Datasheet PB0939 Anti-SMYD3 Antibody
Total Page:16
File Type:pdf, Size:1020Kb
Product datasheet Anti-SMYD3 Antibody Catalog Number: PB0939 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-SMYD3 Antibody Gene Name SMYD3 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid. Purification Immunogen affinity purified. Observed MW 55KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry(Paraffin-embedded Section): 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user. Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene. Reference Anti-SMYD3 Antibody被引用在0文献中。 暂无引用 FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-SMYD3 Antibody Catalog Number: PB0939 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Selected Validation Data Western blot analysis of SMYD3 was detected in SMYD3 expression in paraffin-embedded HELA whole cell lysates sections of human (lane 1) and COLO320 intestinal cancer tissues whole cell lysates (lane 2). using rabbit anti- SMYD3 SMYD3 at 55KD was Antigen Affinity purified detected using rabbit polyclonal antibody anti- SMYD3 Antigen (Catalog # PB0939) at 1 Affinity purified μg/mL. The polyclonal antibody immunohistochemical (Catalog # PB0939) at0.5 section was developed μg/mL. The blot was using SABC method developed using (Catalog # SA1022). chemiluminescence (ECL) method (Catalog # EK1002). FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2 Powered by TCPDF (www.tcpdf.org).