DOCSLIB.ORG

HEMCAM Downregulates (Beta)1 Integrin Expression

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
HEMCAM Downregulates (Beta)1 Integrin Expression RESEARCH ARTICLE 1847 HEMCAM/CD146 downregulates cell surface expression of β1 integrins Sandrine Alais1, Nathalie Allioli1, Cristina Pujades1, Jean-Loup Duband1, Olli Vainio2, Beat A. Imhof3 and Dominique Dunon1,* 1UMR-CNRS 7622, Université Pierre et Marie Curie, 75005 Paris, France 2Dept of Medical Microbiology, Turku University, FIN-20520, Finland 3Dept of Pathology, University of Geneva, CH-1211, Geneva, Switzerland *Author for correspondence (e-mail: [email protected]) Accepted 13 February 2001 Journal of Cell Science 114, 1847-1859 © The Company of Biologists Ltd SUMMARY HEMCAM/gicerin, an immunoglobulin superfamily fibronectin depended on the HEMCAM isoform expressed. protein, is involved in homophilic and heterophilic adhesion. Flow cytometry and immunoprecipitation studies revealed It interacts with NOF (neurite outgrowth factor), a molecule that the expression of HEMCAM downregulated expression of the laminin family. Alternative splicing leads to mRNAs of the laminin-binding integrins α3β1, α6β1 and α7β1, and coding for HEMCAM with a short (HEMCAM-s) or a long fibronectin receptor α5β1 from the cell surface. Semi- cytoplasmic tail (HEMCAM-l). To investigate the cellular quantitative PCR and northern blot experiments showed function of these two variants, we stably transfected murine that the expression of α6β1 integrin modified by HEMCAM fibroblasts with either form of HEMCAM. Expression of occurred at a translation or maturation level. Thus, our each isoform of this protein in L cells delayed proliferation data demonstrate that HEMCAM regulates fibroblast and modified their adhesion properties to purified adhesion by controlling β1 integrin expression. extracellular matrix proteins. Expression of either HEMCAM-s or HEMCAM-l inhibited integrin-dependent Movies available on-line: adhesion and spreading of fibroblasts to laminin 1, showing http://www.biologists.com/JCS/movies/jcs1886.html that this phenomenon did not depend on the cytoplasmic region. By contrast, L-cell adhesion and spreading to Key words: Adhesion, Migration, Integrin, HEMCAM, MCAM INTRODUCTION during development (Taira et al., 1994). Gicerin participates in the development of the retina, the cerebellum and the ear, and is Among adhesion receptors a subgroup of the immunoglobulin involved in the regeneration of different organs in the adult superfamily with a characteristic V-V-C2-C2-C2 Ig domain organism (Hayashi and Miki, 1985; Hayashi et al., 1987; structure has recently emerged. Three members of this family Kajikawa et al., 1997; Kato et al., 1992; Takaha et al., 1995; have been identified in humans: BCAM (or as a splice variant, Taniura et al., 1991; Tsukamoto et al., 1998; Tsukamoto et al., the Lutheran blood group antigen); ALCAM, the activated 1999). Gicerin binds to neurite outgrowth factor (NOF), a 700 leukocyte-cell adhesion molecule; and MCAM/CD146, a kDa extracellular matrix glycoprotein of the laminin family marker for human melanoma tumour progression (Campbell et (Taira et al., 1994; Tsukamoto et al., 1996; Tsukamoto et al., al., 1994; Rahuel et al., 1996; Parsons et al., 1995; Bowen et al., 1997), and promotes cell-cell adhesion of transfected cells. 1995; Shih, 1999; Johnson et al., 1996; Lehman et al., 1989). In These data suggest that HEMCAM exhibits both heterophilic chick, motile c-kit+ hemopoietic progenitor cells in the bone and homophilic adhesion activities (Taira et al., 1995; Taira et marrow express another member of this V-V-C2-C2-C2 al., 1994; Vainio et al., 1996). subgroup, HEMCAM (Vainio et al., 1996; Dunon et al., 1998; Among the three known human V-V-C2-C2-C2 Ig molecules, Dunon et al., 1999). Three HEMCAM mRNA splice variants the highest homology is observed between HEMCAM and have been identified (Vainio et al., 1996). One has a short MCAM/CD146 (39%) (Vainio et al., 1996). Although this cytoplasmic tail (HEMCAM-s), another has a long tail homology is relatively low for the extracellular portion of the (HEMCAM-l), whereas the third lacks transmembrane and molecule, the transmembrane and the cytoplasmic domains cytoplasmic regions. Both transmembrane forms are found on show 66% and 69% homology, respectively. MCAM/CD146, the cell surface (Taira et al., 1995) but they appear to be also named MUC18, A32, Mel-CAM and S-Endo-1 (Shih, expressed differentially in the developing nervous system (Taira 1999), was first identified as a human melanoma-associated et al., 1994; Takaha et al., 1995; Tsukamoto et al., 1996) and in antigen with gradually increasing expression as tumours acquire the immune system (Vainio et al., 1996). HEMCAM expression metastatic potential (Johnson et al., 1996; Luca et al., 1993; is observed on embryonic endothelial cells, myocytes and Schlagbauer-Wadl et al., 1999; Wang et al., 1996; Xie et al., epithelial cells of the bursa of Fabricius. HEMCAM is the same 1997). In contrast to ubiquitous expression on melanoma, molecule as gicerin, a molecule involved in neurite outgrowth MCAM expression is restricted to some types of carcinomas, 1848 JOURNAL OF CELL SCIENCE 114 (10) Fig. 1. Two cytoplasmic variants of MCAM/CD146 are expressed in mammals. (A) RT-PCR analysis of chicken muscle using a combination of two primers, depicting mRNA coding for the long or short HEMCAM cytoplasmic forms (15667-15668) (Vainio et al., 1996). The short form appears as the lower band at 90 bp and the long form at 210 bp. Analysis of the same region of MCAM was performed with mouse muscle and HUVEC. The combination of primers for the murine MCAM was MEMCAM-1-MEMCAM-2 (accession number EMBL: X74628). The expected band corresponding to the putative long form appears as the upper band at 567 bp. The combination of primers for the human MCAM was 11674- MEMCAM2 (Lehman et al., 1989; Sers et al., 1993), the expected long form appears as the upper band at B 703 bp. (B) Alignment of amino acid sequences of chicken HEMCAM, and human, murine and bovine Short cytoplasmic form MCAM cytoplasmic forms. Amino acid sequences of Protein PDZ Domain murine and human MCAM were deduced from the Kinase C interaction nucleotide sequences of the PCR bands obtained in transmembrane domain site site (A). Bovine MCAM sequence was obtained in the HEMCAM-s SESKGIIIVAIIVCILVVAVLGSIIYFLHKKGKISCGRSGKQDIARNTSI EMBL database (accession number: U89328) and mMCAM-s P----VV---V---TL-L----AAL--FY----LP-------EME----- HEMCAM from our published sequences (Vainio et al., 1996). The line indicates the putative hMCAM-s P--R-VV---V------L----AVL---Y----LP-R-----EME----- transmembrane domain. b, bovine; h, human; l, long; m, murine; s, short. Long cytoplasmic form Protein Protein Kinase C Kinase C endocytosis transmembrane domain site site signal HEMCAM-l SESKGIIIVAIIVCILVVAVLGSIIYFLHKKGKISCGRSGKQDITKPEARKDKNVVEVKSDKLSEEAGLLQGANGEKRSPADQSEKYIDLRN mMCAM-l P----VV---V---TL-L----AAL--FY----LP-------E--L-PT--SEF---------P--MA----S--D--A-G--G-------H hMCAM-l P--R-VV---V------L----AVL---Y----LP-R-----E--L-PS--NEL---------P--M-----S--D--A-G--G-------H bMCAM-1 --AVL--FY----LP-------E--L-PT--SEF---------P--M-----S--D--A-G--G-------H such as breast carcinoma, where it has been suggested to act as described previously (Yatohgo et al., 1988). c264 monoclonal a tumour suppressor (Shih et al., 1997a). Similar to HEMCAM, antibody (mAb) against HEMCAM has been previously described MCAM/CD146 mediates cell-cell adhesion both in a (Vainio et al., 1996) and was used for cytofluorimetric (ELITE ESP, homophilic manner and through association with another as yet Coulter) and immunoprecipitation assays. Cells were cultured in unidentified partner (Johnson et al., 1997; Shih et al., 1997b). Dulbecco’s Modified Eagle Medium (DMEM) with 10% fetal calf serum (FCS), 10 IU/ml penicillin and 100 µg/ml streptomycin (Life- Transfection of MCAM into melanoma cells reduces adhesion Technologies Inc., Gaithersburgh, MD). to laminin 1 and increases invasive migration through Matrigel- Antibodies against integrin subunits were as follows: rat mAb coated filters, although the molecular mechanism for this effect GoH3 and EA-1 anti-mouse α6 (Sonnenberg et al., 1987; Imhof et is not known (Xie et al., 1997). al., 1991; Ruiz et al., 1993), PS/2 anti-α4 (Miyake et al., 1991), RMV- In the present report, we show that HEMCAM is the avian 7 anti-αv (Takahashi et al., 1990), CY8 against α7 (Yao et al., 1996), homologue of MCAM/CD146. We investigated the effect of MFR5 against α5 (Pharmingen), 9EG7 against activated β1 integrins HEMCAM isoforms on cell adhesion, spreading, migration (Lenter et al., 1993), mouse mAb 7A3 anti-human α3 (de Melker et and proliferation on various extracellular matrix molecules al., 1997) and polyclonal antibodies (pAb) 363E against β1 including laminin 1 and fibronectin, using normal mouse cytoplasmic region (DeSimone and Hynes, 1988). FITC-conjugated fibroblasts transfected by HEMCAM isoforms. We goat-anti mouse IgG (Jackson, West Grove, PA), FITC-conjugated rabbit anti-rat IgG (Biosys, Compiègne, France), and biotinylated demonstrate that the adhesion of transfected cells to laminin 1 donkey anti-rabbit IgG (Amersham) were used as secondary is specifically reduced, and by comparing the expression antibodies. Biotin labelling was detected by streptavidine coupled to pattern of the laminin receptor integrins, we show that either FITC (Amersham) or HRP (Pierce Chemical Co.). HEMCAM actively downregulates the cell surface expression Transfection of L cells by pcDNA3 vector coding for each isoform of the β1 integrins. of HEMCAM has been described previously (Vainio et al., 1996). The sequence of the cytoplasmic part of truncated HEMCAM isoform (HEMCAM-t) is KKGKISCGRSSMHLEGPIL (HEMCAM MATERIALS AND METHODS cytoplasmic tail is truncated after the tenth amino acid, underlined sequence). Expression of HEMCAM isoforms was controlled by Adhesion proteins, antibodies and cell cultures western blot experiments (data not shown). All results were obtained Mouse laminin 1 (LN) and bovine fibronectin (FN) were purchased with cloned cell lines and some of them were confirmed with sorted from Sigma. Vitronectin (VN) was purified from bovine plasma as cell populations.
Load more

Recommended publications
  • Immunocytochemistry of CD146 Is Useful to Discriminate Between Malignant Pleural Mesothelioma and Reactive Mesothelium
    Modern Pathology (2010) 23, 1458–1466 1458 & 2010 USCAP, Inc. All rights reserved 0893-3952/10 $32.00 Immunocytochemistry of CD146 is useful to discriminate between malignant pleural mesothelioma and reactive mesothelium Ayuko Sato1, Ikuko Torii1, Yoshihiro Okamura1, Tadashi Yamamoto1, Takashi Nishigami1, Tatsuki R Kataoka1, Misa Song1, Seiki Hasegawa2, Takashi Nakano3, Toshiaki Kamei4 and Tohru Tsujimura1 1Department of Pathology, Hyogo College of Medicine, Hyogo, Japan; 2Department of General Thoracic Surgery, Hyogo College of Medicine, Hyogo, Japan; 3Division of Respiratory Medicine, Department of Internal Medicine, Hyogo College of Medicine, Hyogo, Japan and 4Division of Pathology, Yamaguchi Grand Medical Center, Yamaguchi, Japan Malignant pleural mesothelioma is a refractory tumor with poor prognosis associated with asbestos exposure. Pleural effusion is frequently observed in patients with malignant pleural mesothelioma, and cytological analysis is effective to detect malignant pleural mesothelioma. However, cytological discrimination between malignant pleural mesothelioma and reactive mesothelium is often difficult. Increased expression of CD146, a cell adhesion molecule, has been reported to be closely associated with an advanced stage of malignant melanoma, prostate cancer, and ovarian cancer. In this study, to evaluate the diagnostic utility of CD146 for discrimination between malignant pleural mesothelioma and reactive mesothelium, we examined immuno- cytochemical expression of CD146 in malignant pleural mesothelioma and reactive mesothelium using two clones of CD146 antibody, OJ79 and EPR3208, on smear specimens of effusion fluids. Immunocytochemical stains were semiquantitatively scored on the basis of immunostaining intensity (0, negative; 1, weak positive; 2, moderate positive; and 3, strong positive). CD146 expression was detected in 15 of 16 malignant pleural mesothelioma with median immunostaining score of 3 by OJ79, and in 19 of 21 malignant pleural mesothelioma with median immunostaining score of 2 by EPR3208.
    [Show full text]
  • Human and Mouse CD Marker Handbook Human and Mouse CD Marker Key Markers - Human Key Markers - Mouse
    Welcome to More Choice CD Marker Handbook For more information, please visit: Human bdbiosciences.com/eu/go/humancdmarkers Mouse bdbiosciences.com/eu/go/mousecdmarkers Human and Mouse CD Marker Handbook Human and Mouse CD Marker Key Markers - Human Key Markers - Mouse CD3 CD3 CD (cluster of differentiation) molecules are cell surface markers T Cell CD4 CD4 useful for the identification and characterization of leukocytes. The CD CD8 CD8 nomenclature was developed and is maintained through the HLDA (Human Leukocyte Differentiation Antigens) workshop started in 1982. CD45R/B220 CD19 CD19 The goal is to provide standardization of monoclonal antibodies to B Cell CD20 CD22 (B cell activation marker) human antigens across laboratories. To characterize or “workshop” the antibodies, multiple laboratories carry out blind analyses of antibodies. These results independently validate antibody specificity. CD11c CD11c Dendritic Cell CD123 CD123 While the CD nomenclature has been developed for use with human antigens, it is applied to corresponding mouse antigens as well as antigens from other species. However, the mouse and other species NK Cell CD56 CD335 (NKp46) antibodies are not tested by HLDA. Human CD markers were reviewed by the HLDA. New CD markers Stem Cell/ CD34 CD34 were established at the HLDA9 meeting held in Barcelona in 2010. For Precursor hematopoetic stem cell only hematopoetic stem cell only additional information and CD markers please visit www.hcdm.org. Macrophage/ CD14 CD11b/ Mac-1 Monocyte CD33 Ly-71 (F4/80) CD66b Granulocyte CD66b Gr-1/Ly6G Ly6C CD41 CD41 CD61 (Integrin b3) CD61 Platelet CD9 CD62 CD62P (activated platelets) CD235a CD235a Erythrocyte Ter-119 CD146 MECA-32 CD106 CD146 Endothelial Cell CD31 CD62E (activated endothelial cells) Epithelial Cell CD236 CD326 (EPCAM1) For Research Use Only.
    [Show full text]
  • Global Analysis Reveals the Complexity of the Human Glomerular Extracellular Matrix
    Global analysis reveals the complexity of the human glomerular extracellular matrix Rachel Lennon,1,2 Adam Byron,1,* Jonathan D. Humphries,1 Michael J. Randles,1,2 Alex Carisey,1 Stephanie Murphy,1,2 David Knight,3 Paul E. Brenchley,2 Roy Zent,4,5 and Martin J. Humphries.1 1Wellcome Trust Centre for Cell-Matrix Research, Faculty of Life Sciences, University of Manchester, Manchester, UK; 2Faculty of Medical and Human Sciences, University of Manchester, Manchester, UK; 3Biological Mass Spectrometry Core Facility, Faculty of Life Sciences, University of Manchester, Manchester, UK; 4Division of Nephrology, Department of Medicine, Vanderbilt University Medical Center, Nashville, TN, USA; and 5Veterans Affairs Hospital, Nashville, TN, USA. *Present address: Edinburgh Cancer Research UK Centre, Institute of Genetics and Molecular Medicine, University of Edinburgh, Edinburgh, UK. Running title: Proteome of the glomerular matrix Word count: Abstract: 208, main text 2765 Corresponding author: Dr Rachel Lennon, Wellcome Trust Centre for Cell-Matrix Research, Michael Smith Building, University of Manchester, Manchester M13 9PT, UK. Phone: 0044 (0) 161 2755498. Fax: 0044 (0) 161 2755082. Email: [email protected] Abstract The glomerulus contains unique cellular and extracellular matrix (ECM) components, which are required for intact barrier function. Studies of the cellular components have helped to build understanding of glomerular disease; however, the full composition and regulation of glomerular ECM remains poorly understood. Here, we employed mass spectrometry–based proteomics of enriched ECM extracts for a global analysis of human glomerular ECM in vivo and identified a tissue-specific proteome of 144 structural and regulatory ECM proteins. This catalogue includes all previously identified glomerular components, plus many new and abundant components.
    [Show full text]
  • Bruch's Membrane Abnormalities in PRDM5-Related Brittle Cornea
    Porter et al. Orphanet Journal of Rare Diseases (2015) 10:145 DOI 10.1186/s13023-015-0360-4 RESEARCH Open Access Bruch’s membrane abnormalities in PRDM5-related brittle cornea syndrome Louise F. Porter1,2,3, Roberto Gallego-Pinazo4, Catherine L. Keeling5, Martyna Kamieniorz5, Nicoletta Zoppi6, Marina Colombi6, Cecilia Giunta7, Richard Bonshek2,8, Forbes D. Manson1 and Graeme C. Black1,9* Abstract Background: Brittle cornea syndrome (BCS) is a rare, generalized connective tissue disorder associated with extreme corneal thinning and a high risk of corneal rupture. Recessive mutations in transcription factors ZNF469 and PRDM5 cause BCS. Both transcription factors are suggested to act on a common pathway regulating extracellular matrix genes, particularly fibrillar collagens. We identified bilateral myopic choroidal neovascularization as the presenting feature of BCS in a 26-year-old-woman carrying a novel PRDM5 mutation (p.Glu134*). We performed immunohistochemistry of anterior and posterior segment ocular tissues, as expression of PRDM5 in the eye has not been described, or the effects of PRDM5-associated disease on the retina, particularly the extracellular matrix composition of Bruch’smembrane. Methods: Immunohistochemistry using antibodies against PRDM5, collagens type I, III, and IV was performed on the eyes of two unaffected controls and two patients (both with Δ9-14 PRDM5). Expression of collagens, integrins, tenascin and fibronectin in skin fibroblasts of a BCS patient with a novel p.Glu134* PRDM5 mutation was assessed using immunofluorescence. Results: PRDM5 is expressed in the corneal epithelium and retina. We observe reduced expression of major components of Bruch’s membrane in the eyes of two BCS patients with a PRDM5 Δ9-14 mutation.
    [Show full text]
  • Integrin Adhesion Molecules in the Human Endometrium. Correlation with the Normal and Abnormal Menstrual Cycle
    Integrin adhesion molecules in the human endometrium. Correlation with the normal and abnormal menstrual cycle. B A Lessey, … , S M Albelda, C A Buck J Clin Invest. 1992;90(1):188-195. https://doi.org/10.1172/JCI115835. Research Article Integrins are a class of cell adhesion molecules that participate in cell-cell and cell-substratum interactions and are present on essentially all human cells. The distribution of nine different alpha and beta integrin subunits in human endometrial tissue at different stages of the menstrual cycle was determined using immunoperoxidase staining. Glandular epithelial cells expressed primarily alpha 2, alpha 3, and alpha 6 (collagen/laminin receptors), while stromal cells expressed predominantly alpha 5 (fibronectin receptor). The presence of alpha 1 on glandular epithelial cells was cycle specific, found only during the secretory phase. Expression of both subunits of the vitronectin receptor, alpha v beta 3, also underwent cycle specific changes on endometrial epithelial cells. Immunostaining for alpha v increased throughout the menstrual cycle, while the beta 3 subunit appeared abruptly on cycle day 20 on luminal as well as glandular epithelial cells. Discordant luteal phase biopsies (greater than or equal to 3 d "out of phase") from infertility patients exhibited delayed epithelial beta 3 immunostaining. These results demonstrate similarities, as well as specific differences, between endometrium and other epithelial tissues. Certain integrin moieties appear to be regulated within the cycling endometrium and disruption of integrin expression may be associated with decreased uterine receptivity and infertility. Find the latest version: https://jci.me/115835/pdf Integrin Adhesion Molecules in the Human Endometrium Correlation with the Normal and Abnormal Menstrual Cycle Bruce A.
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Integrins: Roles in Cancer Development and As Treatment Targets
    British Journal of Cancer (2004) 90, 561 – 565 & 2004 Cancer Research UK All rights reserved 0007 – 0920/04 $25.00 www.bjcancer.com Minireview Integrins: roles in cancer development and as treatment targets 1 ,1,2 H Jin and J Varner* 1John and Rebecca Moores Comprehensive Cancer Center, University of California, San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0912, USA; 2Department of Medicine, University of California, San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0912, USA The integrin family of cell adhesion proteins promotes the attachment and migration of cells on the surrounding extracellular matrix (ECM). Through signals transduced upon integrin ligation by ECM proteins or immunoglobulin superfamily molecules, this family of proteins plays key roles in regulating tumour growth and metastasis as well as tumour angiogenesis. Several integrins play key roles in promoting tumour angiogenesis and tumour metastasis. Antagonists of several integrins (a5b1, avb3 and avb5) are now under evaluation in clinical trials to determine their potential as therapeutics for cancer and other diseases. British Journal of Cancer (2004) 90, 561 – 565. doi:10.1038/sj.bjc.6601576 www.bjcancer.com & 2004 Cancer Research UK Keywords: angiogenesis; metastasis; apoptosis; integrin a5b1; integrin avb3 During the last 10 years, novel insights into the mechanisms sequences (e.g., integrin a4b1 recognises EILDV and REDV in that regulate cell survival as well as cell migration and invasion alternatively spliced CS-1 fibronectin). Inhibitors of integrin have led to the development of novel integrin-based therapeutics function include function-blocking monoclonal antibodies, pep- for the treatment of cancer. Several integrins play important tide antagonists and small molecule peptide mimetics matrix roles in promoting cell proliferation, migration and survival (reviewed in Hynes, 1992; Cheresh, 1993).
    [Show full text]
  • The Dynamic Interaction Between Extracellular Matrix Remodeling and Breast Tumor Progression
    cells Review The Dynamic Interaction between Extracellular Matrix Remodeling and Breast Tumor Progression Jorge Martinez 1,* and Patricio C. Smith 2,* 1 Cell Biology Laboratory, INTA, University of Chile, Santiago 7810000, Chile 2 School of Dentistry, Faculty of Medicine, Pontificia Universidad Católica de Chile, Santiago 8330024, Chile * Correspondence: [email protected] (J.M.); [email protected] (P.C.S.); Tel.: + 56-2-2987-1419 (J.M.); +56-2-2354-8400 (P.C.S.) Abstract: Desmoplastic tumors correspond to a unique tissue structure characterized by the abnormal deposition of extracellular matrix. Breast tumors are a typical example of this type of lesion, a property that allows its palpation and early detection. Fibrillar type I collagen is a major component of tumor desmoplasia and its accumulation is causally linked to tumor cell survival and metastasis. For many years, the desmoplastic phenomenon was considered to be a reaction and response of the host tissue against tumor cells and, accordingly, designated as “desmoplastic reaction”. This notion has been challenged in the last decades when desmoplastic tissue was detected in breast tissue in the absence of tumor. This finding suggests that desmoplasia is a preexisting condition that stimulates the development of a malignant phenotype. With this perspective, in the present review, we analyze the role of extracellular matrix remodeling in the development of the desmoplastic response. Importantly, during the discussion, we also analyze the impact of obesity and cell metabolism as critical drivers of tissue remodeling during the development of desmoplasia. New knowledge derived from the dynamic remodeling of the extracellular matrix may lead to novel targets of interest for early diagnosis or therapy in the context of breast tumors.
    [Show full text]
  • Blood Vitronectin Is a Major Activator of LIF and IL-6 in the Brain Through Integrin–FAK and Upar Signaling Matthew P
    © 2018. Published by The Company of Biologists Ltd | Journal of Cell Science (2018) 131, jcs202580. doi:10.1242/jcs.202580 RESEARCH ARTICLE Blood vitronectin is a major activator of LIF and IL-6 in the brain through integrin–FAK and uPAR signaling Matthew P. Keasey1, Cuihong Jia1, Lylyan F. Pimentel1,2, Richard R. Sante1, Chiharu Lovins1 and Theo Hagg1,* ABSTRACT Microglia and astrocytes express the VTN receptors αvβ3 and α β We defined how blood-derived vitronectin (VTN) rapidly and potently v 5 integrin (Herrera-Molina et al., 2012; Kang et al., 2008; activates leukemia inhibitory factor (LIF) and pro-inflammatory Milner, 2009; Welser-Alves et al., 2011). Microglia and astrocytes, interleukin 6 (IL-6) in vitro and after vascular injury in the brain. as well as endothelial cells, are major producers of pro- α in vitro Treatment with VTN (but not fibrinogen, fibronectin, laminin-111 or inflammatory cytokines, such as IL-6 and TNF , and collagen-I) substantially increased LIF and IL-6 within 4 h in after traumatic or ischemic injury to the brain (Banner et al., 1997; C6-astroglioma cells, while VTN−/− mouse plasma was less effective Erta et al., 2012; Lau and Yu, 2001) or upon self-induction by IL-6 than that from wild-type mice. LIF and IL-6 were induced by (Van Wagoner and Benveniste, 1999). IL-6 is a major regulator of a intracerebral injection of recombinant human (rh)VTN in mice, but variety of inflammatory disorders and a target for therapies (Hunter induction seen upon intracerebral hemorrhage was less in VTN−/− and Jones, 2015).
    [Show full text]
  • Targeting Endothelial CD146 Attenuates Neuroinflammation By
    Targeting endothelial CD146 attenuates neuroinflammation by limiting SUBJECT AREAS: BLOOD-BRAIN BARRIER lymphocyte extravasation to the CNS MULTIPLE SCLEROSIS Hongxia Duan1,2*, Shu Xing1,2*, Yongting Luo1*, Liqun Feng3, Irene Gramaglia4, Ying Zhang1,DiLu1, NEUROIMMUNOLOGY Qiqun Zeng1, Kelong Fan1,2, Jing Feng1, Dongling Yang1, Zhihai Qin1, Pierre-Olivier Couraud5, AUTOIMMUNITY Ignacio A. Romero6, Babette Weksler7 & Xiyun Yan1 Received 1Key Laboratory of Protein and Peptide Pharmaceuticals, CAS-University of Tokyo Joint Laboratory of Structural Virology and 14 March 2013 Immunology, Institute of Biophysics, Chinese Academy of Sciences, 15 Datun Road, Beijing 100101, China, 2University of Chinese Academy of Sciences, 19A Yuquan Road, Beijing 100049, China, 3Beijing Anzhen Hospital of the Capital University of Medical Accepted 4 3 April 2013 Sciences, 2 Anzhen Road, Beijing 100029, China, La Jolla Infectious Disease Institute, 6044 Cornerstone Court, Suite A2, San Diego, CA 92121, 5Institut Cochin, Centre National de la Recherche Scientifique UMR 8104, Institut National de la Sante´ et de la Published Recherche Me´dicale (INSERM) U567, Universite´ Rene´ Descartes, Paris, France, 6Department of Life Sciences, The Open University, 7 18 April 2013 Walton Hall, Milton Keynes, MK7 6AA, UK, Weill Cornell Medical College, New York, NY 10065 USA. The ability to selectively block the entry of leukocytes into the central nervous system (CNS) without Correspondence and compromisingtheimmunesystemisanattractivetherapeuticapproachfortreatingmultiplesclerosis(MS). requests for materials Using endothelial CD146-deficienct mice as a MS model, we found that endothelial CD146 plays an active role 1 should be addressed to in the CNS-directed extravasation of encephalitogenic T cells, including CD146 TH1andTH17 lymphocytes. Moreover, treating both active and passive MS models with the anti-CD146 antibody AA98 significantly X.Y.Y.
    [Show full text]
  • Alternative Splicing in Endothelial Cells: Novel Therapeutic Opportunities In
    Di Matteo et al. Journal of Experimental & Clinical Cancer Research (2020) 39:275 https://doi.org/10.1186/s13046-020-01753-1 REVIEW Open Access Alternative splicing in endothelial cells: novel therapeutic opportunities in cancer angiogenesis Anna Di Matteo1†, Elisa Belloni1†, Davide Pradella1†, Ambra Cappelletto2†, Nina Volf2†, Serena Zacchigna2,3*† and Claudia Ghigna1*† Abstract Alternative splicing (AS) is a pervasive molecular process generating multiple protein isoforms, from a single gene. It plays fundamental roles during development, differentiation and maintenance of tissue homeostasis, while aberrant AS is considered a hallmark of multiple diseases, including cancer. Cancer-restricted AS isoforms represent either predictive biomarkers for diagnosis/prognosis or targets for anti-cancer therapies. Here, we discuss the contribution of AS regulation in cancer angiogenesis, a complex process supporting disease development and progression. We consider AS programs acting in a specific and non-redundant manner to influence morphological and functional changes involved in cancer angiogenesis. In particular, we describe relevant AS variants or splicing regulators controlling either secreted or membrane-bound angiogenic factors, which may represent attractive targets for therapeutic interventions in human cancer. Keywords: Alternative splicing; RNA binding proteins, Endothelial cells, Angiogenesis, Vascular biology, Anti- angiogenic therapy Background sustained viability of dog thyroid glands ex vivo. To prove Introduction: from the theory of angiogenesis to an tissue viability, he implanted mouse tumor cells into dog orchestra of alternatively spliced angiogenic genes glands and observed that the neoplastic mass stopped In the 1970s Judah Folkman revolutionized the field of growing after having reached a modest size, but grew rap- angiogenesis with his radical idea that tumor growth could idly again if transplanted back into a living mouse.
    [Show full text]
  • CD146 Acts As a Novel Receptor for Netrin-1 in Promoting Angiogenesis and Vascular Development
    Cell Research (2015) 25:275-287. npg © 2015 IBCB, SIBS, CAS All rights reserved 1001-0602/15 ORIGINAL ARTICLE www.nature.com/cr CD146 acts as a novel receptor for netrin-1 in promoting angiogenesis and vascular development Tao Tu1, Chunxia Zhang2, Huiwen Yan1, Yongting Luo1, Ruirui Kong3, Pushuai Wen3, Zhongde Ye1, Jianan Chen1, Jing Feng1, Feng Liu2, Jane Y Wu3, 4, Xiyun Yan1 1Key Laboratory of Protein and Peptide Pharmaceuticals, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, China; 2State Key Laboratory of Biomembrane and Membrane Biotechnology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100101, China; 3State Key Laboratory of Brain and Cognitive Science, Institute of Biophysics, Chinese Academy of Scienc- es, Beijing 100101, China; 4Department of Neurology, Center for Genetic Medicine, Lurie Cancer Center, Northwestern University Feinberg School of Medicine, Chicago, IL 60611, USA Angiogenesis, a process that newly-formed blood vessels sprout from pre-existing ones, is vital for vertebrate de- velopment and adult homeostasis. Previous studies have demonstrated that the neuronal guidance molecule netrin-1 participates in angiogenesis and morphogenesis of the vascular system. Netrin-1 exhibits dual activities in angio- genesis: either promoting or inhibiting angiogenesis. The anti-angiogenic activity of netrin-1 is mediated by UNC5B receptor. However, how netrin-1 promotes angiogenesis remained unclear. Here we report that CD146, an endothelial transmembrane protein of the immunoglobulin superfamily, is a receptor for netrin-1. Netrin-1 binds to CD146 with high affinity, inducing endothelial cell activation and downstream signaling in a CD146-dependent manner. Condi- tional knockout of the cd146 gene in the murine endothelium or disruption of netrin-CD146 interaction by a specific anti-CD146 antibody blocks or reduces netrin-1-induced angiogenesis.
    [Show full text]