DOCSLIB.ORG

DPP-4 Inhibitors As Antidiabetic Agents

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
DPP-4 Inhibitors As Antidiabetic Agents Discovery of DPP-4 Inhibitors as Antidiabetic Agents Tesfaye Biftu Merck & Co., Inc. Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved History of Diabetes • c. 1552 B.C. – 1st reference to Rx for polyuria by Hesy- Ra, 3rd Dynasty Ebers Papyrus • c. 100 B.C. – The father of medicine in India, Susruta of the Hindus, diagnosed diabetes • c. 30 B.C. ~ 50 A.D. – 1st clinical description of diabetes, Aulus Cornelius Celsus • c. 150 A.D. – The name “diabetes” was first introduced from the Greek word for “siphon” by Aretaeus of Cappadocia Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved ……….continued • Discovery of Insulin (1921) – An Instant Hit – First Human Clinical Trial 1922 – Noble Price 1923 Benting & MacLoed – Commercial Production 1923 Eli Lilly – First Total Synthesis 1965 Chinese Team • Discovery of Glucagon (1923) – Largely Unnoticed – Sequenced in 1957 – Rediscovered in 1970’s for its role in diabetes • Discovery of Incretins – Gastrointestinal Hormones – 1932 The term “incretin” was first used – 1970 GIP was isolated – 1982 GLP-1 was sequenced Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Diabetes is a Growing Worldwide Epidemic Europe 2000: 33.3 million 2030: 48 million Middle East 2000: 15.2 million 2030: 42.6 million Africa The Americas 2000: 7 million Asia and Australia 2000: 33 million 2030: 18.2 million 2000: 82.7 million 2030: 66.8 million 2030: 190.5 million Prevalence (%) in persons 35-64 yrs <3 3-5 6-8 >8 • 2000: 171 million cases worldwide; 2030: 366 million cases predicted • >90% is Type 2 diabetes: obesity is a major risk factor Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved WHO Trends among U.S. Adults: 1994 to 2004 1994 2004 <4% 4-4.9% 5-5.9% 6+% missing data Ø 20,800,000 People in US (7%) have diabetes (2005) Ø 6th Leading cause of death in US (2002), by death certificate Ø >90% Type 2, associated with metabolic syndrome Taken from CDC diabetes website: http://www.cdc.gov/diabetes Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Current Medications for Treatment of Diabetes Drug Class Side Effects Sulfonylureas Hypoglycemia, weight gain Meglitinides Hypoglycemia, weight gain Metformin GI intolerance Thiazolidinediones Edema, weight gain α-Glucosidase inhibitors GI intolerance Insulin Hypoglycemia, weight gain Safer and more effective medications are needed Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Role of Active GLP-1 and GIP in Glucose Homeostasis • Glucagon-Like-Peptide (GLP-1) and Glucose-Dependent- Insulotropic-Polypeptide (GIP) are secreted in response to food intake (glucose-dependent mechanism) • GLP-1 and GIP - (↑)stimulate insulin biosynthesis & secretion • GLP-1 inhibits - (↓) glucagon secretion • GLP-1 and GIP - (↓)lower blood sugar level Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved …. but Active GLP-1 (or GIP) is Cleaved Rapidly by DPP-4 Stabilize GLP-1 (Active) HA EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH 2 Inhibit DPP-4 t½ ~ 1 min GLP-1 (Inactive) EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH 2 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Dipeptidyl Peptidase IV (DPP-4) • First Isolated from rat liver in 1966 • Identical to CD26, a marker for activated T cells • Its role in energy homeostasis was discovered which led to the first patent application in 1996 • Cell surface serine dipeptidase belonging to the prolyl oligopeptidase family • Widely expressed, and has Specificity for P1 Pro >> Ala Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Selective Inhibitors F O O Me O S N NH2 O Me O N N N N N NH2 S NH F N 2 I CF3 DPP-4 Selective QPP Selective DPP-8/9 Selective Enzyme IC50, nM DPP-9 > 100,000 11,000 55 DPP-8 69,000 22,000 38 FAP > 100,000 > 100,000 > 100,000 DPP-4 27 1900 30,000 PEP > 100,000 > 100,000 > 100,000 QPP/DPP-2 > 100,000 19 14,000 APP > 100,000 > 100,000 > 100,000 prolidase > 100,000 > 100,000 > 100,000 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Comparative Toxicity Study QPP DPP-8/9 DPP-4 2 wk. Rat Toxicity Selective Selective Selective Alopecia ü Thrombocytopenia ü Reticulocytopenia ü ü Enlarged spleen ü Mortality ü Acute dog toxicity Bloody diarrhea ü G. Lankas, et al., Diabetes 2005, 54, 2988 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Potential Importance of Selective Inhibition for the Treatment of Type 2 Diabetes • Conclusion – “Off-target” peptidase inhibition (i.e. inhibition of other DPP family peptidases such as DPP8/9) can produce severe toxicity in preclinical species • Variables that may determine degree of toxicity – Cell penetration • Unlike DPP-4, DPP8/9 are intracellular DPP-4 proteins – Extent of inhibition of DPP8 and/or DPP9 • Not known if inhibition of both enzymes (or how much) is required to produce toxicities – Intraspecies differences in DPP8/9 inhibition from Demuth et al. Biochim. Biophys. Acta 2005, 1751, 33 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved DPP-4 Inhibitor Program - Objective Identify a potent and selective DPP-4 inhibitor for the treatment of type 2 diabetes mellitus with the following characteristics: • >1000-fold selectivity over other proline peptidases, especially DPP-8 and DPP-9 • Half-life suitable for BID or preferably QD dosing • Structure lacking reactive electrophile as a serine trap, e.g., O O B(OH)2 H CN H N N 2 N R N R R' X Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Common Lead Discovery Methods • Biological screening of compounds • Substrate or active-structure based design • Enzyme – inhibitor crystal structure Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Screening Leads Cl • β-Amino acid proline amides H O N IC = 1.9 µM NH2 O O 50 O N N H • β-Amino piperazines H2N IC50 = 11 µM N O N N NHSO2Me H Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Recovery of Radioactivity after IV (1 mg/kg) or Oral (2 mg/kg) Administration to Rats T NH2 O N F NH Radioactivity Recovered in 24 hrs (% Dose) Collection Period Intravenous Oral Bile 28.3 ± 2.6% 38.2 ± 4.7% Urine 18.1 ± 2.0% 14.0 ± 4.2% Feces 1.0 ± 0.2% 1.4 ± 0.6% Total 47.4 ± 3.9% 54.6 ± 4.9% PK Rat: • high clearance (>150 mL/min/kg) and • short half-life. Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Y. Teffera Metabolites identified in microsomes, hepatocites, and bile of PO/IV treated rats Microsomes: piperazine ring oxidation. Hepatocytes: Conjugation of the primary amino group (glucuronic acid and glucose). Oxidation of the piperazine, the phenyl and the fluoro-phenyl rings. Glutathione conjugation on the fluoro-phenyl ring; d) amide bond hydrolysis. Bile of PO treated rats: carbamoyl glucuronide conjugate on the piperazine ring. Glutathione conjugation of the fluoro-phenyl ring, piperazine ring oxidation, and N- glucuronidation of the primary amine were also observed. Bile of IV treated rats: Glutathione conjugation on the fluoro-phenyl ring, piperazine and phenyl ring oxidation, and N-glucuronidation of the primary amine. Urine of PO treated rats: Acid formed by the de-ethylation and oxidative de- amination of the piperazine ring. Oxidation of the piperazine ring, glucuronidation of the primary amine, and amide bond hydrolysis were also observed. Urine of IV treated rats: excreted mainly parent compounds Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Efforts made to stabilize metabolism NH2 O NH2 O N F X = NH, O N F N Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Bicyclic Piperazine Replacements N N N N N N N N N N N N R N R N N N N R R R O N R S N N N N N N R O N R R O N S R' R N R R R N N N N O N N N R' N R' R R N N N N O O R" R" R R N N N N N N N N R" N R R R N N N N R' R' N N N N N N N N N R R R R R N N N N Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Left Hand Side SAR NH2 O R N N N N CF3 Rat PK R DPP-4 IC50 Clp t½ Frat (nM) (mL/min/kg) (h) (%) 3,4-diF 130 51 1.8 44 2,5-diF 27 43 1.6 50 2,4,5-triF 18 60 1.7 76 MK-0431 = 100 JANUVIA™ (sitagliptin phosphate) D. Kim, et al., J. Med. Chem. 2005, 48, 141 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved F F Sitagliptin: In Vitro Potency NH2 O N N and Selectivity N F N CF3 IC50, (nM) Selectivity Ratio DPP-9 > 100000 > 5000 DPP-8 48000 2700 DPP-4 FAP > 100000 > 5000 Gene DPP-4 18 1 Family DPP-6 not active not active PEP > 100000 > 5000 Other Proline QPP/DPP-2 > 100000 > 5000 Specific Enzymes APP > 100000 > 5000 prolidase > 100000 > 5000 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved F F PK Properties of Sitagliptin NH2 O N N 1 mg/kg IV, 2 mg/kg PO N F N CF3 Clp Vd t½ PO AUCnorm PO Cmax F species (mL/min/kg) (mL/kg) (h) (µM·h/mpk) (µ M ) (% ) Mouse 64 3.8 0.8 0.41 0.51 61 Rat 60 6.4 1.7 0.52 0.33 76 Dog 6.0 9.0 4.9 8.3 2.2 100 Monkey 28 2.3 3.7 1.0 0.33 68 Copyright © 2010 Merck & Co., Inc., Whitehouse Station, New Jersey, USA All rights Reserved Pharmacodynamics of Sitagliptin: OGTT in Lean Mice 20 min
Load more

Recommended publications
  • Dear Colleagues, As the Directors of the Bloomington Drosophila Stock
    Dear colleagues, As the directors of the Bloomington Drosophila Stock Center, the national repository for strains of Drosophila melanogaster, we appreciate this opportunity to comment on the proposed redistribution of NCRR Division of Comparative Medicine activities to other NIH entities. In particular, we would like to address the plans to place oversight of non-primate model organism resources within NIGMS. Although we regret the loss of an NIH institute dedicated to research resources, we support the "straw model” plan to relocate the program for non-primate animal models from NCRR to NIGMS. NIGMS is the logical home for this essential activity, because both NIGMS and model organism resource centers support the full breadth of biomedical research—from investigations of fundamental biological processes to disease treatments. Because NCATS will focus primarily on advancing the development of new therapeutics, its mission will not encompass many resource center activities and it should not be expected to evaluate and oversee them. The resource centers strongly promote translational research and the development and use of animal models of human disease, but support of basic research is, and should continue to be, a central part of their mission. Translational research is possible only because a strong foundation of fundamental biological knowledge has been developed through basic research. It is appropriate that the administrative structure of NIH reflects this reality with respect to the oversight of non-primate model organism resources. There are strong synergisms between research supported by NIGMS and the interests of model organism research communities. As the primary funder of basic biomedical research in the U.S., NIGMS has steadfastly supported investigation in fields that underpin translational research such as biochemistry, molecular biology, genetics, developmental biology, physiology, pharmacology, neurobiology and behavior.
    [Show full text]
  • Use of a Single Hybrid Imaging Agent for Integration of Target Validation with in Vivo and Ex Vivo Imaging of Mouse Tumor Lesions Resembling Human DCIS
    Use of a Single Hybrid Imaging Agent for Integration of Target Validation with In Vivo and Ex Vivo Imaging of Mouse Tumor Lesions Resembling Human DCIS The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Buckle, Tessa, Joeri Kuil, Nynke S. van den Berg, Anton Bunschoten, Hildo J. Lamb, Hushan Yuan, Lee Josephson, Jos Jonkers, Alexander D. Borowsky, and Fijs W. B. van Leeuwen. 2013. Use of a single hybrid imaging agent for integration of target validation with in vivo and ex vivo imaging of mouse tumor lesions resembling human DCIS. PLoS ONE 8(1): e48324. Published Version doi:10.1371/journal.pone.0048324 Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:10859968 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA Use of a Single Hybrid Imaging Agent for Integration of Target Validation with In Vivo and Ex Vivo Imaging of Mouse Tumor Lesions Resembling Human DCIS Tessa Buckle1,2, Joeri Kuil1,2, Nynke S. van den Berg1,2, Anton Bunschoten1,2, Hildo J. Lamb3, Hushan Yuan4, Lee Josephson4, Jos Jonkers5, Alexander D. Borowsky6, Fijs W. B. van Leeuwen1,2* 1 Department of Radiology, Interventional Molecular Imaging Laboratory, Leiden University Medical Center, Leiden, The Netherlands, 2 Departments of Radiology and Nuclear Medicine, Netherlands Cancer
    [Show full text]
  • Research – the Institute for Comparative Medicine
    Prospectus – Vet Graduate School The Institute for Comparative Medicine This new Institute has been established as the research division of the School, and to promote an integrated approach to research strategy and planning. The Institute has a strong and diverse research profile much of which is directed towards the fundamental problems common to Veterinary and Medical diseases. Research within the Institute of Comparative Medicine is organised into four themes (Infection and Immunity, Wellcome Centre for Molecular Parasitology, Comparative Pathobiology, Animal Health). These four research themes encompass nine focussed sections that represent the major research activity of the Institute. Resources • Well equipped laboratories • Library • Study areas • PC & On-line access Research Groups Infection and Immunity (Contact: Prof. Andy Tait; [email protected]) Molecular and Immunobiology of Parasitism (Contact Prof. E. Devaney; [email protected]) The research of this group, which includes the Wellcome Centre for Molecular Parasitology (contact Prof. D.Barry; [email protected]), focuses on nematodes and protozoa, and involves molecular and immunological approaches to the understanding of their biology, immune evasion and pathogenesis. The fundamental knowledge which flows from these studies is being applied in the development of novel chemotherapeutics and vaccines. Research on nematodes uses C.elegans as a model system to investigate the development of the cuticle and to analyse the functional roles of key parasite-derived molecules. This research is directed at both the functional analysis of factors determining the expression of environmentally and developmentally regulated genes, as well as parasite regulation of the host immune response.
    [Show full text]
  • COMPARATIVE MEDICINE and VETERINARY SCIENCE APRIL Published Monthly at GARDENVALE, QUE
    Canadian Journal of COMPARATIVE MEDICINE AND VETERINARY SCIENCE APRIL Published Monthly at GARDENVALE, QUE. by NATIONAL BUSINESS PUBLICATIONS, LIMITED EDITORIAL BOARD T. W. M. CAMERON,. T.D.; M.A.; B.Sc. (Vet. Sc.); Ph.D.; D.Sc.; M.R.C.V.S. Director, Institute of Paravitology, Macdonald College, Que. Chas. A. MITCHELL, V.S. B.V.Sc.; D.V.M. Pathologist, Animal Diseases Research Institute, Hull, Que. R. A. McINTOSH, M.D.V.; B.V.Sc. Professor, Diseases of Animals, Obstetrics, Therapeutics, Ontario Veterinary College, Guelph, Ontario. G. T. LABELLE, D.M.V. Inspecteur Vetirinaire senior, Montreal, P. Q. Subscriptions $2.00 per year to qualified veterinarians, libraries, and scientific institutions. Volume 7 Number 4 CONTENTS IDr. A. F. Cameroii, V. 0. G., Retires ....... .............. 97 Dr. E. A. WVatson Retires ......... ................... 98 Obituary-Dr. G. C. Lawrelnce ........ .................. 99 Eiizootic Bovine Haematuria ............ ................ 101 Veterinary Problems from Feeding Coniditions ..... ....... 108 Chastek Paralysis on Alberta Fox Ranbch ...... ............ 112 Implied Warranty of Fitness-Legal Decisioni ..... ....... 114 Current Veteriniary Literature ........ .................. 118 Western Ontario Veterinary Associafioli ........ .......... 123 Book Reviews ..................... ..................... 124 IPUBUAIN IMIbITED ADVERTISING OFFICES:-Head Office:-Gardenvale, Que. Telephone: Ste. Anne de Bellevue 700. Montreal Office:-M. G. Christie, Castle Bldg. Telephone Ma. 9534. Toronto Office:-137 Wellington St., Room 1206, (V. E. Heron). Telephone: Waverley 6206. Vancouver:-F. A. Dun- lop, P. Q. Box 582. Telephone Pacific 2527. New York; W. G. Gould, 7 West 44th Street. Tele- phone, Murray Hill 2-9888 Chicago:-William S. Akin. Suite 512, Mercantile Exchange Bldg., 308 West Washington Street, Telephone: State 8496. San Francisco:- C. H. Woolley, Room 708, 605 Market Street.
    [Show full text]
  • GSA Response to NIH Request for Information On
    Genetics Society of America Response to NIH Request for Information FY 2016-2020 Strategic Plan for the Office of Research Infrastructure Programs: Division of Comparative Medicine and Division of Construction and Instruments Programs Request for Information (NOT-OD-15-056) • Response Form Submitted March 16, 2015 Responses are limited to 1,500 characters per topic. All responses must be submitted by March 16, 2015. Disease Models, Informational Resources, and Other Resources Disease models, informational resources and other resources that should be modified or expanded in parallel with ongoing advances in biomedical research The Genetics Society of America (GSA) emphasizes the importance of model organisms for advancing knowledge in biomedical research. We believe that continued investment in model organisms—and the resources needed for supporting this research—is one of the most effective and efficient ways for NIH to continue to advance our understanding of living systems and improvement in human health. Model organism researchers depend upon shared community resources that serve the entire community, including stock centers and model organism databases, several of which depend upon ORIP funding. The long-term and consistent support of these community resources has been a crucial component of the strength and success of biomedical research in the United States and assures its future vigor. Centralized stock centers and databases provide optimal resource sharing that maximizes the return on the investments made by NIH and other government agencies. These community resources provide “off-the-shelf” research tools and thus increase the efficiency and speed of hypothesis-driven research supported by other grants. In addition, NIH support for these community resources allows them to operate on an open access model, thus assuring that all researchers have the tools they need for discovery.
    [Show full text]
  • Yale Medicine Magazine
    Short-term gains, long-term losses Winter 2020 ALSO 4 FDA approval for Ebola vaccine / 44 Paying it back: Kristina Brown’s quest / 46 The machinery of immune systems Features 12/ Inflammation: part hero, part villain The traditional approach to inflammation is that it’s bad and should be suppressed, but recent findings offer a more nuanced view. By Christopher Hoffman 18/ Studying autoimmunity Researchers hope that the Colton Center for Autoimmunity at Yale will yield results over the next 10 years. By John Curtis 20/ Ketostasis: nature’s sweet spot Glucose plays a complex role in immune system health. By Sonya Collins 24/ Another use for aspirin A versatile remedy also a potential treatment for breast cancer. By John Curtis 26/ Untangling the web of autoimmune disorders When a person develops certain autoimmune disorders, others often follow in their wake. Figuring out why, and how to stop the deterioration, are top priorities for scientists. By Steve Hamm 30/ Why most heads don’t swell Some places in the body don’t suffer from inflammation as a response to intrusion. The brain and spinal cord are among them. By Christopher Hoffman 34/ A new dimension to intestinal surgery One doesn’t often think of the intestines when thinking about how 3D printing can assist with surgery or medicine. John Geibel is looking to change that. By Adrian Bonenberger 36/ Exploring the frontiers of immunity and healing Researchers at Yale are aware of how wounds know to heal. Now they want to know why. By Katherine L. Kraines OTTO STEININGER ILLUSTRATIONS STEININGER OTTO : AGE winter 2020 departments COVER AND OPPOSITE P 2 From the editor / 3 Dialogue / 4 Chronicle / 9 Round Up / 40 Capsule / 42 Faces / 46 Q&A / 48 Books / 49 End Note winter 2020 from the editor volume 54, number 2 Yale’s Actions and Response to Coronavirus (COVID-19) website, covid.yale.edu, provides such information as clinical and laboratory research, patient care, resources to both track Editor the spread of the virus and help cope during this crisis, COVID-19 news, and messages.
    [Show full text]
  • The Vitamin a Story Lifting the Shadow of Death the Vitamin a Story – Lifting the Shadow of Death World Review of Nutrition and Dietetics
    World Review of Nutrition and Dietetics Editor: B. Koletzko Vol. 104 R.D. Semba The Vitamin A Story Lifting the Shadow of Death The Vitamin A Story – Lifting the Shadow of Death World Review of Nutrition and Dietetics Vol. 104 Series Editor Berthold Koletzko Dr. von Hauner Children’s Hospital, Ludwig-Maximilians University of Munich, Munich, Germany Richard D. Semba The Vitamin A Story Lifting the Shadow of Death 41 figures, 2 in color and 9 tables, 2012 Basel · Freiburg · Paris · London · New York · New Delhi · Bangkok · Beijing · Tokyo · Kuala Lumpur · Singapore · Sydney Dr. Richard D. Semba The Johns Hopkins University School of Medicine Baltimore, Md., USA Library of Congress Cataloging-in-Publication Data Semba, Richard D. The vitamin A story : lifting the shadow of death / Richard D. Semba. p. ; cm. -- (World review of nutrition and dietetics, ISSN 0084-2230 ; v. 104) Includes bibliographical references and index. ISBN 978-3-318-02188-2 (hard cover : alk. paper) -- ISBN 978-3-318-02189-9 (e-ISBN) I. Title. II. Series: World review of nutrition and dietetics ; v. 104. 0084-2230 [DNLM: 1. Vitamin A Deficiency--history. 2. History, 19th Century. 3. Night Blindness--history. 4. Vitamin A--therapeutic use. W1 WO898 v.104 2012 / WD 110] 613.2'86--dc23 2012022410 Bibliographic Indices. This publication is listed in bibliographic services, including Current Contents® and PubMed/MEDLINE. Disclaimer. The statements, opinions and data contained in this publication are solely those of the individual authors and contributors and not of the publisher and the editor(s). The appearance of advertisements in the book is not a warranty, endorsement, or approval of the products or services advertised or of their effectiveness, quality or safety.
    [Show full text]
  • Merck & Co., Inc. and Pfizer Enter Worldwide Collaboration
    Published on Pfizer Pharmaceutical News and Media | Pfizer: the world's largest research-based pharmaceutical company (http://pfizer.newshq.businesswire.com) on 4/29/13 9:23 am EDT Merck & Co., Inc. and Pfizer Enter Worldwide Collaboration Agreement to Develop and Commercialize Ertugliflozin, an Investigational Medicine for Type 2 Diabetes Release Date: Monday, April 29, 2013 9:23 am EDT Terms: Dateline City: WHITEHOUSE STATION, N.J. & NEW YORK Merck & Co., Inc. (NYSE: MRK), known as MSD outside the United States and Canada (“Merck”), and Pfizer Inc. (NYSE:PFE) today announced that they have entered into a worldwide (except Japan) collaboration agreement for the development and commercialization of Pfizer’s ertugliflozin (PF-04971729), an investigational oral sodium glucose cotransporter (SGLT2) inhibitor being evaluated for the treatment of type 2 diabetes. Ertugliflozin is Phase III ready, with trials expected to begin later in 2013. “We are pleased to join forces with Merck in the battle against type 2 diabetes and the burden that it poses on global health,” said John Young, president and general manager, Pfizer Primary Care. “Through this collaboration, we believe we can build on Merck’s leadership position in diabetes care with the introduction of ertugliflozin, an innovative SGLT2 inhibitor discovered by Pfizer scientists.” Under the terms of the agreement, Merck, through a subsidiary, and Pfizer will collaborate on the clinical development and commercialization of ertugliflozin and ertugliflozin-containing fixed-dose combinations with metformin and JANUVIA® (sitagliptin) tablets. Merck will continue to retain the rights to its existing portfolio of sitagliptin-containing products. Pfizer has received an upfront payment and milestones of $60 million and will be eligible for additional payments associated with the achievement of pre-specified future clinical, regulatory and commercial milestones.
    [Show full text]
  • Comparative Medicine Resources
    OFFICE OF RESEARCH INFRASTRUCTURE PROGRAMS FACT SHEET COMPARATIVE SPRING 2017 MEDICINE ORIP MISSION The Office of Research Infrastructure Programs RESOURCES (ORIP) advances the NIH mission by supporting research infrastructure and research-related resources programs, and coordinating NIH’s science education https://orip.nih.gov/comparative-medicine efforts. ORIP’s programs support biomedical researchers with the infrastructure and research- related resources they require to advance medical research and continue improving human health. OVERVIEW Comparative Medicine plays an essential role in biomedical discovery by enabling scientists to better understand, diagnose, prevent, and treat human diseases. Often serving as a bridge between basic science and human medicine, animal models1 have enabled numerous major medical advances—safe and effective vaccines, including Hepatitis A and B immunizations; improved cancer treatments; blood transfusions; organ transplantation; bypass surgery; and joint replacement. Animal • Support phenotypic and genetic characterization models are actively being used to understand the causes of animal models and the development of new and of, and develop therapies for, almost all human conditions, improved long-term storage of animal germ plasm. including cancer, cardiovascular disease, diabetes, obesity, and neurodegenerative and infectious disease. • Support studies aimed at improving the welfare and husbandry of laboratory animals. • The Division of Comparative Medicine (DCM), within the Office of Research Infrastructure Programs (ORIP), • Enable career development and translational research Division of Program Coordination, Planning, and training for veterinary students and veterinarians as well Strategic Initiatives (DCPCSI), National Institutes of as for post-doctoral investigators who use laboratory Health Office of the Director (NIH/OD), works to: animals. • Ensure that NIH-supported researchers have access to, • Increase public-private partnership opportunities with and facilities for, animal models critical to research.
    [Show full text]
  • Identification of Dipeptidase-1 As an Organ-Selective Adhesion Receptor Utilized by Neutrophils and Metastatic Cancer Cells in the Liver and Lungs
    University of Calgary PRISM: University of Calgary's Digital Repository Graduate Studies The Vault: Electronic Theses and Dissertations 2018-04-30 Identification of dipeptidase-1 as an organ-selective adhesion receptor utilized by neutrophils and metastatic cancer cells in the liver and lungs Roy Choudhury, Saurav Roy Choudhury, S. (2018). Identification of dipeptidase-1 as an organ-selective adhesion receptor utilized by neutrophils and metastatic cancer cells in the liver and lungs (Unpublished doctoral thesis). University of Calgary, Calgary, AB. doi:10.11575/PRISM/31901 http://hdl.handle.net/1880/106619 doctoral thesis University of Calgary graduate students retain copyright ownership and moral rights for their thesis. You may use this material in any way that is permitted by the Copyright Act or through licensing that has been assigned to the document. For uses that are not allowable under copyright legislation or licensing, you are required to seek permission. Downloaded from PRISM: https://prism.ucalgary.ca UNIVERSITY OF CALGARY Identification of dipeptidase-1 as an organ-selective adhesion receptor utilized by neutrophils and metastatic cancer cells in the liver and lungs by Saurav Roy Choudhury A THESIS SUBMITTED TO THE FACULTY OF GRADUATE STUDIES IN PARTIAL FULFILMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY GRADUATE PROGRAM IN MEDICAL SCIENCE CALGARY, ALBERTA APRIL, 2018 © Saurav Roy Choudhury 2018 Abstract Lungs and liver are two major sites of neutrophil trafficking and inflammatory disease. Neutrophil recruitment in response to an inflammatory cue is a sequentially coordinated process where adhesion molecules expressed on the endothelium of a given organ mediate different steps in the classical leukocyte recruitment cascade [1].
    [Show full text]
  • Comparative Medicine in Ancient Egypt: Origins of Early Biomedical Theories
    Comparative Medicine in Ancient Egypt: Origins of Early Biomedical Theories Calvin W. Schwabe In introducing today's lecture let me repeat for any of you without medical backgrounds that epidemiology is the study of diseases in populations. It is the one diagnostic approach which is unique to the practice of medicine at herd or other population levels. Of the 3 main facets of epidemiological diagnosis-- disease intelligence, medical ecology and quantitative analysis-- portions of the first two have often been referred to popularly as "disease sleuthing" or medical detective work. Many of you are familiar with the fascinating yet factual narratives about inquiries into the patterns and behavior of diseases new and old which were written over a many year period for the New Yorker magazine by Berton Rouché, a very talented reporter of science who died just a few weeks ago. Many of those narratives were also collected into several absorbing books about the work of epidemiologists as medical detectives. I drew yesterday upon my long interests in more systematized information-gathering for disease control efforts to indicate how veterinary services delivery in Africa could prove the vital key to initiation and facilitation of successful development approaches among that continent's tens of millions of migratory pastoralists, peoples whose plights in the southern Sudan, Somalia, Ethiopia, Rwanda, the Sahel and elsewhere in Africa intrude upon our living room TV screens every now and again. Today I am going to introduce aspects of a very different but interestingly related type of medical detective work which I have managed since the 1950s to "piggyback" logistically upon those other development-related activities in Africa.
    [Show full text]
  • Abstract Book 2011
    The Ramanbhai Foundation 5th International Symposium Current Trends in Pharmaceutical Sciences “Advances in Translational Research & Medicine” Feb 1-4, 2011 Zydus Research Centre, Ahmedabad, India Scientific Abstracts ranslational Res ng T earc nci h va Ad www.rbfsymposium.net ranslational Res ng T earc nci h va Ad ZRC MISSION ZRC aims to be the most admired pharmaceutical research center for innovation in life science dedicated to alleviating human sufferings. www.rbfsymposium.net Contents Message from the Chief Patron 3 About Ramanbhai Foundation 4 Zydus Cadila 5 About Zydus Research Centre 6 Program Schedule 7-14 Speaker Profiles & Abstracts Day I : Feb 1, 2011 16-29 Day 2: Feb 2, 2011 31-51 Day 3: Feb 3, 2011 53-73 Day 4: Feb 4, 2011 75-89 Poster Abstracts (P-001 to P-119) 91-138 Author Index 140-147 How to Reach Venue 148 Question Card ranslational Res ng T earc nci h va Ad 1 www.rbfsymposium.net 2 www.rbfsymposium.net Message from the Chief Patron Dear Delegates, It’s a pleasure to welcome you all to the Ramanbhai Foundation 5th International Symposium. A new decade has begun and it brings with it newer approaches and more promising ideas in research to predict, prevent, diagnose, and treat diseases. There is a need to look at newer ways to treat or prevent heart attacks, stroke, multiple sclerosis, cancer, diabetes and other diseases, including rare diseases and lessen the disease burden. Whether its through a breakthrough, incremental or marginal innovation – the focus of pharmaceutical research will be on delivering solutions, that are safe, effective, provide meaningful health outcomes and have a positive impact on the quality of life.
    [Show full text]