TMF1 antibody - N-terminal region (ARP58092_P050) Data Sheet
Product Number ARP58092_P050 Product Name TMF1 antibody - N-terminal region (ARP58092_P050) Size 50ug Gene Symbol TMF1 Alias Symbols ARA160; TMF Nucleotide Accession# NM_007114 Protein Size (# AA) 1093 amino acids Molecular Weight 123kDa Product Format Lyophilized powder NCBI Gene Id 7110 Host Rabbit Clonality Polyclonal Official Gene Full Name TATA element modulatory factor 1 This is a rabbit polyclonal antibody against TMF1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS Target Reference Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485 Description of Target TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP). Partner Proteins BRCA1, EP300, FOS, MAF, NFYA, PPARGC1A, USF1, USF2, BIRC5, BRCA1, EP300, FUS, HSPA4L, IGF2R, MAF, NPM1, PPRC1, PTP4A2, S100A8, S100A9, SERPINB3, SERPINB4, USF1, USF2 Reconstitution and Add 50 ul of distilled water. Final anti-TMF1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-TMF1 antibody is Catalog # AAP58092 (Previous Catalog # AAPP32525) Immunogen The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the N terminal of human TMF1 Swissprot Id P82094 Protein Name TATA element modulatory factor Sample Type Confirmation There is BioGPS gene expression data showing that TMF1 is expressed in MCF7 Protein Accession # NP_009045 Purification Affinity Purified Species Reactivity Pig, Horse, Human, Dog, Bovine, Rat, Guinea pig Application WB Predicted Homology Based on Immunogen Pig: 100%; Horse: 100%; Human: 100%; Dog: 86%; Bovine: 86%; Rat: 85%; Guinea pig: 85% Sequence
Human MCF-7
WB Suggested Anti-TMF1 Antibody Titration: 0.2-1 ug/ml ug/ml ELISA Titer: 1:12500 Positive Control: MCF7 cell lysate There is BioGPS gene expression data showing that TMF1 is expressed in MCF7
Image 1
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.