while the missionary is speaking in the sanctuary. • Teach about and receive Faith Promises from the children during the missions convention and then present the total to be tallied with the sanctuary total at the end of their service. • Make a monthly commitment from the children to support a missionary. • Adopt a missionary family or the children of that family. Call AGWM for information. • Use Reach Around the World, 52 Global Awareness Activities for Children and Youth (Bob and Sandy Friesen – GPH - # 02TW0464 - $12.99) ______ Randy Jumper 1st Assembly North Little Rock, Arkansas • Last year for Family week (our VBS) we challenged kids to help start churches in the Congo. In one week the kids gave money to start a church in 2 places in the Eastern Democratic Republic of Congo with Todd Churchill. • Dozens of kids have raised money through lemonade stands, garage sales, giving to plant churches. One 5 year old gave up Christmas/Birthday for 2 years to plant a church in Tanzania with Scott Hanson. Another group of kids planted one in Rwanda with Billy Wilson. ______ 56 Jeff Mead, Children's Pastor, Broken Arrow, Oklahoma • Ketchup Sunday – Something that you can do if your BGMC giving is not where you think it should be. You promote “Ketchup Sunday” where children, as well as the adults can participate. You can do it after either a Sunday morning or Sunday evening service. The children’s pastor as well as any other brave children’s workers who are willing will stand in a child’s wading pool (no water) in the parking lot. Ketchup is sold: a small ketchup packet, for a quarter or 50 cents, a bottle for $3 to $ 5 dollars, and a gallon can for around $10. They get to pour the ketchup on the children’s pastor. • Teach at least once a month on missions, with not too much emphasis on raising the money yet. I believe children need to understand the what, and why of missions. During a service place a certain number of children around the room and have them separated from the rest. Then serve clear kool-aid to the rest of the kids. Make it a point to show that the kids that were separated can’t come, and we need to think of a way for them to get their drink. Teach them the only way the other kids will get it, is by having someone take it to them. This is a great way of teaching about missions. The world has a lot people who can’t come to our church to hear about the saving grace of Christ, and that we need people to go to them. • Have a missons convention – Decorate rooms to look like different countries and have the people in each room dress for the country. Decorate the children’s church as an airport where they get passports and board a plane. • Decorate a ship and loading Fire Bibles. • Pick a project such as water wells in Africa, where they say the nearest well is about 50 miles away. We found out how much it cost to dig a well and made that the BGMC project for the kids to raise the funds. I keep them updated on how the project is going. • Anytime you do a project, give kids a package where they can look for donations. Looking outside the church is better, since everyone in the church is doing fund raisers. A bowl a thon, bike a thon, putt-putt golf tournament, go cart racing (having local celebrities race against the pastors is also a good idea). The kids are able to go to the neighbors and show them in writing why you’re trying to raise money. Whoever raises the most gets a great prize. • All the kids that meet a certain goal win a free trip to an amusement park. ______Jessica Wimmel, Asst. Elementary Director, James River Assembly, Ozark, Missouri At James River our goal is to share the love of Jesus with every child and empower the emerging generation to impact the world with the Gospel! One of the ways we do that is by helping children develop a missions-minded perspective. BGMC is the primary mode of missions giving that we utilize at JamesRiverKids. Throughout the year children are encouraged to save their coins for regular BGMC offerings and special projects so that other kids around the world can have the opportunity to hear about Jesus. 57 There are two times during the year that we have designated for doing a special missions emphasis in the elementary ministry, February & December. • Every year during the month of February, James River Assembly devotes a week for a Missions Convention. Several missionary speakers from various types of ministries are invited to speak & set up booths. There is a flag parade in the main sanctuary, as well as other special events throughout that week. The Elementary program participates in this event during the children’s services. Last year, we decorated the children’s auditorium with flags & banners depicting various nations & people groups, we devoted all offerings specifically to BGMC and interviewed a former Missionary’s Kid on stage about missions work, it’s importance, what it looked like for his specific family, etc. We set aside time at the end of the service for the kids to ask the MK various questions about his life. They really enjoyed the interaction as well as the perspective from another kid (even though he was a teen by then). We also showed the kids a portion of a video clip for that year’s missions project. That year James River raised money for World Serve to purchase drilling rigs for clean water wells in Africa. We specifically talked to the kids about the need to provide for people’s basic needs as a way to demonstrate God’s love and to open doors for pastors/missionaries to further the gospel (in this case, the drilling was in predominantly Muslim villages). • In December the elementary ministry has used the month to talk about the birth and life of Christ leading up to the Christmas holiday. Specifically emphasizing that Jesus is God’s gift to us because of his sacrifice on the Cross, we can give a gift back to God when we give money to missionaries, because they tell other boys & girls around the world about Jesus. • During the Katrina relief efforts James River adopted a church that had lost everything, to help get them back on their feet so they could serve their community. The kids were challenged to bring in offerings to purchase new children’s curriculum for this church as well as bring in bandages to send them (the church was helping with local first aid efforts). Some of the things we do on a regular basis to talk about missions with the kids: • On a weekly basis we talk about giving in general during offering time in the kid’s chapel services. We select a verse to highlight each month that specifically addresses giving; its importance, why we tithe & give offerings to missions, some of the ways God uses our giving to bless others as well as bless us and so on. • We have recently setup an M&M mini’s container program with the kids as a way to get them excited about giving to BGMC. We give each child an M&M Mini’s candy tube (available at most grocery stores or price clubs). The kids are challenged to take the candy home so they can eat it and then fill the container with coins & dollar bills (silver coins only, no pennies). When a child brings back a “full” tube (at least ¾ full) they receive another candy filled one to take home & continue the process. It has been a great way to get them excited 58 about missions; they get an immediate incentive and it mixes up the routine of using their buddy barrels for a little while. • We have also done contests between the boys & girls for a specified period of time to see who can bring in the most BGMC offerings. Not too long ago we did a contest, where the winning group would determine the “craziness” of a new haircut for the children’s pastor. The boys won the contest and his hair was shaved into a Mohawk on stage and was then died half blue and half green. The kids absolutely loved it! It also brought the kid’s giving to the attention of the whole staff & church body because it was hard to not notice the dramatic hairstyle change and prompted questions on why he did it. • When it comes to home missions, as an “in-house” ministry we try to continually teach the kids that they can be a part of sharing god’s love in their own families, neighborhoods and schools; giving them specific scenarios and examples. And that there are even kids who visit KidzBlast (elementary) that may not know Jesus so they can participate in leading them to Jesus by welcoming them, being their friend and by not distracting them from hearing the day’s lesson. ______ Jan Crowley, Administrative Assistant - Christian Ed, Missions, Children's Ministries at First Assembly of God Cedar Rapids, Iowa Children’s Ministries at First Assembly of God provides financial support for BGMC through a number of ways that expose the children to Missions Giving and Service. • Each month the first Sunday of the month is called “BGMC” Sunday. The kids (preschool through grade 6) are sent a postcard (pre-printed with a reminder note from Pastor Jan with the bulk mailing indicia) reminding them to bring their Buddy Barrels next Sunday. On BGMC Sunday Pastor Jan shows a video and/or speaks about Missions during Children’s Chapel for grade school children. When they take the offering the children empty their buddy barrels into a four foot tall lighted “Stoplight” Bank. There is one for the girls & one for boys. They compete for which group brings the most BGMC offering, the winning gender receiving 5 quints each. Our Children’s Church is called “Construction Zone” – hence the use of the “Stoplight” Bank. • Quints are our form of reward – see the following page explaining the earning/use/redemption of quints. • The Corner Store (in a converted classroom) offers a variety of merchandise for sale – cash or quints are accepted. All profits are given to BGMC. There is an adult supervisor in the store, with many older children/youth helpers. The store is open one half hour prior to Wednesday evening activities as well as between services & after second service on Sundays. The helpers are a part of the MTA program (Ministry Team Assistants). Each year children ages 10 – 18 go through an application and interview process in order to be chosen to be a part of the Construction Zone Leadership Team and receive the title of MTA. 59 These students are responsible for a variety of different “Helps” ministries like Game Captains, Greeters Ushers, Technical team and Corner Store workers. They may also be involved with the Drama, Puppet, or Worship teams. As an integral part of the “team and in addition to their “job” each week, they are responsible for consistent attendance, maintaining a daily walk with God and exhibiting godly character in and outside of the church. MTA’s are rewarded & blessed for their faithfulness throughout the year with special activities and parties. • Currently our youth do not have a “scheduled” program during second service which frees them for service to various ministries in the church – like Children’s Ministry. • Annually we also hold a “BGMC” Bike-a-thon. Children Bikers obtain pledges for the number of laps they will ride on a Saturday morning around our parking lot. Prizes are awarded by age group/pledge amounts with proceeds benefiting BGMC. Quints ??? What are they Children’s ??? How do my kids get them Ministry One Quint and ??? What can they do with them Quints are a form of reward & “currency” for Children’s Ministry Quints are earned by children for: Learning memory verses Doing activity sheets when available Bringing their Bible Bringing a friend Bringing their Buddy Barrel on BGMC* Sunday Answering questions when called on in Children’s Church or Wednesday evenings Participating in Children’s church games & activities Children receive a quint when leaving Children’s Church if they turn in their nametag. Quints have an approximate value of 20 cents and can be used to: Play games before Children’s Church Buy Drinks in Higher Grounds Coffee Shop (no change given for Quints) Purchase items from the Corner Store (cash may also be used alone or combined with Quints) Many children choose to save up their quints to make a large purchase in the Corner Store. After saving 100 quints they may be exchanged for a certificate worth 110 Quints. *BGMC – Boys & Girls Missionary Crusade is the Assemblies of God Missions organization for children. Cash proceeds from the Corner Store and contributions on BGMC Sunday (first Sunday of the month) go toward BGMC. 60 ______Dennis Daywitt, Children’s Pastor, Oak Creek Assembly of God, Oak Creek, Wisconsin • The kids support two children at Mission of Mercy in Calcutta, India at $60 monthly. They correspond with them, sending drawings, pictures and letters. • Locally they fill stockings at Christmastime for needy children in Milwaukee. • During the adult missions convention each Fall they celebrate their own week of “Kidvention”, even with their own “banquet” – hotdogs, pizza, etc. • Trade-up Week – Pastor Dennis gives each a penny. The children go to friends and ask to trade for a larger denomination. They keep trading up until the end of the week when the money is collected for BGMC. Note: Leave Mom, Dad and Grandparents until last! • Talents Week – Remember the parable of 1, 5, and 10 talents? Pastor Dennis gives each child a one dollar bill and asks them to multiply the investment in the project of their choice (run errands, lemonade stand, etc.). Once again they bring their original dollar along with the profit on that investment and give it for missions. D. Wendel Cover, Pastor, Word of Life Assembly of God, Springfield, Virginia There are numerous things that we do to keep missions alive for our children and youth. • We show missions videos provided by AGWM. • We promote missions projects such as Speed the Light and BGMC. • We sponsor missions trips for our youth to other countries through AIM. • We are currently building a new children’s center with a new children’s missions room. - This will be decorated with a motif of children from different countries. - Computers to interact with missions children and keep them up to date on our missions projects and happenings around the world. • Missionary songs are sung and opportunities are given to respond to altar calls. • We have many, many missionary speakers who visit our children and youth. • The first and third Sundays are Missions Sundays. - First Sunday is for the support of our career missionaries - Third Sunday is for projects • Having people in our church from over 100 countries makes us all missions minded. When there are disaster situations in other countries, it affects families of our church and gives us another reason to do missions. It’s Not Just About Money Although many of the ideas listed in Part 10 focus on fund raising, that is not the primary purpose of the leaders’ efforts. Their desires are to build the Kingdom. Thank God these leaders and many others who know how to use the tools at hand to teach the children about missions. Let’s not mistake the motive behind their suggestions. They are focused on teaching young minds. 61 If our focus is just on receiving offerings, raising money from others and running contests, we have missed the most important point: teaching the children two important reasons why we do it. 1. To evangelize the world, 2. Because Jesus told each one of us to become personally involved. 1. To evangelize the world – Simply stated, although we use many motivators, we must be able to communicate successfully that the reason we do these things is not just to win a contest, but to help a child who has never heard of Jesus! 2. Because Jesus told each one of us to become personally involved – Jesus gave the Great Commission to the Church. We are the Church, so we are responsible as individuals. Oswald J. Smith, the great missions pastor for so many years at the People’s Church in Toronto, Canada built missions in that church on the principle that every person from the elder, deacon, choir member, right on down to the child had to become involved, personally. In fact, every child from 7 years and up was taught to give to missions, regularly and consistently. He said that the parents do not give for the children. They are taught to give their own money! That is stewardship at its highest level! 62 PART 11 KEEP THE YOUTH FOCUSED ON MISSIONS Speed the Light is the primary focus of most youth groups that have a missions involvement. For that reason, much of the activity of our youth groups across America is focused on providing transportation and audio-visual equipment for our missionaries. That’s why you will see STL appear frequently in the submissions listed below. Ideas In Brief • Use WorldBeat youth video each month in service before receiving missions offering • Sponsor a missionary family with a monthly commitment. • Sponsor a well for a village in Africa or Latin America • Go on an AIM trip in the U.S. or overseas. • Raise extra funds for Speed the Light by parking cars at the fair or selling fireworks at the 4th of July. • Do Saturday visitation or clean-up and repair work for a home missions church. • Invite a missionary (or missionary kid – MK ) to speak each quarter. • Prepare skits and mime to promote missions in the sanctuary services. • Use Reach Around the World, 52 Global Awareness Activities for Children and Youth (Bob and Sandy Friesen – GPH - # 02TW0464 - $12.99) ______Liz Goggin, Administrative Assistant from Rockford, Illinois • 10% of weekly offering is sent to Speed the Light. • Each week, a portion of offering that is brought in that is above and beyond our budgeted income is given towards Speed the Light. • Annual Family night where parents and family members are invited & asked to bring a special missions offering to go towards Speed the Light. • Annual Sunday morning Coin Drive: Students stand outside the church w/ buckets by the exits to receive change from cars lined up to leave. • 1 month series (4 weeks) each year on the topic of missions. ______Randy jumper, First Assembly North Little Rock, Arkansas • Last year we had a missionary (Steve Lilly) come and talk to our students and they raised the money for a year to buy his STL vehicle. • Every class (2007,2008, 2009, etc) planted a church last year with a missionary through weekly giving. • The students also volunteer at the mission and work at our inner city church plant. 63 ______ Chris May, Student Pastor, Eastside Assembly of God, Tucson, Arizona • Example - We are a missions-minded church. Giving to missionaries is exemplified through our adults. We do not ask the students to do anything that we are not willing to do. • Prayer - We bathe everything in prayer. We seek direction from the Lord as to what our goals should be and also for direction in reaching those goals. • Teaching – We don’t just ask the students to give money. We provide Biblical teachings on the principals of sacrificial giving. • Special STL Services – We normally dedicate one Wednesday night youth service to Speed the Light each quarter. • This year, the Lord laid on my heart to have 30 people from the youth group raise $30,000. Each of these students would raise $500 and then an adult from the church would match dollar for dollar up to the $500. In the natural, this seemed almost impossible for that many students and leaders to reach such a high goal. However, we got over 25 participants the first Wednesday Night that I shared this. We encourage the students to give on a weekly basis, and provide many different avenues for fundraising and ideas for meeting their goals. We send out quarterly statements to the students to let them know where they are at in their giving. ______ Lasse Lund, Assistant to the Youth Pastor, Evergreen Christian Community, Olympia, Washington FOS Youth Ministries is aware of our Biblical need to reach out to others around us. Matthew 28:19 clearly states that part of a Christian’s mission here on earth is to share the Gospel with everyone, everywhere, and in every way possible. While our main focus is encouraging students to share their faith with those who are in their immediate vicinity, we also emphasize Global Missions as an important part of their walk with God. Although not every student is called to be a full-time missionary in another country, we teach our students that supporting those missionaries is an important discipline to practice. Practically, we take a Speed-the-Light missions offering each and every Wednesday night during our Service. We give to the National office out of the funds collected there. We have also begun forming a Missions Committee as a part of our Adult Staff, with a former full-time missionary leading the charge. We see many short-term missions trips for student being spearheaded by that very team. We also plan on having STL emphasis nights periodically during our Wednesday services. In those, we will highlight Missionaries who are on the field, and the work that they are doing. That way, we connect students to those that they are supporting, and encourage them to support them even more. ______ 64 Chris Lindberg, Youth Pastor at Sachse Assembly of God in Sachse, Texas has embarked on a high energy plan for raising funds for Speed the Light. Chris writes, “Club365 is the same thing as Speed the Light. But for us we don’t really promote (the name) STL, we promote Club365 since it really flows well with our name. The concept is simple if you give a dollar a day it will accumulate to $365 in a year. For those that rise to this challenge we provide an awesome incentive. Our STL giving recently has been terrible, Already this year we are on target to reach $40,000 to $50,000 so fundamentally Club365 is our renewed effort to be advancing in the area of Missions.” GO AHEAD AND BREAK THE LAW The law that says it's impossible (for you to excel or succeed). Listen, the greats of the past didn't accept the impossible, neither do great people today. They see the impossible as a dare, not a declaration, because they believe in actions, not words. At Live365 it is our passionate belief that Impossible is Nothing. With that belief strongly in our hearts, we are determined to raise $50,000 for Speed the Light Missions. Sure, there are those that will say that's impossible, you're too young. To us though, impossible is just a big word thrown around by small men who find it easier to live in the world they've been given, than to explore the power they have to change it. Impossible is not a fact. It's an opinion. Impossible is not a declaration. It's a dare. Impossible is potential. Impossible is nothing. • YOUR REWARDS FOR BREAKING THE LAW. 1. For Those Who Give $52: Every student who gives $52 to Club365 this next year will receive an authentic Speedo-the Light T-Shirt. That’s only a buck a week. 2. For Those Who Give $365 Or More: Every student who gives $365 or more to Club365 this next year will receive the following and be eligible for the bonus gifts: That's only $7 a week. ÷ An Authentic Speedo-The-Light T-Shirt. ÷ The Ultimate Ticket To Ride: We want to give you the gift of adrenaline. So we've already reserved the entire Speed Zone Park for January 2008. That's 4 non-stop hours of heart racing action. Get behind the wheel on one of 3 Racing Tracks. Including Real Dragsters that take you from 0 to 70 in 3.5 seconds while pulling 2.5 G-forces as you race against 12 of your friends. Race into action against 15 friends on the Slick Track, and don't forget the Turbo Track where you can race. • CLUB365 BONUS'S FOR BREAKING THE LAW. 1. CHAUFFEURED LIMO RIDE: The top 10 student givers will ride in style to and from Speed Zone, while all their friends ride the buses. (minimum of $365 to be eligible to ride) 2. WIN $$$ CASH: The top 3 student givers will not only win a ride in the limo, but win the following amazing gifts: ÷ 1st PLACE GIVER: $500 gift certificate to Firewheel Mall. 65 ÷ 2nd PLACE GIVER: $250 gift certificate to Firewheel Mall. ÷ 3rd PLACE GIVER: $100 gift certificate to Firewheel Mall. ATTENTION: USE GIVING ENVELOPES (VERY IMPORTANT): In order to accurately track your giving progress, ONLY money placed in properly filled out giving envelopes will be credited to your total 2007 giving amount. So, stick the money in the envelope or it doesn't count. ______Joseph Kellogg, Student Pastor, First Assembly of God, Broken Arrow, Oklahoma “I’m personally stoked about what God is going to do through our students this year. Last year we had 80 students and leaders go on three different missions trips from the Republic of Ireland to an Indian Reservation in Arizona. This year we are going on four missions trips to reach as many as possible. I really feel strong about discipleship that takes place every Thursday at WM (World Mpact). And I’m ready to GO be the Good News to the world this Summer. Whatever it takes!” World Mpact meets every Thursday beginning the last Thursday in May from 8am to 5pm. The daily schedule includes prayer time, discipleship lessons, team building, ministry preparation, and servanthood activities. Attendance to the Thursday meetings is required for all who wish to participate in the Summer ministry trips, but that’s not all. Read the list of expectations below. • Faithful attendance to WM meetings and activities • Mandatory attendance to all church services • Keep sermon notes of Sunday and Wednesday mpact services • Must sit in the first four rows of every service • Be faithful to tithing, offerings, and STL giving to mpact • Choose and accountability partner and be accountable to group • Pray and read your Bible at least 30 minutes daily • Fast at least one meal weekly • Live a pure and holy life – one pleasing to God - Use wisdom in choosing TV shows and movies (no rated “R”) - No secular music - Use wisdom in choosing things you do, where you go, and what you say - Don’t date anyone who is a non-Christian - No dating during the Thursday WM and the missions trip • Keep confidential any personal matters shared by others in the group • Complete World Mpact discipleship • Be on time and ready to participate • Attend missions trip ______ 66 Is It Just Another Project Or Are They Being Established In The Faith? To paraphrase the words of Jesus, “What shall it profit a congregation, if it raise a million dollars for missions but lose its own young people?” Someone may say, “Paul, what in the world are you talking about? Have you lost your mind?” And my answer is, “No, but we are losing our sons and daughters!” It is altogether possible for us to involve them in the externals of good works while the internal need of transformation never takes place. The busyness of these activities binds the group together and that glue holds until they graduate from high school. The group dynamic is broken and there is little that they feel in common with the rest of the congregation if they have never been born again. Unfortunately, that is not an isolated case. A study by George Barna, released in 2006, shows that despite strong levels of spiritual activity during the teen years, most twentysomethings disengage from active participation in the Christian faith during their young adult years – and often beyond that. In total, six out of ten (61%) twentysomethings were involved in a church during their teen years, but have failed to translate that into active spirituality during their early adulthood. Gratefully, the statistics seem not to be quite so extreme within our own fellowship. Although no controlled study has been done in recent years, Jay Mooney, the National Youth Director for the Assemblies of God Youth Ministries, after a careful evaluation of the data from the Annual Church and Minister’s Reports and other information, estimates the loss rate to be well below 45%. Should we, as the Publican, thank God that we are not as others who are losing so many more young people? Or, should we bow our heads and our hearts in sorrow as we ask God to forgive us for allowing the cares of this life to distract us from one of our major responsibilities – caring for our own and assuring their salvation. So what is my primary concern? It is the spiritual welfare of these young people. Their souls are a number one priority! I am encouraged, however, as I read some of the responses of these Spirit-led youth pastors, but we need more – many more! Not only do I think about the value of those twentysomething drop-outs, but I think of what they might have become. That young lady who might have become a missionary. That young man who might have become a strong missions pastor. Now, that young lady is just a statistic. And sadly, the young man is another. And both are lost! Lord, help us reach our Jerusalem, even as we carry the gospel to the uttermost parts of the earth! 67 PART 12 PASTOR, YOU ARE THE KEY TO SUCCESS! The path you choose will determine where your congregation goes. Whether they become Great Commission Christians depends on the decisions that you make. You, as pastor, are the spiritual leader of your congregation. You have the opportunity to lead those under your care into obedience to the Great Commission. If you don’t do it, no one else will. They will either walk in obedience to the command of Christ to carry this gospel to the whole world, or they will ignore that command and live in disobedience. It’s not your place to drive them, and not everyone will follow you, but you must give them a choice. I’ve noticed that when the pastor gets excited about reaching the world, most of the congregation will, too. Let’s talk about a few things that will help you help them. Plan Sufficient Time in the Missions Sunday Schedule There is no doubt about it. Once the missions convention is over and the Faith Promises have been raised, the monthly Missions Sunday becomes the most important activity during the year! We must keep interest and enthusiasm high if we hope to maintain missions giving at a high level throughout the year. That can only happen with a well-planned monthly Missions Sunday. This doesn’t mean that the whole service on Missions Sunday has to be dedicated to missions, but it does require more than just an announcement that it time for your missionary offering. A well-planned and very effective missions presentation could last from eight to fifteen minutes and then the missions offering could be received. The Sunday morning schedule is always full. Could there be some things that could be shortened on Missions Sunday or shifted to other Sundays? After all, this is Missions Sunday. Is it asking too much that missions hold a place of priority for fifteen minutes each month on Missions Sunday? Participate in the Monthly Missions Team Meetings Every pastor has a personal preference concerning committee meetings and whether he/she will attend. This is different. First, this is not a common committee. This is a missions team. The first priority of the church is to reach the world! Some pastors chair their missions team, while other never attend a team meeting, claiming a lack of time. It may not be possible to attend all of the team meetings, but since the first priority of the church is to reach the world with the gospel, doesn’t it make since that the pastor would make it a priority to attend when possible? 68 On the other extreme is the pastor who has not yet learned that the team is a resource, not just a rubber stamp. Give the team members opportunity to carry part of the load, dream dreams and see great visions of what we might yet accomplish before Christ comes again. Schedule a Missionary Speaker, at Least Quarterly Of all the things we can do to influence our congregation for missions, this is by far the quickest and simplest. It only takes a phone call or two, a note on the calendar and a reservation at a motel, all of which can be done in 30 minutes or less. But it is also one of those things that isn’t raising a red flag and waving it in our faces, so we forget. We intended to, but…. There is no way that we can teach our people the importance of obedience to the Great Commission unless we show them, and we can’t make any impression of the real importance of missions if we have fewer than four missionary speakers each year – That’s just one each quarter. If we can’t work that into our schedule our priorities are wrong! In addition to having at least four missionaries each year for a full service you should also consider inviting some missionaries to stop by for a ten or fifteen minute window. This simply means that you give them a few minutes to present their ministry, receive an offering for them, and then continue with your service. Preach Missions, Soul-winning, and Evangelism The congregation must know that you, personally, love missions. They won’t know that if you never preach about missions. Take a trip overseas. See the need first-hand. Get your spirit stirred. Than come back and stir their spirits. Preach on soul-winning. The people of your congregation must realize the value of a soul – every soul. Many Christians are not stirred for their own unsaved family members, much less, the lost and dying of the world. We must change that. Preach on their personal responsibility to witness to and win those around them and to make possible a witness to those they can’t reach through their prayers and their faithful giving. Set the Example in Prayer, Giving and Caring for the Lost Some excellent sermonizers are failures as pastors because they fail to walk the walk. Other pastors are very poor pulpiteers, but their lives proclaim ever so clearly the gospel of Christ Jesus. Whatever we want our people to become, let us develop those traits and values within our own lives first. Then, and only then, will we begin to see the transformation take place within the lives of those who surround us. In the last church that we pastored, several of us had the custom of gathering early on Sunday morning in the sanctuary to intercede for the days services and for lost souls. It was many years later that a very dear and faithful saint told me 69 that she learned to intercede for the lost while listening to me pray. I was humbled by the thought. It is not enough that we receive the missionary offering. They will want to know if we made a Faith Promise and if it was generous. They will observe how we give in other appeals as well. Our actions do speak louder than our words and our best sermons are not preached in the pulpit! 70 PART 13 PUT MISSIONS ON THE PLATFORM, NOT IN THE BUDGET! I know. You looked at that twice, didn’t you? Missions is too important to be limited to the budget. I mean budgeted items are usually forgotten by the congregation. That reminds me of an experience I had when I accepted the pastorate of a church which hadn’t had a missions convention for 19 years. I promptly began to make plans for a convention and announced it with enthusiasm. One of the board members came to me and said, “Pastor, I hope you won’t be too disappointed with the results of the Faith Promises. You see, there are several of us who feel that once we pay our tithe, we shouldn’t be bothered with any further appeals.” He wanted missions kept in the budget. I wanted it on the platform. The board had been very generous in their budgeted giving to missions, but it was all out of the general fund. The congregation had no personal participation and consequently, no obedience to the Great Commission. Fortunately, the majority of the congregation was ready to respond to the voice of the Holy Spirit when missions was no longer hidden in the budget, but brought to the platform. We doubled our missions giving after that first convention. Three years later our church was in first place in missions giving in the district. In the last year of our pastorate there we averaged $458 per capita in giving to AGWM. Now do you understand? Missions is not an entry on a spreadsheet. Missions is heart and soul. Missions is flesh and blood of martyrs. Missions is the sacrifice of those who have gone before. Missions is the cry of the lost. Missions is the obedience of those who are proclaiming the Word right now. Missions is Jesus saying, Go. Missions is Jesus saying, Send. Missions is me saying, “Here I am, send me.” That’s missions, and it doesn’t belong in a budget! It belongs on the platform, and it belongs in the hearts and lives of our people! And that depends on you! 71 Building Missions Effectiveness Through Intercessory Prayer E. Building Missions Partnership Through the Missionary Visit F. THE BLUEPRINT SERIES Volume 5 Building … Through the Missionary Visit Photo illustration: Jim Whitmer Photography Written by Paul Brannan 1445 North Boonville Avenue • Springfield, MO 65802-1894 www.worldmissions.ag.org CONTENTS INTRODUCTION……….………………………….…………….... 3 SECTION 1 - The Importance of the Missionary Visit………..………… 5 SECTION 2 - Missions and the Guest Speaker……………………...... 10 Part 1: How Often Should a Church Have a Missionary Speaker?...... 11 Part 2: Selecting Missionary Speakers……………………………...... 11 Part 3: What About Speakers From Other Countries?...... 12 SECTION 3 - How to Maximize a Missionary’s Ministry to Your Congregation……………………………………………….…...... 15 Part 1: Sunday Morning Options………………………………….……... 16 Part 2: Other Options……………………………………………….…….. 17 SECTION 4 - How to Make the Missionary Visit More Effective…...... 19 Part 1: Scheduling Missionary Services………...…….………….……. 20 Part 2: Pre-service Planning……………………………...……….……. 20 Part 3: Missionary Offerings………………………………………….…. 22 Part 4: Accommodations……………………………………...... 24 Part 5: After-Service Fellowship….…………………………………….. 26 Part 6: A Monthly Commitment…….…………………………………… 26 SECTION 5 - How Are Assemblies of God Missionaries Supported?.… 28 Part 1: What System Do We Use?...... 29 Part 2: Why Do We Use the Itineration System?...... 29 Part 3: Missionary Itineration………………………..…………………... 30 Part 4: Why Do Missionaries Itinerate?...... 31 SECTION 6 – What Missionaries Wish Pastors Knew……………..…. 32 About Budgets………………………………………………………….…. 33 About Communication and Cultural Differences…………………...... 34 About Itineration and Expectations ……………………...... 35 About the Family, Fellowship and Additional Ministry………………... 36 About Housing/Food Arrangements and Offerings…………………… 37 About Partnership, Phone Calls and Monthly Commitments……...... 38 About Presentations and Scheduling ………………………………….. 39 About Cancellations………………………………………………………. 40 Views from a Missions Secretary……………………………..………… 40 2 INTRODUCTION Just before He went away, Jesus told His followers: “Go into all the world and preach the Good News to everyone” (Mark 16:15, NLT). Some might ask, “What does that have to do with me?” His command has everything to do with you—for several reasons. First, Jesus said it! Second, this directive was among the last words He spoke, and last words are usually very important. Third, it was more than a request; it was a command! Jesus knew that we couldn’t get the job done by ourselves, so He introduced the idea of partnership. Most importantly, it would be necessary to depend on the Holy Spirit as our senior partner. Jesus said in Acts 1:8: “But you will receive power when the Holy Spirit comes upon you. And you will be my witnesses, telling people about me everywhere—in Jerusalem, throughout Judea, in Samaria, and to the ends of the earth" (NLT). The power for witnessing comes through the anointing of the Holy Spirit. Jesus underscored the fact that we won’t be properly equipped to fulfill His command until we are filled with the Holy Spirit. Jesus added another dimension to partnership when He said, “Anyone who receives a prophet because he is a prophet will receive a prophet's reward, and anyone who receives a righteous man because he is a righteous man will receive a righteous man's reward” (Matthew 10:41, NIV). We do the Scriptures no injustice when we replace the word prophet with the word missionary. A partnership is formed between those who go and those who send. If senders are as committed in sending as missionaries are in going, then the senders will receive the same reward as the missionaries. What a privilege! Paul added another dimension to partnership when he wrote, “Everyone who calls on the name of the Lord will be saved" (Romans 10:13, NLT). He was thrilled with this revelation, but then he began to explore what this meant to a lost world. The next two verses reveal four questions that haunted him. “But how can they call on him to save them unless they believe in him? And how can they believe in him if they have never heard about him? And how can they hear about him unless someone tells them? And how will anyone go and tell them without being sent?” (Romans 10:14-15, NLT). The answer to all four questions is the same: They cannot! A partnership must exist between God who provides salvation, the goer who preaches salvation, and the sender who provides for the goer. The apostle John tied it all together when he wrote: “Dear friend, you are doing a good work for God in taking care of the traveling teachers and missionaries who are passing through. They have told the church here of your friendship and your loving deeds. I am glad when you send them on their way with a generous gift. For they 3 are traveling for the Lord, and take neither food, clothing, shelter, nor money from those who are not Christians, even though they have preached to them. So we ourselves should take care of them in order that we may become partners with them in the Lord's work” (3 John 5-8, TLB). There it is! John identified those who remain at home in the local church as partners with missionaries who go to the ends of the earth to proclaim the good news. Frequent visits between missionaries and a local congregation are critical if they are to partner together in missions. This manual has been prepared to help build the partnership between missionaries and the local congregation and to move every believer into obedience to Christ’s command! 4 Section 1 In Jerusalem the believers were glad to see us. The next day Paul went with us to visit James, and all the elders were there. Paul greeted them and told them everything God had done among the other nations through him. When they heard this, they praised God. (Acts 21:17-20, NCV) 5 SECTION 1 THE IMPORTANCE OF THE MISSIONARY VISIT Giving to missionaries is not charity! We give, not because we feel sorry for them, but because we want to become partners with them in reaching the lost world for Christ. Missionary itineration becomes the key to partnership. While detractors may point out that missionary itineration is expensive, time- consuming and tiring, we have only to examine its success within our missions outreach to know that it produces results that are unparalleled by other methods. At least seven obvious benefits are realized when missionaries visit our churches and share their burden for the lost in faraway places. 1. The individual church member is blessed. Jesus commanded every believer to go into all the world and preach the gospel. This seems impractical, if not impossible, for most people in our churches. When missionaries visit a local church, they share opportunities for reaching the lost in distant lands. By communicating their vision, they afford believers the opportunity for partnership by participating in the work God has given them. In this way, we are enabled to fulfill the Great Commission. We become partners in soul winning around the world – without ever leaving home. The better we know missionaries personally, the more effective our partnership becomes. Contact with missionaries builds friendships that last a lifetime. An occasional letter, card or small gift for Christmas and birthdays—sent by a church or individual—is the added touch that is so needed and appreciated by a missionary far from home. 2. The local congregation is blessed. A recent review of data from the annual Church and Ministers’ Report revealed a startling discovery. During a recent 12-month period, churches that had missionary participation in an annual missions convention reported 67 percent more converts than churches that had no conventions with missionary speakers. This should come as no surprise. When we are burdened for the lost who live halfway around the world, we also are more aware of our lost neighbors, friends and colleagues. A missionary visit keeps the reality fresh before us that without Christ, all men are eternally lost! 3. The lost of the world have a greater opportunity to hear the liberating gospel of Christ. A survey of missionaries revealed that these two factors had an almost equal share in their missions call: a daily prayer time and the ministry of visiting missionaries. Assemblies of God World Missions does not actively recruit missionaries, trusting instead that the Lord of the harvest will call those whom He chooses. Over the years He has provided a growing resource of 6 candidates. Add to this number those who respond through Ambassadors in Mission (AIM) and Missions Abroad Placement Service (MAPS), and you will see that a great army of volunteers is tearing down Satan’s strongholds. Would these laborers be on the front line today if they had not heard a missionary message? Not likely. For those desiring to go into full-time missionary service, Assemblies of God World Missions offers a variety of opportunities for credentialed ministers as well as committed laypeople. In addition, those desiring to spend a year or two working alongside missionaries will find ample opportunities as missionary associates (MAs). For more information about this program, call (417) 862-2781, extension 2088, e-mail [email protected], or visit www.worldmissions.ag.org. Youth will also find opportunities to serve overseas during one- to two- week trips as part of an Ambassadors in Mission team. These teams are often sponsored by the youth department in your district. For more detailed information, contact Ambassadors in Mission (AIM) at (417) 862- 2781, extension 4084, or e-mail [email protected]. 4. Ministries are strengthened as a result of the intercessory prayer of believers. Missionaries share prayer needs for ministries and projects on the field. These can include Bible schools, church planting, Good News Crusades and a number of international ministries. Thousands of believers become silent partners with the visiting missionary. Their faithfulness in prayer makes the difference. Many missionary victories can be traced to this faithful intercession. A personal experience will illustrate this. In a visit to a supporting church, I shared several prayer requests concerning needs in Argentina where my wife, Betty, and I were ministering at the time. I included the names of several national workers. Five years later I returned to that church. The pastor’s wife showed me a Bible belonging to her daughter who was about 7 years old when I had visited previously. Written on the flyleaf in a childish scrawl were the requests I had shared with the congregation. The mother told me that her daughter had prayed faithfully each night for those needs. That young woman is now the wife of a district superintendent and still prays for our missionary family! Intercessory prayer is absolutely essential for the missionary’s success and well-being. Missionaries find immeasurable strength in knowing others are supporting them in prayer as they face challenges on the field. Prayer becomes truly effective when we are guided by the Holy Spirit in intercession for specific needs. Here is a partial list of missionary needs for which you can intercede as guided by the Spirit: Special anointing and wisdom. 7 Favor with the people among whom they are ministering. Health and well-being. Protection from danger and difficulties. Their children’s well-being, both physical and emotional. Help in learning a new language and adapting to a new culture. Provision to meet financial needs. Response to the gospel message as people accept Christ and are discipled More workers to be called and sent into the harvest. 5. Candidate missionaries are developed spiritually through itineration. Raising a missionary budget is a spiritual exercise that allows new missionaries to experience God’s divine provision—a lesson they will need to remember daily as they go into the enemy’s territory. Without God’s supernatural empowerment, the missionary will soon fail. The months of sharing during itineration gives new missionaries the opportunity to clarify their call. As they verbalize their vision to congregations across America, their resolve is strengthened and their understanding of God’s will for their lives becomes more focused. If new missionaries were sent to the field without itineration, many would likely fail during their first term of service. Itineration prepares them for the next challenge. 6. Veteran missionaries find fulfillment in itineration. A veteran missionary visit could be called a “stockholders meeting.” These missionaries return to report the accomplishments that have resulted from their spiritual partners’ investments during their previous term of service. Personally, I found that itineration represented the completion of a cycle. I had challenged churches, and they had responded. For four years my wife and I had labored on the field. This could not have happened without believers who faithfully prayed and gave. Itineration was my time to return to them and share what had been accomplished as a result of their sacrifice. In many ways, a missionary’s identity is somehow tied to these visits with his or her supporting churches. 7. Itineration provides more adequate financing for the missionary. Only after examining six other benefits of itineration does money come into the picture. Ample evidence exists to provide a comparison between missionary-sending organizations with centralized budgets and others, such as the Assemblies of God, that raise funding through missionary itineration. Those with itinerating missionaries win hands down. Better information, more layperson involvement and higher motivation are just a few advantages of the itineration approach. Everyone benefits from the missionary visit to the local church. 8 Of course, there is room for improvement. Announcing missionary services with excitement, fewer preliminaries, singing songs with a missionary theme to create atmosphere, and giving people the opportunity to respond financially after the missionary has shared are just a few ways to make missionary services even more effective. One part of our system, however, is backward. In Acts, Luke wrote that the Antioch church, under the direction of the Holy Spirit, sought out Barnabas and Paul and sent them forth as missionaries. Currently, missionaries must seek churches that are willing to support them. What would happen if our churches began to seek out missionaries to send as their representatives to the four corners of the earth? That would be true partnership. THANK GOD FOR THE MISSIONARIES! We have all been commanded by Christ to “go into all the world and preach the Good News to everyone.” In order for us to fulfill the Great Commission, we would have to sell everything we own, tell family and friends goodbye, go to a foreign country, and learn a new culture and language! But all of us can’t go physically, because God has called certain people to go. Our responsibility in fulfilling Christ’s command is to send them. In missions, there are three types of Christians: those who go, those who send, and the disobedient! So the next time a missionary visits your church, don’t complain or criticize. Instead, thank God that you can be obedient to Christ by sending the missionary and helping to obey the Great Commission. The missionary visit is never an interruption; it’s an opportunity! 9 Section 2 Dear friend, you are doing a good work for God in taking care of the traveling teachers and missionaries who are passing through. They have told the church here of your friendship and your loving deeds. I am glad when you send them on their way with a generous gift. For they are traveling for the Lord, and take neither food, clothing, shelter, nor money from those who are not Christians, even though they have preached to them. So we ourselves should take care of them in order that we may become partners with them in the Lord's work. (3 John 5-8, TLB) 10 SECTION 2 MISSIONS AND THE GUEST SPEAKER The success of a church’s missions outreach will depend largely upon the time spent planning missions activities and securing the best possible missionary speakers for each occasion to assist in inspiring, informing and motivating the congregation. Adequate planning is also needed for the provision and comfort of those who come to assist in building missions vision. Part 1 HOW OFTEN SHOULD A CHURCH HAVE A MISSIONARY SPEAKER? Every church is different and, consequently, has different needs. But great churches are missionary churches, and a church cannot be truly missions-minded without scheduling frequent missionary speakers to come and inspire the people. Fewer than one missionary service each quarter is insufficient to create and maintain vision for a lost world. Planning for a missionary speaker, when possible, at least every other month is far more effective. Many churches have at least one missionary speaker each month. A problem can arise if missionary traffic is so heavy that the pastor does not have time to minister to his own congregation. However, giving every guest missionary a full service is not always necessary. If the pastor feels the need to minister to the congregation, most missionaries would be happy for a 10-minute window followed by a generous offering. Having these “missionary windows” makes it possible to include more missionary speakers throughout the year. Once the pastor has determined, in consultation with the missions team, how frequently and on what dates to have missionary speakers, a foundation is in place to proceed with future plans. Flexibility is the key. Sometimes a missionary might not be available on the specific date you planned, but flexibility will allow for shifting one date to another, depending on the activities on the church calendar. Part 2 SELECTING MISSIONARY SPEAKERS Normally, a missionary service brings to mind veteran missionaries who recently returned from the field. For the next several months they will travel and share their successes in ministry with their supporting churches and seek renewed and increased monthly support for their next term. A second group of missionaries—new missionaries—are also available for services. For the most part, these new missionaries have limited or no missionary 11 experience. Their purpose in traveling among churches is to share their burden and vision so that churches will join them as partners through prayer and monthly support. In addition to these approved missionaries from Assemblies of God World Missions are a growing group of approved missionaries from U.S. Missions. Some districts of the United States have a number of U.S. missionaries living and ministering in them. Other districts rarely have contact with U.S. missionaries unless they are itinerating to raise additional support. While veteran and new missionaries are important in sparking enthusiasm for missions in a congregation, leaders of U.S. and World Missions also provide a wealth of experience that can be drawn upon for a missions service. Most members of the World Missions Executive Committee have served as missionaries for many years. Because of their frequent travel to the countries within their regions, they can share the latest information on what God is doing and can bring updates on urgent needs and victorious revivals. Other possible speakers for missionary activities include district personnel. District superintendents and district missions directors often have served as missionaries. They have a burden for missions, both at home and abroad, and should not be overlooked in an annual schedule of missionary speakers. Some districts lack an abundance of missionary speakers in close proximity. If this is true in your area, please don’t despair. Call Frank Vice, itineration manager for AGWM, at (417) 862-2781, extension 2057, or your district missions secretary for assistance in finding available missionaries within your district or in neighboring districts. Part 3 WHAT ABOUT SPEAKERS FROM OTHER COUNTRIES? People from other countries are visiting the United States more than ever before. This is due to greater availability of transportation and the upward economic mobility in many areas of the world. Whether to schedule a national speaker for a missions service requires considerable thought and care. Often a pastor will schedule one or more national speakers, only to learn that they were not who they said they were and did not represent what they said they did. Sometimes these speakers are received and assisted by U.S. churches, yet they have actually created problems for the Assemblies of God within their own country. Of course, no pastor wants to be in a position of contributing to someone who is, at best, nonproductive and, at worst, counterproductive within his own nation and fellowship. So, how can a pastor or missions committee know what to do? The answer is not to refuse all nationals who come to the United States for ministry. On the contrary, an 12 experienced and proven national church leader can add a new dimension to your missions activities and increase a church’s understanding of how national believers feel about missions and missionaries. To prevent a lot of heartache and misunderstanding, take care to learn more about potential guests and whether they are trustworthy. When approached about scheduling a service, consider contacting David Lee, AGWM director for U.S. Relations at (417) 862-2781, extension 2075, for an endorsement. One of his responsibilities is to monitor national church leaders who are in the United States for ministry. He will verify their good standing within their national fellowship and whether they represent approved projects. Another nuance to consider is about funds given directly to an international guest. Offerings given to a national who is not approved by AGWM must be reported to the Internal Revenue Service. According to the law, 30 percent of the offering must be retained for income tax and verified with a form 1099. AGWM will not issue a receipt or give missions credit. On the other hand, offerings given to national church leaders who have official AGWM approval are designated and accountable. These offerings are receipted by AGWM and donor churches receive missions credit for their giving. Personally, I have several concerns about our responsibility toward those who come from other countries for ministry. Having lived on the mission field for many years, I have seen several problems arise from a lack of understanding on the part of some pastors within our Fellowship. Many nationals who come to the United States find it very difficult to settle into a productive ministry after they return home. They have found that life in the United States is much more comfortable and that one offering from a church can be as much as two or three months’ income at home. The temptation is strong for a national guest to return to the United States repeatedly to pick up additional income. This pattern produces several problems. First, if nationals return to the United States frequently, they lose productivity in their own country where they can be the most effective. Second, once they start receiving help directly from churches – and this is quite common – they maintain a higher standard of living than their peers. Consequently, they are resented by other nationals with whom they work. Third, every offering given to a national increases the risk of competition between him or her and the growing number of missionaries who are raising their support. I have known of national believers who came to the United States every year or so and stayed for several weeks or months. The funds they received from offerings were used for personal expenses. Others came on three-month visas and were still making a preaching circuit two years later. Going from place to place, they continued this extended stay because churches, with all sincerity, responded to their appeals 13 without inquiring as to their legitimacy. This, of course, is not the best use of the missions dollars given sacrificially by our congregations. In the final analysis, we should not close our doors to all national speakers, but we should become well-informed about those who work among us. Many godly and trustworthy men and women come to the United States to represent approved projects. They can be a great blessing to a congregation, and believers can help meet legitimate needs in other countries. We, as good stewards, are responsible to ascertain that the funds we give are invested as they were designated. 14 Section 3 I planned to stop and see you on my way to Macedonia, as well as afterwards when I returned, so that I could be a double blessing to you and so that you could send me on my way to Judea. (2 Corinthians 1:16, TLB) 15 SECTION 3 HOW TO MAXIMIZE A MISSIONARY’S MINISTRY TO YOUR CONGREGATION In times past, a missionary could schedule a service for just about every night of the week. Today this is no longer possible in most districts. Finding time for a missionary speaker has become a challenge for many churches. Wednesday evenings are departmentalized, which limits the missionary’s contact to a small group of adults in the sanctuary. Scheduling on Sunday evenings is becoming more difficult as the number of churches dismissing services or moving to a cell group format increases. More than 30 percent of our churches no longer have regular Sunday evening services. On Sunday mornings many pastors feel they need to minister to their congregations. So what is the best approach? Should churches decrease the number of missionary visits because scheduling has become more problematic? A lost world still remains in darkness and deserves to hear the liberating message of the gospel. The Great Commission is still in effect for every believer, and spiritual leaders still have the responsibility of giving every member of their congregation the opportunity to obey through giving, praying and going. Missions must be a priority in our churches. We must find ways to teach congregations regarding not only their responsibilities, but also the opportunities to participate. Finding time for missionary speakers on the church calendar will not be difficult if we believe that reaching the world is a priority! Scheduling a missionary for Sunday morning is always the ideal, because this service usually has the largest attendance. Since this option is not always possible, consider these alternatives that will still build missions vision within your congregation: Part 1 SUNDAY MORNING OPTIONS Morning Worship Service Sunday morning is still the ideal time for scheduling a missionary service, since it reaches the largest number possible with the challenge of missions. Giving a missionary 25 to 30 minutes to minister is the best arrangement for most missionaries. Window on the World When it is not possible to give the missionary the entire service, a 10-minute Window on the World should always be a possibility. Many missionaries are quite comfortable with this arrangement. Discuss this option at the time the visit is scheduled so that the missionary will know what is expected of him or her. 16 Sunday School Classes If a missionary is participating in a Sunday morning service, consider scheduling him or her for ministry during the Sunday School hour as well. By going from class to class, a missionary can briefly share a missions challenge in each setting. Another option is to let the missionary focus on one class for the entire hour. The purpose is not to teach the current lesson but to share missions and get acquainted with the people. If the missionary is traveling with his or her family, the spouse and older children could be assigned to different classes to share about their experiences in another country. This will give your church members a fresh look into missionary life and ministry. Part 2 OTHER OPTIONS Sunday Evening The Sunday evening service, though usually fewer in attendance, is a great setting for a missionary service. It is often more casual and allows for spending more time at the altar. Without the time pressures of the morning service, the missionary has an opportunity to become better acquainted with the people. Many churches have substituted a traditional service with cell group ministry on Sunday evenings. Cell groups give missionaries an important opportunity to build relationships with the attendees, as well as share the challenge of missions in a more personal setting. If the church has neither a Sunday evening service nor cell group ministry, a small gathering with coffee and cake can be held in the fellowship hall. Both churches and missionaries have found these to be very enjoyable and spiritually rewarding. Saturday Activities If scheduled for Sunday morning, most guest speakers will arrive on Saturday afternoon. With a little forethought, the missionary’s contact with the congregation can be increased substantially. If the Women’s Ministries group is planning a Saturday meeting, invite the missionary to participate. In many churches the Men’s Fellowship meets monthly for a Saturday breakfast. Why not include the missionary in the program and fellowship? Many churches have youth activities on Saturday afternoon or evening. Why not include the missionary? Hearing from the missionary will make clear the demands of Jesus Christ on young people’s lives, both present and future. The missionary can also encourage the youth in their Speed the Light project. 17 Wednesday Evening The Wednesday evening service is often very similar to Sunday School, since activities are departmentalized. In most churches, specific age groups meet together. If a missionary speaker is scheduled to minister to the adults, plan a time for him or her to spend a few minutes with the youth group during the sanctuary preliminaries. Off-night Activities Although scheduling a missionary for a service on off nights might not be feasible, it is often possible to schedule a fellowship time with a smaller group. Desserts could be served at a “Get Acquainted With the Missionary Night.” Many churches have held these events with great success. The attendance is fewer but the motivation is high, and those who attend are inspired and encouraged after spending quality time with “their missionaries.” Missions Team Meeting Regardless of when the missionary is scheduled for a service, setting aside time for the missions team to meet with him or her is always beneficial. The team will be better informed about missions in general and about the missionary’s ministry in particular. They will be better prepared to make decisions concerning the missionary’s financial needs and better informed and more effective in their prayers for missions. Breakfast or Lunch Meetings If no other alternative is available on the church calendar, invite the missionary to meet with the pastor for breakfast or lunch. This does not give the missionary an opportunity to meet the congregation, but it does communicate that the pastor is committed to missions and will do everything possible to get to know and assist every missionary. During the visit, the pastor becomes more knowledgeable concerning the missionary’s ministry. Afterward, the pastor may decide that this is a ministry the church should support on a monthly basis or at least with a one-time offering. Missions Conventions As scheduling missionaries for regular services becomes more problematic, the missions convention takes on greater importance. The most important part about a missions convention is not the number of missionaries invited to participate, but rather the faith promises raised for missionaries, including those who have not yet ministered to the congregation. If a church will effectively plan and conduct annual missions conventions that include a successful faith promise service, its missions income will grow and the congregation will touch the world with their giving. The church will never reach its potential in missions without an annual missions convention! 18 Section 4 Do everything you can to help Zenas the lawyer and Apollos on their way and see that they have everything they need. Our people must learn to devote themselves to doing what is good, in order to provide for urgent needs and not live unproductive lives. (Titus 3:13-14, TNIV) 19 SECTION 4 HOW TO MAKE THE MISSIONARY VISIT MORE EFFECTIVE An old adage says that planning is everything. This is certainly true when it comes to missionary visits to the local church. Considering how little time the missionary will have with a congregation, it is essential that pastors do everything possible to maximize the effectiveness of this special time of ministry. Part 1 SCHEDULING MISSIONARY SERVICES Frequency and timing of missionary speakers are critical to the overall success of a missions outreach. Frequent missionary speakers, as often as one each month, is far more effective in building missions vision than having an occasional missionary visit. Pastors should become proactive and seek out missionary speakers rather than passively wait for missionaries to contact them for services. This gives intentionality to the overall plan to create a passion for missions in the hearts of believers. In districts that lack a lot of missionary traffic, it will be necessary to contact missionaries from neighboring districts to maintain a healthy schedule of mission’s speakers. The district missions director can provide helpful guidance on available missionaries. For additional information, contact Frank Vice’s office at (417) 862-2781, extension 2057. Many churches schedule all of their missionary speakers for the same time and day of the week, such as the Sunday evening service. This plan has two major problems. First, at least half of the congregation is missing in the evening service. If missionaries always come during one particular time slot, much of the congregation will never hear a missionary challenge. Second, many people who attend church during this time are working elsewhere in ministry. They too will miss hearing the missionary’s message. By rotating the days and times of your missions services, everyone should hear a missions message at least three or four times each year. Part 2 PRE-SERVICE PLANNING For years I worked with missionaries, both new and veteran, concerning itineration and ministry in local churches. I repeatedly stressed the importance of scheduling time with the pastor prior to the service so that clearly defined plans could be established and mutually understood. 20 Personal experience has shown that meeting with the pastor prior to the service is often difficult. With the responsibilities involved in preparing for a service, pastors often have little quality time to devote to their guest speakers. Some pastors find it easier to meet with the missionary at an earlier hour when there is less pressure. While no set rules exist for what time or place is more effective for meeting, the key is to find what works and develop a clear vision for the upcoming service. Before the pastor can fully understand the burden of the missionary, he or she must know something of that missionary’s ministry, responsibilities and financial need. A preservice meeting brings all of this into focus. After this has been done, make sure the missionary understands any specific time constraints. Please be generous with the missionary on the time allotted. Sometimes a church invites a missionary to minister on a Sunday morning and pays all of his or her airfare and other expenses. However, the missionary is not given the opportunity to speak at the service until 11:45 a.m.—and is expected to dismiss at noon! In these cases, the missionary’s frustration is not a matter of ego, but rather a missed opportunity to share his knowledge and expertise. Please make every effort to give the missionary ample time. He or she will probably not be back with you for at least five years! Because of time pressures, not every missionary can be given a full service. It may come as a surprise to know that not all missionaries want a full service. Many are quite comfortable with a 10- or 15-minute window. Pastors must determine which missionaries should be allowed to minister the Word and which will be given a window. Pastors must clearly share what is expected of missionaries when they visit. Should they preach, share about their call and ministry on the field, or both? Most missionaries need certain equipment for their presentation. Will they need a table for a display in the lobby? Will they be using video or PowerPoint while they speak? Will they use the church’s equipment or do they want to set up their own? During preservice planning, decide whether the missionary’s presentation will be a complete package or if a break in the middle of the presentation is the best time to receive the offering. Some missionaries prefer to give a full presentation and receive the missionary offering at the end. Others prefer to give a brief overview of their ministry and financial needs and then turn the service back to the pastor to receive the offering. The missionary then returns to the pulpit to minister, leaving the end of the service for a challenge and time at the altar. To achieve the most effective results, plan the whole service around the theme of missions rather than making the missionary speaker a postscript or afterthought. Plan to incorporate choruses, hymns and special music that focus on missions. Everything that is done in the service should point toward reaching a lost world with the gospel of Jesus Christ. 21 Make every missionary service a success by helping the missionary plan the service. Give the missionary your church’s full cooperation. In return, they will give you their very best in ministry. Part 3 MISSIONARY OFFERINGS As mentioned earlier, preplanning is essential to establish when the offering will be received. Equally important is a clear understanding of who will receive it and for what purpose. It should be underscored that the missionary offering should never be received before the missionary has the opportunity to share the financial need. Most congregations are quite generous when fully informed and challenged. Unfortunately, many churches do not receive an offering for missionary speakers, choosing instead to give them an honorarium at the close of the service. Honorariums are given to speakers for services rendered, and missionaries should never be paid for services rendered. Instead, they should be given a generous offering according to the needs of a dying world and the challenges of their ministry. Give the missionary opportunity to share his or her burden. Then, as the people are challenged, see what God will do toward meeting the need through their enthusiastic response. The person receiving the offering, usually the pastor, should clearly state the purpose of the offering and set the example by his or her own giving. It should never be referred to as “a little offering” or “a little something to help the missionaries buy a pizza before they get home.” The people are investing in soul- winning and should be encouraged in their giving, knowing that their offering will reap eternal benefits. Consider setting a minimum offering for missionary speakers, but never set a maximum amount. Whether the weather is bad, attendance is low or a number of other reasons, remember that missionaries are giving their best and deserve our best. When faith promises are received during a missions convention, part of the income from those promises can be designated for missionary speakers. That way, if the offering for a missionary does not meet the established minimum, the balance can be taken from the missions fund. Using this method, you will never have to apologize for the size of the offering. You have done your best, and that is what God requires. Always plan on giving the missionary a check that covers the offering received. If the church treasurer or missions treasurer is present, plan ahead and prepare a signed check so the amount can be inserted after the service. A missionary should never be told, “We will have to send your check.” Many times a missionary will need funds in order to travel to his or her next destination. 22 I remember a time when I was scheduled to speak in a certain church. I was traveling with my wife and three children. No hotel or motel was provided, which meant we would need to drive some distance after the service before arriving home. The main problem was that our car’s gas tank was as empty as my wallet. The pastor told me that they would send a check for the missionary offering later. I asked the pastor if I could cash a check for a small amount. He said that I should speak to the church treasurer. The treasurer was in a side room counting the offering. When I asked if he would cash a check for me, he refused, saying, “No, we don’t do business on the Lord’s Day.” I left there wondering how we would get home when we ran out of gas. As we were leaving town, I remembered that someone had handed me a bill after the morning service in another church. I had slipped it in my side pocket and forgotten about it until that moment. What a delight when I pulled it out of my pocket and discovered that it was a $10 bill! The Lord knew that others might fail us, but He is always faithful! Another kind of offerings is special offerings. These are given to missionaries for personal use rather than for specific ministry needs. Sometimes churches and individuals choose to give missionaries something extra for their personal use. This is not discouraged, because many times God uses this means to supply urgent needs that missionaries have. This doesn’t mean that missionaries do not receive an adequate monthly allowance, but as with every family, financial challenges occur. Churches are also encouraged to remember missionaries on their birthdays and at Christmastime. These kinds of special offerings are greatly appreciated—especially by missionary kids (MKs). Special offerings are receipted in the same manner as ministry offerings, and churches receive missions credit for this giving as well. The World Missions Executive Committee has established an annual maximum that missionaries can receive in personal offerings, and any special offerings beyond that amount are placed in the missionary’s work account. On numerous occasions my wife and I have placed personal offerings in our work account, because that represented the most urgent need for us at that particular moment. Sometimes a pastor will hand a missionary a check and say, “Now, this is just for you. We don’t want a receipt or missions credit. Don’t report this to AGWM. This is yours to spend as you please.” This places the missionary in a dilemma. On one hand, he wants to honor your wishes. On the other hand, he knows he needs to be accountable and receipt the offering, although he is free to keep it for his own use up to the yearly maximum. Be generous with missionaries, but please don’t ask them not to report an offering. Each missionary must maintain financial integrity and comply with missionary policy. 23 Part 4 ACCOMODATIONS When we invite someone into our home as a guest, we want them to feel welcome and at ease. This is equally true when inviting someone as a guest to speak at your church. Although this should go without saying, the experiences of many missionaries indicate otherwise. When a church invites a missionary—or any guest speaker—for a service, accommodations should be provided prior to or following the service, depending on whether the speaker is scheduled for a morning or evening service. If the missionary stays for both Sunday morning and evening, accommodations should be provided for Saturday and Sunday nights. The only exception is when the speaker prefers to make other arrangements. Contact the missionary by e-mail several days prior to the date, listing details concerning lodging and reservations. Be sure to include directions on how to arrive at the hotel, as well as directions from the hotel to the church. Be sure to include a telephone number other than the church office for any emergency that might arise. Inform the missionary of when they need to arrive at the church to prepare for the service. When making the reservation, keep in mind that location and comfort are important. Be sure that the hotel is located in a relatively secure part of the city. Especially in the case of single women, make a reservation in a hotel that has inside hallways rather than rooms with doors leading directly to the outside. This provides a much greater degree of security. Don’t assume that the room is comfortable and attractive. See for yourself or send another responsible individual. Does the room have a good bed? Does it provide a restful and appealing atmosphere? Does the hotel serve a complimentary breakfast? If not, arrangements must be made to cover the cost of breakfast at the hotel or elsewhere. Would you be happy to stay there? If not, please don’t expect guests to stay there. Reservations should be made in the name of the visiting missionary, not in the name of the church, pastor or church secretary. Make certain that hotel personnel understand that the church will be responsible for the cost of the room. This will avoid awkward misunderstandings later. If no adequate hotel facility is available in your community or nearby, it may be necessary to host the missionary in a private home. Remember that, although the missionary’s visit may be a one- or two-night experience for the host, many times it represents daily life for the missionary. After 12 to 15 months of itineration, the process can become exhausting as the missionary adapts to different families, schedules and routines several times each week. 24 If your church is small and cannot afford a hotel, or if nothing adequate is available in your community, please do not let this hinder you from inviting missionary speakers. Remember that most missionaries are quite flexible and have spent some delightful times of fellowship in the homes of both pastors and laypeople. A word of caution is advisable when thinking of placing a missionary in a home other than the pastor’s. I have stayed in the homes of church members on many occasions, and we have enjoyed delightful times of fellowship. But the awkwardness presents itself on Monday morning when the man of the house goes to work, the children go to school and the missionary is left alone with the hostess. Such a situation can be quite uncomfortable for everyone involved. More than likely, the missionary will probably make a point to leave the home as quickly as possible in order to prevent any appearance of impropriety, even when he has nowhere else to go. Another point to consider is the missionary’s lack of knowledge of the area. If he or she is to be housed in a private home, the pastor or a staff member should accompany the missionary and make personal introductions to the hosts, rather than giving the missionary an address and expecting him or her to take care of locating and approaching the hosts alone. When housing the missionary in a home, ask the following questions: Is the room clean and does it have a good bed? Does the room offer some privacy? Will the temperature be adequate? Is a writing table or desk available? Make sure there are plenty of fresh towels. Remember that the missionary may need to do laundry or take clothes to the cleaners. If the wife is along, she might appreciate a trip to a hair salon. Could that be your small token of appreciation to her? If missionaries are traveling with small children, will the children’s needs be met? Remember that families with small children may need a baby bed, potty chair, bottle warming facilities, etc. Let the missionaries know the host’s schedule and whether they are expected to be a part of these activities. The hostess might say, “I will be in the kitchen if you need me,” or “We will be in the backyard, but we understand if you need time to rest or pray or study. On a few occasions I have not received enough to eat while hosted in a private home, but the opposite is usually the problem. Hosts normally want to prepare a large meal for their guests. This means that many missionaries fight the “battle of the bulge.” Large meals should not be served immediately before service time. Keep desserts light and don’t insist that the missionary take a second helping. Remember to ask the missionary if he or she has any dietary restrictions and what meal schedule they prefer. Even when the missionary is staying with a family other than the pastor, remember that the purpose of the visit is ministry. Ample time should be set 25 aside for the missionary and pastor to spend together, both before and after the service. Part 5 AFTER-SERVICE FELLOWSHIP If a missionary is invited to speak on a Sunday morning, it is assumed that lunch will be provided afterward. Following an evening service, most missionaries are not interested in eating a full meal, but they generally eat something light before going to bed. Why not take this opportunity to invite the missionary for a snack or dessert and enjoy a choice time of fellowship? It will give you an opportunity to learn more about the missionary and his or her ministry. Itinerating missionaries look forward to a time of fellowship with the pastor’s family. Friendships are cultivated that will last a lifetime. The bond that is formed makes us family, not just business associates. This time of sharing can benefit both pastors and missionaries. Many times a pastor is going through a difficult moment. He or she does not feel comfortable talking with a neighboring pastor and may not wish to confide in district leaders at the moment. The missionary represents a nonthreatening listener with wisdom and experience. This combination can be a unique blessing to the host pastor. Speaking from personal experience, I remember many occasions when I have sat with a struggling pastor until well after midnight, listening to and praying with him about a burden heavy on his heart. Those occasions are rarely planned, but when they occur, hearts are melded together as one. You can’t buy that kind of kinship! Part 6 A MONTHLY COMMITMENT Missionaries itinerate within our churches for three important reasons: To challenge every believer to pray and give so that others can go. It should come as no surprise that finances become a major issue in itineration. Since missionaries seek financial support, the subject cannot and should not be ignored when they visit. An expression from another era says, “Every tub must sit on its own bottom.” This certainly applies to missionaries in the Assemblies of God who must raise every dollar of their budget, both for personal support and ministry expenses. Missionaries are seeking partners for the “end-time harvest,” and they are hoping that pastors will lead their congregations to join them as financial partners. 26 When possible, present the missionary with a signed monthly commitment form before he or she leaves following a service. It is a great encouragement to the missionary and it hastens their departure for the field. If the church board or missions team must be consulted before making a commitment, tell the missionary when a decision will be made. Ask the missionary to give you a call at a set time, and be prepared to give a response. If your church is not in a position to join the missionary with monthly support, please don’t tell the missionary “maybe.” As painful as it may be for both you and the missionary, it is better to simply tell the missionary that the church cannot make a monthly commitment. This will give the missionary time to seek support elsewhere. Sometimes churches opt to wait until the missionary is ready to leave for the field before making a monthly commitment. However, if every church did this, the missionary would never leave! These monthly commitments by churches and individuals provide missionaries with personal support and/or accumulate toward their cash budget while they itinerate. Many churches only respond to emergencies. This is commendable, but it would be much more helpful if we all responded before emergencies happen. Prompt response with a monthly commitment can prevent many crises from occurring in the first place. A missionary’s dream is to receive a signed monthly commitment form from a congregation before he or she leaves a church. Why not make this your goal as well? LITTLE THINGS THAT MEAN A LOT Through the years Betty and I have enjoyed many acts of kindness. These deeds have shown how much the congregation and pastor appreciated what we were doing and how happy they were to have us as their guests. Here are a few examples to file away for use in the future: When my children were young, I always appreciated it when pastors took an interest in them—even when they weren’t with me. On occasion, the church gave me a small cash gift for them. Some also made it a point to give me a gift to take to Betty. Sometimes when I check into a hotel room that the church reserved for me, I find a basket of fruit and other goodies placed there by the missions team. This is not only extremely thoughtful, but also practical. Many times a missionary might like a snack, but he or she doesn’t want to take the time or expense to go to a restaurant. I always get a warm feeling inside when I arrive at an airport and the pastor is there to meet me personally, take me to a hotel and accompany me to dinner. The kindness of these gracious hosts is certainly not wasted. Missionary are sure to give you their best when you treat them with courtesy and kindness. 27 Section 5 I have received my full pay, and even more than that. I have everything I need. That’s because Epaphroditus brought me the gifts you sent. They are a sweet-smelling offering. They are a gift that God accepts. He is pleased with it. (Philippians 4:18, NIrV) 28 SECTION 5 HOW ARE ASSEMBLIES OF GOD MISSIONARIES SUPPORTED? Part 1 WHAT SYSTEM DO WE USE? “It seems such a shame for missionaries to spend four years overseas and then be forced, upon their return to the United States, to spend a full year visiting scores of churches to raise support for their next term. There must be a better way.” This objection is voiced frequently by pastors and laity alike. As a reasonable observation, it deserves a reasonable answer. Three methods are commonly employed to raise missionary support. First, the independent faith system assumes every missionary will raise what he or she can with no guarantees. Donors send their support directly to the missionary. It leaves the missionary with no assurance of a stable income. The second is the budgeted system in which churches send undesignated offerings to their denomination’s national office. These funds are then divided among missionaries and projects according to the budget established by the missions organization. This system is impersonal and relieves the average church member from any sense of individual responsibility. The third method of raising missionary support is the itineration system. A combination of faith and budget, it is used by Assemblies of God World Missions. Under this system, missionaries travel among U.S. Assemblies of God churches to raise their financial and prayer support. Monthly offerings are designated by the donor for the missionaries and their projects and then sent to the national office for disbursal and record keeping. Assemblies of God World Missions requires that all its missionaries raise their own support. No one is supported through subsidies, since such funds are nonexistent. Part 2 WHY DO WE USE THE ITINERATION SYSTEM? Over the years, some missions-sending organizations changed from the faith system to the budgeted system. Without exception, they saw erosion in missions giving, while giving for Assemblies of God World Missions increased. As a result, they have encouraged AGWM not to make the same mistake. As the old adage states: “If it ain’t broke, don’t fix it.” 29 Itineration has biblical precedents. In 1 Corinthians 16:6 Paul wrote this to the church in Macedonia: “Perhaps I will stay with you awhile, or even spend the winter, so that you can help me on my journey (propempo*) wherever I go” (NIV). Paul intended to return to Corinth and receive help from them in order to return to Judea (2 Corinthians 1:15-16). Paul also wrote to Titus, instructing him to do everything he could “to help Zenas the lawyer and Apollos on their way (propempo*) and see that they have everything they need” (Titus 3:13). (NOTE: “Propempo” is a Greek word that often implies providing a traveler with material provision for a journey.) Part 3 MISSIONARY ITINERATION Effective missionaries do not work independently. Rather, they are sent by churches that share in the burden, the work and the rewards. The sent and the senders must answer to the call of the same Master, even though their direction of ministry may be different. Itinerating missionaries travel from church to church on a regular schedule to promote missions and to raise their prayer and financial support. Itineration is vital for a successful four-year term of world missionary service. It requires about one out of every five years of a missionary's ministry. All Assemblies of God world missionaries and their ministries are financially dependent on monthly commitments from churches and individual donors. Each itinerating missionary is given a supply of monthly commitment forms by the U.S. Relations Department. Each donor or church is asked to complete a form and send it to Assemblies of God World Missions. Each missionary is given a budget determined largely by the cost of living in his or her assigned country. This budget is divided into two categories: a personal budget for support and a work budget to cover the expenses of ministry overseas. In addition to raising monthly support for each category, the missionary is required to raise a cash budget for initial expenses of fare, freight, duty, equipment and language study if applicable. A project budget may also be included. The cash budget is raised by missions offerings from churches, contributions from individual donors, and accumulated support from incoming monthly commitments made during itineration. Missionaries are not cleared to leave for the field until they have raised their required budget. When missionaries leave without raising their full amount their budget is not underwritten. This means that if money does not come in to meet their monthly allowance, they will suffer a shortfall. 30 World evangelization requires teamwork between sending churches, Assemblies of God World Missions and missionaries. We must make certain that missionaries are not limited in their ministry because of insufficient prayer and financial support at home. Part 4 WHY DO MISSIONARIES ITINERATE? Itineration is about much more than raising money. It is a spiritual exercise for both the missionary and the congregation. The missionary ministers the Word as directed by the Holy Spirit, adding a spiritual dimension that many congregations would miss without such ministry. Missionary itineration is informational. People respond to the needs of a lost world when they are informed. Missionary itineration is motivational. It challenges people to pray, give and even go as missionaries themselves. The missionary’s ministry will bless the missions-minded congregation. Studies have shown that a church that becomes missions-minded will win more people to the Lord in its own city. Oftentimes it also experiences an increase of up to 15 percent in its general fund revenue. Itineration ministry blesses the pastor. Many times a missionary has the unique opportunity to encourage the pastor during his or her visit. Missionary itineration gives a congregation a clearer vision of man’s lostness and the value of a soul. 31 Section 6 Would you do me a favor, friends, and give special recognition to the family of Stephanas? You know, they were among the first converts in Greece, and they've put themselves out, serving Christians ever since then. I want you to honor and look up to people like that: companions and workers who show us how to do it, giving us something to aspire to. 1 Corinthians 16:15-16 (The Message) 32 SECTION 6 WHAT MISSIONARIES WISH PASTORS KNEW … Some have said that it is impossible to understand another man until you have walked in his shoes. In an effort to help missionaries and pastors understand the challenges that each face in their ministry, Frank Vice, itineration specialist for Assemblies of God World Missions, conducted a survey among the two groups. The missionaries were given one question: What do you wish pastors knew about missionaries? Pastors were then asked the question: What do you wish missionaries knew about pastors? Following both questions were several categories for specific responses. The surveys were collected from each group and the responses edited to express the most salient concerns. The completed project filled 58 pages. The results given by pastors were then communicated to missionaries to help them better understand pastors’ challenges relating to missions. The results from missionaries were communicated to hundreds of pastors to help them understand issues from the missionaries’ point of view. A sampling of some of the missionaries’ responses is included here. These comments are not intended as criticism, but rather as an attempt to help pastors understand several challenges that our missionaries face. All Assemblies of God missionaries and missions personnel are deeply grateful for the loyalty and faithfulness of the thousands of pastors who support and maintain a missionary vision. Perhaps after reading these concerns they will be able to assist missionaries even more effectively in some areas. At least they will be able to pray more knowledgably for missionaries as they face the inevitable challenges that come because of their ministry and calling. ABOUT BUDGETS Budgets are not set by the individual missionary, but rather according to guidelines established by Assemblies of God World Missions. Budgets are not “personal funds.” They are comparable to a “church budget”—not the pastor’s personal income. Except for the missionary’s personal salary, funds given by churches are controlled by AGWM in accordance with budget, policy and need. A missionary has to raise his or her work support in addition to personal support. We often hear pastors say, “What? You mean Springfield (or World Missions) doesn’t pay for that?” 33 Missionaries are grateful to pastors who take time to ask, “What is your financial need? How can our church help you?” ABOUT COMMUNICATION Concerning possible support, scheduling of a service, etc., missionaries would rather be told “no” than to have no communication at all and be left wondering. Communication between pastors and missionaries is critical. Pastors want to hear from missionaries. Missionaries also appreciate an occasional letter from a pastor, especially when they are going through ‘tough stuff’ on the field. Even one letter from a pastor during a missionary’s four-year term is encouraging. Pastors, please return phone calls and answer letters—even if done by a secretary or a handwritten reply on the missionary’s original letter. Missionaries love to hear from churches, either through church newsletters or personal correspondence. If a pastor/church cannot have a missionary for a service or pick up a new missionary for monthly commitment, he/she will understand. However, communicating this ASAP would help cut down on the missionary’s phone charges and time. Pastors should demonstrate preparedness when inviting a missionary for a service. A missionary should not be left to guess whether he has lodging for the night or a hot meal after the service. The pastor and missionary need to communicate these things prior to the service. The first three months on the field are the hardest. Regular correspondence and encouragement through this time is a great help. Missionaries need to know about pastoral changes, congregational changes, financial difficulties and victories so that they can pray and feel a part of the church family. Let the missionary know if you must drop or lessen your financial support. They don’t necessarily need to know the reason, but they do need to know so they can plan accordingly. The missionary’s “lifeline” depends on keeping up with pastoral and address changes. Missionaries appreciate knowing how correspondence should be addressed. Should newsletters and other items be sent to the pastor, missions committee chairman or someone else? ABOUT CULTURAL DIFFERENCES Missionaries returning after a four- or five-year term are not always aware of changes in society and culture. Prepare the speaker about topics that might be offensive. 34 So-called “tourist destination countries” have great needs, both spiritually and socially. Tourists only see beaches or other popular sites, not real life, when they come on vacation. Missionaries wish pastors knew how difficult it is to return to America after several years of ministry. While missionaries are on the field, they are constantly invited to speak and are graciously welcomed by national pastors wherever they go. It is most humbling and discouraging to call some U.S. pastors repeatedly, just to hear their secretaries say, “I’m sorry, the pastor is in a staff meeting,” or “I’m sorry, he isn’t available right now. Can you call back?” After calling many times and getting the same response—and even asking the secretaries to have the pastor call them collect—the missionary’s call is rarely returned. ABOUT ITINERATION Within an 11- to 12-month period, the missionary family tries to enjoy a time of vacation by traveling to places in the United States together. They have only one chance in every five years to do so. Itineration is like an 18-month job interview for the new missionary. Itineration is not the same as a furlough. Rather, itineration is a difficult year of intense fundraising. Please return calls and be up front, even if you have to say “no.” Itineration is a required part of field service. Please don’t view it as a vacation with a full salary from the Assemblies of God. Missionaries usually maintain support of their ongoing ministries on the field, even while they are itinerating. Missionaries don’t enjoy a year of vacation during itineration. Trying to keep a full schedule and prepare for services (just as pastors do) is hard work. Missionaries spend long hours on the road away from their families and often have little time to spend with elderly parents, grown children and grandchildren. ABOUT EXPECTATIONS Please advise the missionary what you expect of him or her. Do you want a sermon with illustrations from the field, a report from the field, video or other visual presentation? Give sufficient time for his or her participation. Be clear about time. Communicate your expectations about arrival time, the amount of time allowed for the missionary’s presentation, etc. When the missionary arrives, please ask someone to greet him and show him where to go and what to expect. Missionaries travel so much and are in so many diverse congregations that they cannot automatically know what a church wants from their ministry. Talk about plans for the service, such as expectations, dismissal time, etc. 35 ABOUT THE FAMILY Families cannot always travel together. The missionary’s children attend school just as all children do. If the missionary’s wife and family are in the service, ask someone to help them feel at home. If a missionary’s teenagers don’t travel during itineration, it’s often because they need to be connected to an English-speaking youth group in a local church. Don’t assume all missionary wives are proficient at or like to speak before a crowd. Have the courtesy to ask rather than assume and assign. ABOUT FELLOWSHIP The time after the service is often as important to the missionary as the service itself. A meal with the pastor is not just another restaurant meal; it is a final opportunity for the missionary to communicate his or her call, the needs of the field and the need of continual support. Topics can be addressed here that cannot be said during the service. Missionaries need friends, even though they are home for only a year. Missionary wives appreciate being introduced to the pastor’s wife before the service. That way they won’t wonder whether she is the pianist or worship leader or if she is even present. It is not necessary that they sit together. Missionaries want to know pastors as individuals. A chance to talk and share for a while before the service is very helpful. If a missionary is scheduled for a Sunday morning service, he or she would enjoy going out for dinner with the pastor’s family on Saturday night. The time invested will pay real dividends in the service. Missionaries are people too. They get lonely as they constantly travel to new places. Fellowship with people is very welcome and refreshing after a service. Missionaries need a church and a pastor to “adopt” them and their family when they come home for itineration. Don’t avoid missionaries, especially at district functions. ABOUT ADDITIONAL MINISTRY Please pray with the missionary before a service. Include members of the missions committee and other staff members in a short meeting so the missionary can answer any questions of interest they may have. Adult Sunday School classes are a wonderful time for questions and answers. Some people have lingering doubts about missions; give them a chance to get an answer. 36 Tell the missionary how he or she can help elevate the church’s missions vision and budget. Help the missionary know how to pray for you and your congregation. Even though a church cannot make an additional monthly commitment, invite a missionary to come and help keep the missions vision alive. Missionaries who are part of AGWM’s stateside ministries live in the United States because of the communication, logistical and financial requirements of their work. While most of them would prefer to reside overseas, the nature of their ministry demands a stateside office. Often these missionaries are out of the country more than they are in the United States. Missionaries want to minister! Let them preach and have an altar call. They want to bless, encourage and challenge people. Please don’t refuse missionaries for Wednesday evening services. They don’t mind a small attendance and must have a minimum of 10 services a month, according to AGWM policy. Missionaries do what they do for one reason only: The Harvest Master has called them, and they are committed to obey—whatever the cost. ABOUT HOUSING/FOOD ARRANGEMENTS If a missionary will be staying in a motel, advise him or her in advance of its name and location. Missionaries don’t need to eat a big meal before a service. They usually feel better if they don’t. A snack after the service is appreciated. Missionaries want pastors to understand that Sunday afternoons away from home and between churches can present a problem. It would be helpful to have a place to stay and rest. Quite a few churches have missionary quarters. Missionaries appreciate pastors who offer these accommodations while they are in the area. Missionaries are grateful when pastors offer meals and lodging without being asked. ABOUT OFFERINGS Please refer to the offering as a “cash offering for the missionary’s work budget” as opposed to a “love offering for the missionary.” Most people think of a “love offering” as an honorarium for the missionary’s personal needs. Missionaries would rather receive a $125 offering than a $200 honorarium. Giving people a chance to respond is very important. Take a cash offering for the missionary. Don’t mix it with other offerings and don’t mention other needs. Giving only an honorarium chains God’s hands. 37 Pastors should know the expenses missionaries incur by coming to their church. For example, if a pastor invites a missionary to a church, knowing that he or she must drive hundreds of miles to get there, and the check does not cover the mileage, the missionary actually paid money to minister in that church. Missionaries would rather trust God for a good offering than receive an honorarium. Missionaries find themselves in a difficult position when they have to wait for an offering in the mail. A check should be given at the time of the service. Missionaries must receive the offering before they can issue a receipt. ABOUT PARTNERSHIP Cooperation is a partnership. Missionaries cannot serve on the front lines without the ‘support troops’ back home. They help churches fulfill the Great Commission. Missionaries want to be partners. The more involved the church is in their work, the stronger their relationship will be. Missionaries need partners at home and they know it. Churches need missionaries in order to obey the Great Commission! ABOUT PHONE CALLS As many as 10 phone calls are needed to contact a pastor. A large part of itineration time is spent calling pastors multiple times. Missionaries would get to the field quicker if pastors would return their calls. Please return phone calls, even you must tell a missionary that he or she can’t come for a service. Answering machines say you will return the call, but you seldom do. It’s frustrating to try repeatedly to reach a pastor whose secretary constantly shields him from all callers. Please return a missionary’s phone calls! If you cannot have a missionary, tell him up front. This will save missions money. ABOUT MONTHLY COMMITMENTS A simple “no” for a service or a monthly commitment is more loving and cost effective than a “maybe” or a “check with me later,” knowing that the church cannot or has no plans to give to the missionary’s support. If support for missions decreases, don’t drop a missionary completely. Instead, write and inform the missionary of the situation. The missionary can certainly pray for the need. Perhaps he or she might also write a letter to encourage the people to become involved. 38 Missionaries struggle when they are taken from a church’s support list each time a new pastor comes on staff. Missionaries need faithful, dependable support even more than large amounts of money given sporadically. Missionaries still need monthly support while they are itinerating! Trust area directors to evaluate the missionaries under their care. Individual churches cannot possibly make this call. Instead, churches should pray and ask God whom they should support and then do it. Some churches have a policy of increasing a missionary’s monthly commitment every year or at least every term before they take on new candidates. This covers inflation, which often skyrockets, and the inevitable drop in support from other sources. Since the missionary’s budget goes up every term, this policy and practice is greatly appreciated. Be up front about telling a missionary that your church can’t take on any new commitments. That’s a much better approach than making a missionary believe that you will send in a monthly commitment when you have no intention of doing so. ABOUT PRESENTATIONS Please don’t feel that you have to invite all missionaries for an entire service. They would prefer a 10-minute window to a closed door. Missionaries wish pastors understood that their role in a service is not only to preach, but also to inform and report on the church’s missions investment. Many missionaries who come for ministry have traveled thousands of miles and invested years of their lives in missionary service. Please adjust the time spent on music and preliminaries and let them share their heart. Missionaries appreciate pastors who give them plenty of time and freedom to make their presentation. Please be present at the service when the missionary speaks. ABOUT SCHEDULING Pastors should avoid making tentative bookings. This often prevents missionaries from scheduling services in an organized manner. Inviting a missionary for a service when the pastor knows he will not be there is sometimes awkward. Often, no one is left in charge, and the missionary ends up being a “fill-in” speaker. Please don’t use missionaries as “pulpit fill-ins” without prior consultation. The missionary deserves to know, and they feel cheated when they show up and discover you are not there. Missionaries love preaching missions services but feel stressed when scheduling them. 39 ABOUT CANCELLATIONS Missionaries realize that canceling a service is sometimes necessary. However, they wish pastors knew the effect that this has on their itinerary, especially when the cancellation occurs less than two weeks prior to the service and plans are already set. Scheduling a replacement service less than four weeks ahead of time is next to impossible. Some missionaries do not find out about the cancellation until they call to confirm the service. This causes stress and frustration for everyone involved. If you tell a missionary you will reschedule a service, be sure to do so. VIEWS FROM A MISSIONS SECRETARY A missions secretary wrote: “We just finished my first attempt at a missions convention in our small church (around 100). What a wonderfully blessed weekend of activities! “Since January, we have hosted missionaries in our home for dinner and fellowship with a few couples and the pastor and his wife. This has had a tremendous effect on the missionaries as well as each of us present. One missionary couple told us that this was their first time to be in a home for food and fellowship. “As a missions secretary, I have the privilege to be in contact with missionaries by e-mail. This contact has further developed our church’s friendship and concern for them in their struggles. They send prayer requests to us and we pray for them on Sunday as a congregation. What powerful stuff!” 40 Missions Convention Planner G. MISSIONS CONVENTION PLANNER by Randy Hurst Assemblies of God Missions ©2OO9 Gospel Publishing House 1445 North Boonville Avenue • Springfield, MO 65802-1894 HOW TO PREPARE FOR A MISSIONS CONVENTION by Randy Hurst Communications Director Missions is at the very heart of the Church’s purpose. Jesus said, “The field is the world.” Missions is spreading the good news of Jesus and establishing His church at home and abroad. The whole church can and should be involved in the mission of reaching the lost. God blesses churches that have a heart for missions. Studies compiled over many years confirm that churches holding missions conventions and other missions services through- out the year enjoy not only increased missions giving, but increased financial support and evangelism in their own churches as well. A regular missions emphasis once a year, or preferably twice a year, will keep the mis- sionary vision of the church before the people. With prayer and planning, a missions convention can be a dynamic means God uses to inspire, enlist, challenge and motivate the local church. Each church, regardless of size, can have a missions convention. A church’s first missions convention can be simple, with new features added in subsequent years. The convention will increasingly become a highlight of your church year. PRAY The first order of business in planning a missions convention should be prayer. Any effective activity for God’s kingdom depends on our communication with Him. A constant attitude and habit of prayer seeks divine involvement. Ask the Holy Spirit to guide, inspire and unite the church in purpose. Goals, plans, and decisions should continually be pre- sented to Him. PLAN AHEAD The date for your convention should be chosen well in advance. A year, or at least 6 months, will give you time for scheduling and planning essential details. Check your church, school, district and community calendars to ensure the convention won’t conflict with events that would involve members of the congregation and lower the attendance and participation. Avoid scheduling the convention on a holiday when families are often out of town. It might be helpful for you to change the time of year for your missions convention to get a particular speaker you want. Certain months in the spring and fall are prime times for missions conventions, and many speakers are already committed. If you can be flexi- ble, it may help you to get the speaker you want. Shifting a missions emphasis may throw off the 12- or six-month faith promise commitments made at the previous convention, but it likely will not hurt the faith promise program. If you plan to cooperate with other churches in the area in a combined or “round- robin” convention, early planning is all the more important to settle the dates. Appoint a missions committee. People will take “ownership” of the missions conven- tion and work for its success. The size of the committee will depend upon the size of the church and its involvement in missions. There may be as few as two or three or as many as 10 to 12. Consider repre- sentation from various ministries of the church such as youth, children, music, women’s ministries, and men’s ministries. At least one person on the committee should have good organizational skills. Other qualifications to consider include church membership, faithful attendance, a cooperative spirit and financial support of missions. The senior pastor should be a member of the missions committee. Pastoral oversight is important for the committee to function well. SUGGESTIONS • If you have two conventions a year, and one is a week-long event, you might make the alternate emphasis just a weekend event. Some churches make their fall emphasis the longer one and have a shorter one in the spring. • If you have speakers who are raising their monthly budgets, try to commit regular sup- port to them, especially if you want them to return to your church. Missionary speakers have sometimes been taken advantage of, having worked hard in a convention without receiving any monthly support, even when others received support who were not even a part of the convention. • Nothing is more effective than when a missionary communicates his or her calling and passion through preaching the Word. Some missionaries, especially those who work in specialized ministries, may not be strong public speakers but can be interviewed during a service. The pastor can ask questions that will be of interest to the congregation. Probably the best thing to ask a missionary to do is describe his call to missions in gen- eral or to the specific country where he or she works. • Publications, videos, theme materials, decorations and missionary interviews are help- ful, but for more than 86 years the primary means of communicating missions to people in our churches has been by missionaries in our pulpits. In surveys done of Assemblies of God missionaries both in 1985 and 1995, of 25 reasons given for how missionaries became convinced that God was directing their lives toward missions, the top two rea- sons were personal prayer and hearing missions sermons by a missionary. Along with eliciting prayer and giving for missions, the most important thing that can happen in a missions convention is when the Lord speaks to the heart of children, youth or adults concerning full-time missionary service. ORDER MATERIALS AND SUPPLIES Each year the Assemblies of God selects a theme to promote missions awareness and a variety of items are produced for use in churches. These include a missions musical, choir books, accompaniment DVDs, orchestration books, banners, bulletin covers and inserts, placemats, faith promise cards, offering envelopes, letterhead stationery, thank-you cards and an activity book for children. Also available are informational brochures that can help educate a congregation concerning Assemblies of God missions. The Assemblies of God World Missions U.S. Relations Department has a variety of items available that will help make your convention more effective. If you haven’t received the most recent catalog, call 417-862-3420 or view online at www.worldmissions.ag.org. Several items are available, including Newsbreak, a DVD magazine that reports on current mission- ary activity around the world, WorldBeat DVDs for youth, go 360 DVDs for children and a PowerPoint presentation concerning the missions faith promise. Other convention items include banners, posters, bulletin covers, placemats, lapel pins, informational and educa- tional brochures, and “True Story” brochures. A missions musical is produced every year that focuses on the annual missions theme and can be presented in missions banquets and services by a live choir, or as a video presentation, or both. The musicals are also designed to utilize single songs that can be performed individually. SET GOALS Decide in advance specific goals you want your convention to accomplish. Is your goal to increase the amount committed to the missionaries you currently support? Do you want to make commitments to missionaries not on your list or to a certain number of new missionaries and projects? Try to set goals that are challenging, but attainable. Organize your convention around them and try to reach all the goals you set. PROMOTE To create interest and support, involve your congregation in the preparation and pro- motion of the convention. Communicate missions whenever possible and emphasize the individual’s responsibility to winning the lost. Pastors, deacons, and missions committee members can bring their faith promises forward before the congregation is asked to fill out cards. Church leadership can set the example for making faith promises. It is essential that in the weeks prior to the convention the pastor educates, or reedu- cates, the congregation concerning missions faith promises. Faith Promise Sunday is not the best time to educate people. It is the time to motivate them and call them to commit- ment. Thought and prayer concerning missions faith promises should take place before Faith Promise Sunday. Faith promises can be promoted in several ways during the weeks leading up to the missions convention. 1. Have a meeting with your adult and youth Sunday school teachers to convey your vision for total involvement concerning faith promises. Sunday school teachers can be encour- aged to take five or 10 minutes of class time a week or two before Faith Promise Sunday to challenge their class members to personal involvement in missions. 2. If members of the congregation have testimonies concerning how the Lord has enabled them to give to missions and how their lives have been blessed by it, ask a couple of them to share brief testimonies in services prior to the missions convention. 3. Short videos or a PowerPoint presentation concerning the missions faith promise, as well as other brief video reports, can be shown in church services and Sunday school classes leading up to the missions convention. THE INTERNATIONAL DINNER An international dinner featuring food from different areas of the world will give every- one a “taste” of life in a foreign country. If such a banquet is not feasible, a potluck will give your congregation an opportunity to meet and fellowship with missionary guests. The following are just a few tips concerning an “international dinner,” if you have one on a Saturday evening before Faith Promise Sunday or at some other time in the convention: 1. You don’t need to have exotic, strange dishes. Readily available ethnic foods in America are good, such as Italian spaghetti, Chinese carry-out, Thai, Indian or Mexican food. 2. The international dinner does not necessarily need to have a sermon, but can be a time of informal sharing with the missionaries. If you do have a speaker, the message should be shorter than in a normal service. Many churches present the annual missions musi- cal at their missions banquet. 3. One effective banquet feature for an international dinner is a Mexican piñata for the children to break. It can be a highlight of the evening. Piñatas are available for pur- chase in toy stores or party supply stores. They are crepe paper animals stuffed with little toys and candies. The piñata swings back and forth on a length of heavy twine or rope while blindfolded children take turns trying to hit it. These are a lot of fun for the kids (and parents alike). However, make sure everyone stands clear of the blindfolded child swinging the stick! A piece of one-inch plastic PVC pipe about a yard long will work very well for kids to swing and is less dangerous than a wooden stick. 4. People also like to dress in costumes if they have them. If some have been on missions trips, it gives them an opportunity to wear clothes they bought overseas. This can also highlight people of varied ethnic backgrounds in the congregation. ADVERTISE Missionaries will supply you with pictures and publicity information about themselves. Some newspapers list community religious events weekly. Some radio stations also do Public Service Announcements free of charge. Post pictures, posters or news stories about your speakers on the bulletin boards of the church so the congregation can be familiar with the convention participants before they arrive. The children’s department can con- duct a poster contest, with the best entries to be hung in local places of business. DECORATE To make the convention a special occasion, decorate the church auditorium to high- light the theme. Flower arrangements by local “green thumbs” and curios or costumes provided by guest missionaries or international congregation members will brighten the sanctuary. Flags, posters, banners and pictures will add to the special atmosphere. Booths in the foyer dedicated to each missionary participating in the convention work well too. Builders and carpenters in your church can construct displays—African huts, etc. RESOURCES AND DISPLAYS World Missions will mail or you an order form that lists available materials. An annual catalog is also available. You may order supplies by telephone, fax or mail. Some other suggestions are: 1. If you want to obtain international flags, contact Ozark Flag Distributors for a brochure and price list or visit www.ozarkflag.com. Their toll-free number is 800-288-3101. 2. You can obtain world maps in various sizes from the National Geographic Society. Visit shop.nationalgeographic.com or call their toll-free number 800-437-5521. 3. Probably the most effective display I have ever seen relating to faith promises was at Highway Tabernacle in Youngstown, Ohio. A large map of the world was constructed of plywood, holes were drilled in the map, and Christmas lights pushed into the holes from the back. Several sets of Christmas lights represented missionaries the church already supported. As the faith promises were tallied on Sunday morning at the conclusion of the service, the sets of Christmas lights were lit according to the five strategic regions of Assemblies of God World Missions. They lit up ten or so lights, as commitments came in to cover the support of ten missionaries. The last set of lights to be lit were those representing missionaries that the church wanted to begin supporting in the current year. This display is a graphic way to demonstrate how supporting missionaries is only possible as people make commitments to give to missions on a regular basis. PRESENTING THE FAITH PROMISE PLAN A faith promise is a life-changing experience. God will use it to further fashion us according to His will and use us to bear fruit, that His kingdom will be increased and His name will be glorified. The most effective method of overall missions funding is training your people to give regularly to missions just as they do to the local church through tithes and offerings. Missions giving should be a regular part of worship just as tithes and offerings. THE SIX-MONTH FAITH PROMISE PROGRAM Following are some major advantages to the six-month faith promise. 1. I believe people will generally trust God in faith to give more per week or per month for a six-month period than a year. Sometimes a year can seem long to people, and they will commit more conservatively for a longer period of time. 2. Since we know that the missions commitment program works and that God honors people’s faith in this way, most people will commitment again six months later, and many will increase their commitment. Consequently, people will give more both in the first six months and then increasingly in the second six months than they would have given during a 12-month commitment. 3. If you have a 12-month program, new people coming into the church a month or two after the missions convention will have to wait 10 or 11 months before they have the opportunity to participate. If missions commitments are made every six months, they have an opportunity to participate sooner. This serves two valuable purposes, a. First, if they are new believers, they are getting involved in missions giving early in their experience, when they tend to be most zealous and responsive. b. Second, it increases the church’s missions income for the year, giving the budget a boost during the second six-month period. 4. You may receive many requests from missionaries to come for services. If you have two missions emphases, they can be featured during those times rather than having mis- sionaries every few weeks. RECEIVING FAITH PROMISES Receiving faith promises on Faith Promise Sunday can be done in several ways: 1. Faith promise cards can be enclosed in church bulletins, passed out to congregation members before the message, or distributed after the message. 2. After the congregation is led into filling out faith promise cards, they can be received by the ushers or placed in an offering bag when the missions offering is received at the conclusion of the service. Some pastors have missions committee members and/or board members and church staff bring their faith promises to the front to set an example of involvement. 3. If a number of missionaries are present in the convention, it is effective to have the mis- sionaries receive the faith promises from the congregation. It is very helpful for the pastor to hold up the faith promise card and talk briefly about it before the missionary or a guest speaker comes to deliver the message and explains that faith promises will be received at the conclusion of the message. I observed one pastor who had the church members come to the front and place their faith promise cards face down on the altar. This is very effective if the faith promises are tallied publicly at the conclusion of the service. TALLYING FAITH PROMISES There are two basic ways of tallying commitments: Totaling commitments after the morning service and announcing the total in the evening service, or tallying the commit- ments at the close of the morning service and announcing a running total while the congregation waits. The second way is an inspiring, exciting time, but it must be well-planned. The follow- ing considerations are important: 1. The speaker should conclude his message at least 10 to 15 minutes before the normal closing time of the service. To do this, it is very important that the speaker be given the service as early as possible. 2. The tallying procedure should be well-organized so it runs smoothly and time is not wasted. Following are some suggestions: a. Have ushers (or missionaries, if you have several) pick up the commitment cards and bring them to the tallying table. They should not wait until they receive all of the cards, but bring a few at a time toward the front. Keeping the ushers active and moving helps add to the excitement. b. Have two or three people at a table to tally the commitments. One person is not enough. One person should have an adding machine to add the commitments, subtotaling them periodically so the pastor can announce it. (IMPORTANT: Even though you may be doing missions commitments for six-months, the amount of the commitment should be figured on an annual basis, since the missions budget is figured annually.) Two more people should calculate the annual amount of each commitment from the weekly or monthly figure written on the cards. They should use a red marking pen to write this amount in large figures on the commitment card. For example, a $10 per week faith promise would be $520 for a year. After the annual amount has been written in red and circled the cards should be passed to the person with the adding machine to total. This makes the total faith promise figure easier to calculate. It is critical that there be a clear understanding of procedure so the total that is announced is accurate. In one convention, there was confusion at the tallying table, and a figure was announced that was significantly larger than the actual amount that came in. The pastor was left in an embarrassing position of announcing Sunday night that the missions commitments were $30,000 less than what had been announced that morning. To prevent such a thing from happening, choose reliable people for the tallying table! Concerning the announcement of commitments, there are basically two approaches: 1. The pastor can read the amounts of individual commitments as they come in. As soon as the people who calculate the total commitment amount have circled the figure in red on the commitment cards, a stack of cards can be taken to the pastor to read aloud. Care has to be taken that a procedure is followed strictly concerning who gives the cards to whom. I suggest that the cards only be given to the pastor after they have been tallied by the person with the adding machine. Under no circumstance should the cards go back to the tallying table where they might be counted twice accidentally. One advan- tage of reading individual commitment amounts is the excitement it creates when people hear the number of commitments read and some of the large amounts that are given. One disadvantage is that when a large commitment is announced, people sometimes clap or vocally respond and no response is given for smaller commitments. (Often, of course, a smaller commitment might be a greater sacrifice for a person than a larger one that received more response.) 2. An alternative is to continually subtotal the amount and announce it periodically, possibly singing choruses in between. BUDGETING THE MISSIONS INCOME The final service should include prayer for your missionary speakers and guests. Invite the congregation to come forward, lay hands on them, and pray for God’s protection and anointing upon their ministries. This prayer time will bind your congregation and mis- sionaries together in a way that nothing else can. Be sure not to allow other things to supersede or interrupt this part of the convention. By the final night of the convention you will find that the guest missionaries are no longer strangers. They will have become brothers and sisters. Their visit has added inspira- tion, and their reports of what God has done throughout the world will have built faith in the hearts of your congregation. These benefits will remain to bless your church for months and years to come. During the week immediately following the missions convention, while the convention is fresh in your mind, call a meeting of the missions committee. Review every aspect of the convention and its planning. Ask the following questions: 1. What did we do right? 2. What did we do that we should not have done? 3. What did we leave out that we should have included? Now is a good time to establish the annual missions budget for the next 12 months. Did you receive enough faith promises to meet your projected giving? You can now adjust your giving to actual income. One word of caution might be helpful. If this was a first-time convention with faith promises, you do not yet have a record on the reliability of this income. For this reason, it is best not to budget the full amount of faith promises. If the total faith promise amount does come in, you will always find more missions needs in which you can invest later. KEEPING MISSIONS BEFORE THE CONGREGATION The following ideas can help you keep the level of missions interest high in the church: 1. If possible, include one-paragraph excerpts from recent missionary newsletters in each week’s church bulletin. This practice provides the congregation with a weekly report from a missionary the church supports and focuses their attention on one missionary at a time. Special prayer can be featured in a Sunday service for the missionary that is featured in the bulletin that week. Mail that missionary a copy of the service bulletin in which he or she was remembered. 2. Use the weekly Intercessor & World Report to keep missions before the congregation. This publication can be faxed or e-mailed to you; call 417-862-3420 for subscription information. 3. Have missions committee members carefully read all the newsletters that missionaries send to the church. Urgent meaningful prayer requests can be passed along to the pas- tor to mention during a service prayer time. 4. Have your own missions convention brochure printed. A simple one can be printed using the theme bulletin covers. The World Missions U.S. Relations Department can also supply full-color artwork, logos and photos on CD. World Missions giving credit is granted for all printing expenses you incur. 5. A key to keeping missions commitments alive in the local church is “talking it up” by mentioning missions commitments whenever it can be appropriately done. People need to think of their missions commitment and building pledge with as much regularity as they do their tithes. My former pastor, Charles Crabtree, taught us when- ever we took the offering to say, “Now it is time to receive God’s tithe, our offerings, and faith promises.” Just taking a few seconds each time the offering is received to mention faith promises as a regular part of the announcement at offering time keeps the concept before the people. CONCLUSION You may not be able to use all of the ideas presented in this booklet in one convention, or you may have other ideas that will suit your congregation better. But pray, plan early and be well-prepared. MISSIONS CONVENTION CHECKLIST 10 to 12 Months Ahead or More K Appoint a missions planning committee K Set dates 8 to 10 Months Ahead K Prepare schedule K Confirm speakers 8 Months Ahead K Announce convention dates 7 Months Ahead K Announce convention dates again 6 Months Ahead K Announce convention dates again K Appoint subcommittees K Decorations K Hospitality and/or banquet K Project K Convention activities for children K Convention activities for youth K Advertising K Prayer K Ushers and tabulators K Meet with committees, church leaders, staff and Sunday school teachers to explain the faith promise plan in detail. Use the “Missions Faith Promise” PowerPoint CD available from Assemblies of God World Missions. K Request letters or videos from missionaries your church supports 4 Months Ahead K Announce convention dates again 3 Months Ahead K Announce convention dates again K Order materials from Assemblies of God World Missions K Request prayer for the convention K Meet with subcommittees for reports 2 Months Ahead K Begin announcing the convention weekly K Activate prayer groups K Determine advertising to be used K Secure photos and news releases from the speakers 1 Month Ahead K Announce convention, including your goals for it K Reserve accommodations for the speakers K Include missions literature such as “True Story” brochures in the church bulletin K Meet with subcommittees for reports 3 Weeks Ahead K Announce convention, including your goals for it K Include missions literature in the church bulletin 2 Weeks Ahead K Announce the convention K Submit advertising K Announce a prayer meeting for next week K Meet with subcommittees for last-minute reports K Include missions literature in the church bulletin K Print the convention schedule in the bulletin 1 Week Ahead K Conduct a special prayer meeting for the convention K Preach a missionary message K Include a folder on the faith promise plan in the bulletin the week before Faith Promise Sunday K Announce the convention in detail, including your goals for it K Decorate the church, using theme materials from Assemblies of God World Missions U.S. Relations Department K Prepare a special bulletin with a thumbnail sketch of each missionary supported, the church’s present missions budget, and the proposed missions budget. Additional copies of this publication and other missionary pamphlets and tracts may be ordered by: writing Assemblies of God World Missions 1445 N. Boonville Avenue Springfield, Missouri 65802-1894 or calling 800-988-6568 You may want to order the book Proven Missions Convention Ideas from Assemblies of God World Missions, which contains ideas from many local churches and missionary leaders. Visit www.missions.ag.org to learn more about Assemblies of God Missions and other resources that are available.