DOCSLIB.ORG

The Ndi Igbo Question in Nigerian Politics Is Real. It Is for the Igbo Leaders to Handle

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Ndi Igbo Question in Nigerian Politics Is Real. It Is for the Igbo Leaders to Handle THE NDI IGBO QUESTION IN NIGERIAN POLITICS IS REAL Page 1 of 7 THE NDI IGBO QUESTION IN NIGERIAN POLITICS IS REAL. IT IS FOR THE IGBO LEADERS TO HANDLE By Prof. Omo Omoruyi,mni ADVANCING DEMOCRACY in AFRICA (ADA) Former Director General, Centre for Democratic Studies (CDS) (Abuja) 1989-93 I HAVE NO REASON TO BE ANTI-IGBO IN 2003 ELECTION My last essay published in the Guardian of February 24, 2003 classifying the Presidential candidates in the 2003 election into four categories generated some comments from fellow Nigerians from the southeast. Instead of the commentators addressing the deep-seated uncertainty within the Igbo ethnic nationality that I chose in my earlier essay to call the "The Igbo Question in Nigerian Politics", they quickly found another Igbo hater. I am not an Igbo hater; I have no reason to hate the Igbo. Since I got involved in politics, I have always sympathized with the Igbo and their plight in Nigerian politics. Here was a majority ethnic nationality and one vital leg in the traditional tripod before 1966 that is today since 1970 reduced to the status of a minority by the other two legs in the tripod. Omo Omoruyi or his ethnic nationality did not contribute to the loss of status or political impotence of the Igbo in Nigerian politics. The solution lies in the Igbo leadership and not on others. COMMENTATORS ARE UNFAIR TO ME The comment by Comrade Edwin Madunagu is misplaced. His appeal to and rehash of the classical philosophers is downright poppycock and maybe pedantic at best. I read it twice and I came to the conclusion that it is unrelated to the issues I was dealing with. Quite frankly with the greatest respect to Comrade Edwin, does he really believe that these political parties and the candidates that are running round their local government areas and not in the country in their names are serious? Comrade, give me a break! Haba! Some of them went into this game thinking that Government would share money among the political parties as it did in the past. The comments by Daniel Obi Dozie and Prince Jimmy Asiegbe fail to see the point I was making. Both ignore the import of the essay and instead accuse me of harboring an anti-Igbo feeling, especially with the way I handled the Dim Ojukwu in the essay. This is arrant nonsense. THE "UNWRITTEN QUALIFICATIONS" GUIDED ME Maybe I should deal with some issues about the three Igbo candidates that I put in the category of those with personal or http://www.nigerdeltacongress.com/narticles/ndi_igbo_question_in_nigerian_po.htm 7/21/2008 THE NDI IGBO QUESTION IN NIGERIAN POLITICS IS REAL Page 2 of 7 ethnic agenda in furtherance of the Stalemate Strategy. I am referring to General Ike Nwachukwu, Chief Jim Nwobodo and Dim Emeka Ojukwu. I have nothing against these illustrious Nigerians who have all the qualifications in the Constitution and in the written laws for the office of President, Commander in Chief of the Armed Forces of the Federal Republic of Nigeria. Maybe I should call the attention of the commentators to the fact that one does not become the President in Nigeria through the democratic process or through the coup by invoking the formal qualifications. I know Chief Jim Nwobodo and General Ike Nwachukwu as realists. They know that there are "unwritten qualifications" for the office of the President that they do not meet in 2003. Maybe Dim Ojukwu is putting himself in the category of former Heads of State such Generals Gowon, Obasanjo, Buhari, Babangida and Abubakar. After all General Gowon wanted to be the nominee of the National Republican Convention (NRC) in 1993. Where was he when Chief Obasanjo was approached to be the nominee of the Peoples Democratic Party (PDP) in 1999? Those who want to have some idea of these unwritten qualifications should read my book, The Tale of June 12. On the status of these candidates and their mission in the race, the Governor of Abia State clarified the position already that the "Igbo Presidency Project" died with the defeat of Dr. Alex Ekwueme at the PDP national convention. May I add that the "Igbo Presidency Project" was buried when the Ohaneze N’Igbo could not get the Southeast to agree to the idea of one Igbo candidate in 2003. All the resignations involving General Ike Nwachukwu and Chief Jim Nwobodo from the PDP and their emergence within 24 hours as presidential candidates in other political parties made no difference to the point made by Governor Kalu of Abia. The nomination of Dim Emeka Ojukwu as the Presidential candidate of APGA had problems of its own that I would not like to go into here. OJUKWU HAS A PLACE IN NIGERIAN HISTORY All the Igbo commentators unnecessarily focused on Dim Ojukwu and what he represented in the past. Again I am not going to comment on this. Nigerians have their views on the role of Dim Ojukwu in the past, distant and immediate past. Dim Ojukwu’s place in Nigerian history is well known to all Nigerians. But his place as a partisan politician is also well known. I’d recall two incidents for the interest of those commented on what I said. First, I recall what happened to Dim Ojukwu with his Ikemba Front as a partisan politician in Anambra when he tried to use his place in history to get votes from Igbo people in 1983. Sometimes we forget that a Senatorial District around his home of Nnewi rejected him in 1983, despite the political thugs in the name of "Ikemba Front" he unleashed on his opponent and a friend and compatriot, Dr. Edwin Onwudiwe. Second, I also recall what happened to him as "a tax-payer" and as a partisan politician when he tried to seek clearance from FEDECO in 1992 to contest the presidential primaries of the Social Democratic Party (SDP). Professor Humphrey Nwosu is still alive who was the Chairman of the FEDECO that rejected him in 1992 because he was found wanting as a taxpayer. http://www.nigerdeltacongress.com/narticles/ndi_igbo_question_in_nigerian_po.htm 7/21/2008 THE NDI IGBO QUESTION IN NIGERIAN POLITICS IS REAL Page 3 of 7 I CONTRIBUTED TO GETTING THE IGBO BACK ON ITS FEET POLITICALLY What bothers me is the scanty knowledge of these commentators of the history of how the Igbo fought their way back into the political mainstream after the Civil War and those who were involved in the process. It was not Chief Jim Nwobodo; it was not General Ike Nwachukwu and certainly it was not Dim Ojukwu. They would have to write their roles for the Igbo people to understand. Let me cite two incidents. One, if these new defenders of Igbo cause would do some research, they would acknowledge the role that I, Omo Omoruyi played in the past to work for the reentry of the Igbo into the political mainstream in 1978. Two, those who are enjoying the increase in the number of States in Igboland since 1990, fail to appreciate and acknowledge the part that I, Omo Omoruyi played with the late Diokpa, Dr. Pius Okigbo to give the Ndi Igbo more "political homes". I am referring to the creation of more states in Nigeria under President Ibrahim Badamasi Babangida. CLASSIFICATION OF CANDIDATES IS BASED ON CERTAIN FACTS The attackers of Omo Omoruyi may not like my classification of the Nigerian presidential candidates into four categories. That is the way I see the candidates. Is it not my right to hold the view I held? I still hold the view that only two candidates (Chief Olusegun and General Buhari) are worth considering by my people of Edo State. My decision to embark on the classification of the Presidential candidates has nothing sinister to it. It is not meant to undermine the political status of the Igbo candidates. The candidates would not dispute the fact they are not serious contenders for the high office like Obasanjo and Buhari. It is the freedom of others to take exception to my characterization of Dim Emeka Ojukwu as the leader of those who have no national following but in the race to pursue what I called the "Stalemate Strategy" in 2003. Maybe I should pose two questions to them. One, do they want me to use Dim Ojukwu’s expressions as soon as he became the candidate of APGA to buttress my point? His speech at the Aba launching of his campaign is for Nigerians to analyze. Two, do they want me to use the advocacy of others who want an anti-Obasanjo coalition in the style of the anti-Moi in Kenya? Its all over there. I will not do either. I am tired of being called anti-Igbo; anyone who dares to call their attention to the error in their assumption is easily labeled anti-Igbo. They fail to appreciate that the problem with the Igbo since the Civil War is the http://www.nigerdeltacongress.com/narticles/ndi_igbo_question_in_nigerian_po.htm 7/21/2008 THE NDI IGBO QUESTION IN NIGERIAN POLITICS IS REAL Page 4 of 7 inability of the Igbo leaders to come up with an Agenda of reentry into the political mainstream of Nigeria. MEMORY LANE Maybe I should remind my Igbo detractors that I was a witness to how the Igbo leaders failed in 1977 to address the "Igbo Question in Nigerian Politics" during the politics of transition. I still recall how and when the Igbo members from Imo and Anambra States came to the Constituent Assembly. This was the first time Nigerians from all ethnic nationalities were meeting after the Civil War to address the post military political order.
Load more

Recommended publications
  • The Future of the Nation-State Project in Africa: the Case of Nigeria
    3 The Future of the Nation-State Project in Africa: The Case of Nigeria Nduba Echezona As the Cold War cycle played itself out, some of the multinational nation-states which had been taken for granted such as the former Soviet Union, Czechoslovakia and Yugoslavia suddenly dissolved. Their splitting pointed towards a direction which had hitherto been a trend in world politics, namely that the nation’s territory had to be synonymous with the territory of the state, the nation being made up of people with shared cultures and myths of blood ties. This direction in Europe might have set a worldwide pace. Africa has shown very little sign of complying with it. Africa entered the post-Cold War era with seemingly high prospects of terri- torial disintegration. This was exemplified by many civil wars in recent years, some with genocidal features. But, except for Eritrea and, to a lesser extent Somaliland, the political map of Africa’s states and borders has remained remarkably unchanged. Wars in Liberia, Sierra Leone, Rwanda, Burundi and the Democratic Republic of Congo have not caused these states to split. Nonetheless, wars have led to spatial recompositions, to emerging spaces of sovereignty within state territories and to renewed challenges to the official geography from above — the latter being defined by: the various corporations that have or have had the political or technocratic vocation of establishing, defending or modifying foreign or internal (administrative) borders of established states and organizing their geographical space (regular armies, diplomatic corps, colonial or contemporary administrators) (Ben Arrous 1996:17). 3.Chap.3_2.pmd 79 10/06/2009, 11:10 80 African Studies in Geography from Below In Nigeria, the colonial and postcolonial efforts to construct a nation-state from above rather than from below produced an ‘uncertain’ Nigerian; somebody with equivocal national feelings and many other allegiances.
    [Show full text]
  • Legislative Control of the Executive in Nigeria Under the Second Republic
    04, 03 01 AWO 593~ By AWOTOKUN, ADEKUNLE MESHACK B.A. (HONS) (ABU) M.Sc. (!BADAN) Thesis submitted to the Department of Public Administration Faculty of Administration in Partial fulfilment of the requirements for the degree of --~~·---------.---·-.......... , Progrnmme c:~ Petites Subventions ARRIVEE - · Enregistré sous lo no l ~ 1 ()ate :. Il fi&~t. JWi~ DOCTOR OF PHILOSOPHY (PUBLIC ADMIJISTRATION) Obafemi Awolowo University, CE\/ 1993 1le-Ife, Nigeria. 2 3 r • CODESRIA-LIBRARY 1991. CERTIFICATION 1 hereby certify that this thesis was prepared by AWOTOKUN, ADEKUNLE MESHACK under my supervision. __ _I }J /J1,, --- Date CODESRIA-LIBRARY ACKNOWLEDGEMENTS A work such as this could not have been completed without the support of numerous individuals and institutions. 1 therefore wish to place on record my indebtedness to them. First, 1 owe Professer Ladipo Adamolekun a debt of gratitude, as the persan who encouraged me to work on Legislative contrai of the Executive. He agreed to supervise the preparation of the thesis and he did until he retired from the University. Professor Adamolekun's wealth of academic experience ·has no doubt sharpened my outlciok and served as a source of inspiration to me. 1 am also very grateful to Professor Dele Olowu (the Acting Head of Department) under whose intellectual guidance I developed part of the proposai which culminated ·in the final production qf .this work. My pupilage under him i though short was memorable and inspiring. He has also gone through the entire draft and his comments and criticisms, no doubt have improved the quality of the thesis. Perhaps more than anyone else, the Almighty God has used my indefatigable superviser Dr.
    [Show full text]
  • Regressive Democracy: the Monstrous Role of Godfatherism in Nigeria
    International Journal of Politics and Good Governance Volume VI, No. 6.2 Quarter II 2015 ISSN: 0976 – 1195 REGRESSIVE DEMOCRACY: THE MONSTROUS ROLE OF GODFATHERISM IN NIGERIA Francis Osadebamwen Osayi University of Benin, Benin City, Nigeria ABSTARCT Godfatherism has become an attribute of modern day Nigeria democracy. With the gradual institutionalization of democracy, godfatherism has taken its toll in the politics of the country, thereby causing disaffection, disharmony, disunity and conflict among various political and interest groups. Its lethargic impact has further heightened political passivism and aparthism, thus retarding Nigeria’s democratic process. Apart from being a game of power play and rivalry, it often engenders political acrimony which tends to divest the people of democratic dividends. Consequently, such features as stagnated development, wanton destruction of lives and property becomes predominant. Nigeria has consistently been rated as one of the most corrupt nations on earth. This corrupt tendency propelled by greed has resulted in Nigerians seeing government as a vehicle for primitive accumulation and self aggrandizement. With these attendant problems associated with politics of godfatherism, Nigeria’s socio-economic structure tends to encourage it. However, the third and fourth dispensations (2007-2014) of this fourth republic have witnessed tremendous change in role from ‘do or die’ style of godfatherism to that of intra party politics. It is this change pattern that necessitated this study. Key Words: Democracy, Godfatherism, Paternalism, Political Conflict, Personal Interest, Clientelism Introduction It is an undeniable fact in Nigeria history that godfatherism has been a major setback in the country’s democratic experience. The drawbacks, political passivism and aparthism witnessed across Nigeria today are traceable largely to the activities of godfatherism in the 1 International Journal of Politics and Good Governance Volume VI, No.
    [Show full text]
  • Federal Republic of Nigeria - Official Gazette
    Federal Republic of Nigeria - Official Gazette No. 47 Lagos ~ 29th September, 1977 Vol. 64 CONTENTS Page Page Movements of Officers ” ; 1444-55 “Asaba Inland Postal Agency—Opening of .. 1471 Loss of Local Purchase Orders oe .« 1471 Ministry of Defence—Nigerian Army— Commissions . 1455-61 Loss of Treasury Receipt Book ‘6 1471 Ministry of Defence—Nigerian Army— Loss of Cheque . 1471 Compulsory Retirement... 1462 Ministry of Education—Examination in Trade Dispute between Marine’ Drilling , Law, Civil Service Rules, Financial Regu- and Constructions Workers’ Union of lations, Police Orders and Instructions Nigeria and Zapata Marine Service and. Ppractical Palice Work-——December (Nigeria) Limited .e .. 1462. 1977 Series +. 1471-72 -Trade Dispute between Marine Drilling Oyo State of Nigeria Public Service and Construction Workers? Unions of Competition for Entry into the Admini- Nigeria and Transworld Drilling Com-- strative and Special Departmental Cadres pay (Nigeria) Limited . 1462-63 in 1978 , . 1472-73 Constituent Assembly—Elected Candi. Vacancies .- 1473-74 ; dates ~ -» ° 1463-69 Customs and Excise—Dieposal of Un- . Land required for the Service of the _ Claimed Goods at Koko Port o. 1474 Federal Military Government 1469-70 Termination of Oil Prospecting Licences 1470 InpEx To LecaL Notice in SupPLEMENT Royalty on Thorium and Zircon Ores . (1470 Provisional Royalty on Tantalite .. -- 1470 L.N. No. Short Title Page Provisional Royalty on Columbite 1470 53 Currency Offences Tribunal (Proce- Nkpat Enin Postal Agency--Opening of 1471 dure) (Amendment) Rules 1977... B241 1444 - OFFICIAL GAZETTE No. 47, Vol. 64 Government Notice No. 1235 NEW APPOINTMENTS AND OTHER STAFF CHANGES - The following are notified for general information _ NEW APPOINTMENTS Department ”Name ” Appointment- Date of Appointment Customs and Excise A j ~Clerical Assistant 1-2~73 ‘ ‘Adewoyin,f OfficerofCustoms and Excise 25-8-75 Akan: Cleri .
    [Show full text]
  • Issue Papers, Extended Responses and Country Fact Sheets File:///C:/Documents and Settings/Brendelt/Desktop/Temp Rir/Country Fact
    Issue Papers, Extended Responses and Country Fact Sheets file:///C:/Documents and Settings/brendelt/Desktop/temp rir/Country Fact... Français Home Contact Us Help Search canada.gc.ca Issue Papers, Extended Responses and Country Fact Sheets Home Country Fact Sheet NIGERIA August 2007 Disclaimer This document was prepared by the Research Directorate of the Immigration and Refugee Board of Canada on the basis of publicly available information, analysis and comment. All sources are cited. This document is not, and does not purport to be, either exhaustive with regard to conditions in the country surveyed or conclusive as to the merit of any particular claim to refugee status or asylum. For further information on current developments, please contact the Research Directorate. Table of Contents 1. GENERAL INFORMATION 2. POLITICAL BACKGROUND 3. POLITICAL PARTIES 4. ARMED GROUPS AND OTHER NON-STATE ACTORS ENDNOTES REFERENCES 1. GENERAL INFORMATION Official name The Federal Republic of Nigeria. Geography Nigeria is located in Western Africa . Bordering the Gulf of Guinea, its neighbouring countries are Cameroon to the east and southeast, Benin to the west, Niger to the north, and Chad to the northeast. The Niger, West Africa's largest river, passes through Nigeria and empties into the Gulf of Guinea. Nigeria has a total area of 923,768 km². The country's topography is diverse with swampy coastlands 1 of 18 9/17/2013 9:03 AM Issue Papers, Extended Responses and Country Fact Sheets file:///C:/Documents and Settings/brendelt/Desktop/temp rir/Country Fact... and tropical forests in the south, hills and plateaus in the centre, grassy plains and semi-desert in the north, and mountains in the east.
    [Show full text]
  • Page 1 of 27 Nigeria and the Politics of Unreason 7/21/2008
    Nigeria and the Politics of Unreason Page 1 of 27 Nigeria and the Politics of Unreason: Political Assassinations, Decampments, Moneybags, and Public Protests By Victor E. Dike Introduction The problems facing Nigeria emanate from many fronts, which include irrational behavior (actions) of the political elite, politics of division, and politics devoid of political ideology. Others factors are corruption and poverty, lack of distributive justice, regional, and religious cleavages. All these combine to create crises (riots and conflicts) in the polity, culminating in public desperation and insecurity, politics of assassinations, decampments (carpet crossing), moneybags, and public protests. All this reached its climax during the 2003 elections. When the nation thinks it is shifting away from these forces, they would somersault and clash again creating another political thunderstorm. It looks that the society would hardly outgrow ‘the politics of unreason’ (Lipset and Raab, 1970), which is often politics of extremism, because the political class is always going beyond the limits of what are reasonable to secure or retain political power. During the 2003 elections moneybags (instead of political ideology) directed political actions in political parties; and it also influenced the activities of many politicians. As a result, the presidential candidates of the two major political parties (PDP and ANPP) cliched their party tickets by stuffing the car boots, so to say, of their party delegates with Ghana-Must- Go bags. This frustrated and intimidated their political opponents within (and those in the other minor political parties). Since after his defeat by Chief Olusegun Obasanjo in the 2003 PDP primary in Abuja, Dr.
    [Show full text]
  • Global Journal of Human Social Science
    Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS The Politics of Labeling An Appraisal of Voters National Election of Ethiopia Implications on Nigeria Democracy VOLUME 17 ISSUE 1 VERSION 1.0 Global Journal of Human-Social Science: F Political Science Global Journal of Human-Social Science: F Political Science Volume 17 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society Social Sciences. 2017. Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO ® 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG 945th Concord Streets, XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO Framingham Massachusetts Pin: 01701, 6FLHQFHV´ 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free Fax: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ G lobal Journals Incorporated SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG
    [Show full text]
  • Voting Pattern in Imo State Governorship Election: a Study of 2011 Election
    Global Advanced Research Journal of History, Political Science and International Relations ISSN: 2315-506X Vol. 3(2) pp. 017-029 , April, 2014 Available online http://garj.org/garjhpsir/index.htm Copyright © 2014 Global Advanced Research Journals Review Voting pattern in Imo State governorship election: a study of 2011 election Oji R.O. Phd 1, Okeke Vincent Onyekwelu Sunday Phd 2* and Agata. F.I. 2 1Department of Political Science, Faculty of Social Sciences, Enugu State University of Science And Technology, Nigeria 2Department of Political Science, Faculty of Social Sciences, Anambra State University, Igbariam, Anambra State, Nigeria Accepted 21 April, 2014 With the April 2011 general elections, Nigeria may have taken steps towards reversing the degeneration of its previous elections, but the work is not finished. Despite some progress, early and intensive preparations for the 2015 elections need to start now.There is no doubt that election is the process of selecting leaders through voting. Voting is a critical variable in the electoral process. Therefore, the voting patterns in any ideal election should follow the direction or pattern which will see the popular candidates for election emerging winners and helping to solve the socio-economic and political problem in Nigeria. This is because, at the heart of the problem with Nigeria today is leadership. There is no free and fair election that will usher in credible leaders who has the interest of their people at heart. The course of character and behaviour modification is critical in Nigeria and should be championed. Orientation and re-orientation of the electorate on the values of election through process of political socialization based on our indigenous values should have a prime of place in our electoral system.
    [Show full text]
  • Governance and Insecurity in South East Nigeria.Pmd
    GOVERNANCE AND INSECURITYYY IN SOUTH EAST NIGERIA Edited by: Ukoha Ukiwo and Innocent Chukwuma CLEEN Foundation First published in 2012 by: CLEEN Foundation Lagos Office: 21, Akinsanya Street Taiwo Bus-Stop Ojodu Ikeja, 100281 Ikeja, Lagos, Nigeria Tel: 234-1-7612479, 7395498 Abuja Office: 26, Bamenda Street, off Abidjan Street Wuse Zone 3, Abuja, Nigeria Tel: 234-9-7817025, 8708379 Owerri Office: Plot 10, Area M Road 3 World Bank Housing Estate Owerri, Imo State Tel: 083-823104, 08128002962, 08130278469 E-mail: [email protected] Website: www.cleen.org ISBN: 978-978-51062-2-0 © Whole or part of this publication may be republished, stored in a retrieval system or transmitted through electronic, photocopying, mechanical, recording or otheriwe, with proper acknowledgement of the publishers. Typesetting: Blessing Aniche-Nwokolo Cover concept: Gabriel Akinremi The mission of CLEEN Foundation is to promote public safety, security and accessible justice through empirical research, legislative advocacy, demonstration programmes and publications, in partnership with government and civil society. Table of Content List of tables v Acknowledgement vi Preface viii Chapters: 1. Framework for Improving Security and Governance in the Southeast by Ukoha Ukiwo 1 2. Governance and Security in Abia State by Ukoha Ukiwo and Magdalene O Emole 24 3. Governance and Security in Anambra State by Chijoke K. Iwuamadi 58 4. Governance and Security in Ebonyi State by Smart E. Otu 83 5. Governance and Security in Enugu State by Nkwachukwu Orji 114 6. Governance and Security
    [Show full text]
  • UNITED NATIONS REFORMS in This Issue: a Colloquium at NIIA
    niianews Newsletter of the Nigerian Institute of International Affairs Volume 1 No. 3 July - September, 2005 UNITED NATIONS REFORMS In this issue: A Colloquium at NIIA Security, Poverty, Infectious Diseases, - The UN Reforms: A Colloquium (HIV/AIDS), Environmental at NIIA Degradation, Conflict between and within states; Nuclear, Radiological, - Presentations at the Chemical and Biological Weapons, Terrorism, Transnational Organized Colloquium Crime, Use of Force, Peace - Reform of the Security Council Enforcement, Peace-Keeping, Post- Conflict Peace-Building and Protection - Why Nigeria deserves a of Civilians. Permanent Seat in the UN In addition, the Report has a section on how to have a more effective UN for Security Council the twenty-first century. This aspect - Exhibition covers reform proposals on all the Chief Olusegun Obasanjo, GCFR, organs of the UN and its charter. All - Founders' Day President and Commander-in-Chief, members were invited to debate the Federal Republic of Nigeria submission thoroughly so that informed - On-going Book Projects decisions could be made about the Reforms. The UN Reforms Challenges Before the UN he United Nations (UN) has been Colloquium on the United Nations Tand still remains the most important or decades now, there have been AReforms was organized by the platform for nation-states to pursue Fcalls for the reorganization and Institute from the 23rd – 25th June, their foreign policy interests and reform of the UN to make it more 2005. The event, which was meant to objectives. The UN, being a vast global relevant to the needs of its members, sensitize the Nigerian public, organization with functional more effective in facing the many particularly members of the involvement in virtually every challenges confronting it and more open intelligentsia, was sponsored by the important sphere of human endeavour and democratic.
    [Show full text]
  • VERBAL HYGIENE and ETHNIC POLITICS in NIGERIA: a STUDY of SELECTED NEWSPAPER PRINT and ONLINE PUBLICATIONS Matthew Chinenye Nnut
    VERBAL HYGIENE AND ETHNIC POLITICS IN NIGERIA: A STUDY OF SELECTED NEWSPAPER PRINT AND ONLINE PUBLICATIONS Matthew Chinenye Nnuta* & Chinwe Ezeifeka* http://dx.doi.org/10.4314/og.v13i 1.3 Abstract The work investigates verbal hygiene as fundamental towards achieving unity, conflict resolution and sustainable development in a linguistically, ethnically, culturally and politically diversified Nigerian society. It tries to establish a connection between verbal hygiene and persistent implosion of ethnic conflicts in Nigeria and the debilitating consequences of such on virtually all strata of national development. Data were collected using purposive sampling technique from select Nigerian newspapers and other textual sources like television and social media broadcast that showcase the speeches of opinion leaders from different ethnic groups in Nigeria. The collected data were textually analyzed through the lens of Politeness Theory of Brown and Levinson. It was found that a strong relationship exists between poor verbal hygiene, hate speech, electoral violence and ethnicity in Nigeria. This work also found out that the speeches of most opinion leaders analysed in this work are impolite and verbally unhygienic and as such impede the positive face of people from opposing ethnic groups, this constitutes serious threat to inter-ethnic relation and cohesion. The researchers recommend that every user of the English language in Nigeria must strive to use language consciously to achieve mutual understanding and peaceful co-existence. Introduction The two words, “verbal” and “hygiene” may seem incompatible at first glance, judging from the fact that whereas the former comes from the language discipline, the latter may be located in the domain of sanitation and environmental cleanliness.
    [Show full text]
  • Assessing the Impact of Military Rule on Imo State, 1976-1999
    International Journal of Research in Humanities and Social Studies Volume 2, Issue 9, September 2015, PP 40-53 ISSN 2394-6288 (Print) & ISSN 2394-6296 (Online) The Military in Politics: Assessing the Impact of Military Rule on Imo State, 1976-1999 Kelechi C. Ubaku1*, Emmanuel U. Ezeifedi1, Solomon S. Duru1 1Department of History and International Studies, Imo State University, Owerri, Nigeria ABSTRACT Nigeria is one of the nations of the world with a history of military domination in her political activities. The earliest incursion of the military in the political affairs of the African polity was encouraged by the upheavals which encrusted the political atmosphere of the country in the first republic. Traditionally, the acquisition of power by the military at the centre (federal level) automatically means the presence of the military at the helm of political affairs in the federating units, as military personnel were usually appointed as governors or administrators at the state level. Periodically, this trend was felt in Imo state from creation in 1976 through 1999 when the military officially relinquished power and recognized a democratically elected government in Nigeria. Numerous impacts were created on Imo state, during this period, by the various serving military governments in the administration of the state, and the examination of these impacts therefore forms the central discourse of this study. Adopting historical methodology of data gathering which encouraged ample utilization of primary and secondary sourced materials in the study, findings, however, revealed that in as much as the developmental woes of the state, within the stipulated period, was attributed to the political activities of the military governors – a maxim held and promoted presently in some quarters, there were still elements of benefits that accrued from the activities of military governments in Imo state.
    [Show full text]