PACRG (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

PACRG (Human) Recombinant Gene Summary: This gene encodes a protein that is Protein (P01) conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the Catalog Number: H00135138-P01 adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. Regulation Status: For research use only (RUO) These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are Product Description: Human PACRG full-length ORF ( associated with susceptibility to leprosy. The parkin NP_001073847.1, 1 a.a. - 257 a.a.) recombinant protein co-regulated gene protein forms a large molecular with GST-tag at N-terminal. complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is Sequence: also a component of Lewy bodies in Parkinson's disease MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSL patients, and it suppresses unfolded Pael VSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFR receptor-induced neuronal cell death. Multiple transcript KFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF variants encoding different isoforms have been found for FDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLII this gene. [provided by RefSeq] PIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPY YRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQET LEAFERYGGENAFINIKYVVPTYESCLLN Host: Wheat Germ (in vitro) Theoretical MW (kDa): 55.7 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 135138 Gene Symbol: PACRG Gene Alias: FLJ32724, GLUP, HAK005771, PARK2CRG, RP3-495O10.2 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

PRKN Gene Parkin RBR E3 Ubiquitin Protein Ligase
PRKN gene parkin RBR E3 ubiquitin protein ligase Normal Function The PRKN gene, one of the largest human genes, provides instructions for making a protein called parkin. Parkin plays a role in the cell machinery that breaks down ( degrades) unneeded proteins by tagging damaged and excess proteins with molecules called ubiquitin. Ubiquitin serves as a signal to move unneeded proteins into specialized cell structures known as proteasomes, where the proteins are degraded. The ubiquitin- proteasome system acts as the cell's quality control system by disposing of damaged, misshapen, and excess proteins. This system also regulates the availability of proteins that are involved in several critical cell activities, such as the timing of cell division and growth. Because of its activity in the ubiquitin-proteasome system, parkin belongs to a group of proteins called E3 ubiquitin ligases. Parkin appears to be involved in the maintenance of mitochondria, the energy- producing centers in cells. However, little is known about its role in mitochondrial function. Research suggests that parkin may help trigger the destruction of mitochondria that are not working properly. Studies of the structure and activity of parkin have led researchers to propose several additional activities for this protein. Parkin may act as a tumor suppressor protein, which means it prevents cells from growing and dividing too rapidly or in an uncontrolled way. Parkin may also regulate the supply and release of sacs called synaptic vesicles from nerve cells. Synaptic vesicles contain chemical messengers that transmit signals from one nerve cell to another. Health Conditions Related to Genetic Changes Parkinson disease Researchers have identified more than 200 PRKN gene mutations that cause Parkinson disease, a condition characterized by progressive problems with movement and balance.
[Show full text]
1 Supporting Information for a Microrna Network Regulates
Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia.
[Show full text]
Myopia in African Americans Is Significantly Linked to Chromosome 7P15.2-14.2
Genetics Myopia in African Americans Is Significantly Linked to Chromosome 7p15.2-14.2 Claire L. Simpson,1,2,* Anthony M. Musolf,2,* Roberto Y. Cordero,1 Jennifer B. Cordero,1 Laura Portas,2 Federico Murgia,2 Deyana D. Lewis,2 Candace D. Middlebrooks,2 Elise B. Ciner,3 Joan E. Bailey-Wilson,1,† and Dwight Stambolian4,† 1Department of Genetics, Genomics and Informatics and Department of Ophthalmology, University of Tennessee Health Science Center, Memphis, Tennessee, United States 2Computational and Statistical Genomics Branch, National Human Genome Research Institute, National Institutes of Health, Baltimore, Maryland, United States 3The Pennsylvania College of Optometry at Salus University, Elkins Park, Pennsylvania, United States 4Department of Ophthalmology, University of Pennsylvania, Philadelphia, Pennsylvania, United States Correspondence: Joan E. PURPOSE. The purpose of this study was to perform genetic linkage analysis and associ- Bailey-Wilson, NIH/NHGRI, 333 ation analysis on exome genotyping from highly aggregated African American families Cassell Drive, Suite 1200, Baltimore, with nonpathogenic myopia. African Americans are a particularly understudied popula- MD 21131, USA; tion with respect to myopia. [email protected]. METHODS. One hundred six African American families from the Philadelphia area with a CLS and AMM contributed equally to family history of myopia were genotyped using an Illumina ExomePlus array and merged this work and should be considered co-first authors. with previous microsatellite data. Myopia was initially measured in mean spherical equiv- JEB-W and DS contributed equally alent (MSE) and converted to a binary phenotype where individuals were identified as to this work and should be affected, unaffected, or unknown.
[Show full text]
Supplementary Materials
Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
[Show full text]
Heterogeneous Phenotype in a Family with Compound Heterozygous Parkin Gene Mutations
ORIGINAL CONTRIBUTION Heterogeneous Phenotype in a Family With Compound Heterozygous Parkin Gene Mutations Hao Deng, PhD; Wei-Dong Le, MD, PhD; Christine B. Hunter, RN; William G. Ondo, MD; Yi Guo, MS; Wen-Jie Xie, MD; Joseph Jankovic, MD Background: Mutations in the parkin gene (PRKN) cause mutations in compound heterozygotes. The phenotype autosomal recessive early-onset Parkinson disease (EOPD). of patients was that of classic autosomal recessive EOPD characterized by beneficial response to levodopa, rela- Objective: To investigate the presence of mutations in tively slow progression, and motor complications. All het- the PRKN gene in a white family with EOPD and the geno- erozygous mutation carriers (T240M or EX 5_6 del) and type-phenotype correlations. a 56-year-old woman who was a compound heterozy- gous mutation carrier (T240M and EX 5_6 del) were free Design: Twenty members belonging to 3 generations of of any neurological symptoms. the EOPD family with 4 affected subjects underwent ge- netic analysis. Direct genomic DNA sequencing, semi- Conclusions: Compound heterozygous mutations quantitative polymerase chain reaction, real-time quan- (T240M and EX 5_6 del) in the PRKN gene were found titative polymerase chain reaction, and reverse- to cause autosomal recessive EOPD in 4 members of a transcriptase polymerase chain reaction analyses were large white family. One additional member with the same performed to identify the PRKN mutation. mutation, who is more than 10 years older than the mean age at onset of the 4 affected individuals, had no clinical Results: Compound heterozygous mutations (T240M manifestation of the disease. This incomplete pen- and EX 5_6 del) in the PRKN gene were identified in 4 etrance has implications for genetic counseling, and it patients with early onset (at ages 30-38 years).
[Show full text]
Human Genetic Variation Influences Enteric Fever Progression
cells Review Human Genetic Variation Influences Enteric Fever Progression Pei Yee Ma 1, Jing En Tan 2, Edd Wyn Hee 2, Dylan Wang Xi Yong 2, Yi Shuan Heng 2, Wei Xiang Low 2, Xun Hui Wu 2 , Christy Cletus 2, Dinesh Kumar Chellappan 3 , Kyan Aung 4, Chean Yeah Yong 5 and Yun Khoon Liew 3,* 1 School of Postgraduate Studies, International Medical University, Bukit Jalil, Kuala Lumpur 57000, Malaysia; [email protected] 2 School of Pharmacy, International Medical University, Kuala Lumpur 57000, Malaysia; [email protected] (J.E.T.); [email protected] (E.W.H.); [email protected] (D.W.X.Y.); [email protected] (Y.S.H.); [email protected] (W.X.L.); [email protected] (X.H.W.); [email protected] (C.C.) 3 Department of Life Sciences, International Medical University, Kuala Lumpur 57000, Malaysia; [email protected] 4 Department of Pathology, International Medical University, Kuala Lumpur 57000, Malaysia; [email protected] 5 Department of Microbiology, Faculty of Biotechnology and Biomolecular Sciences, Universiti Putra Malaysia, Selangor 43400, Malaysia; [email protected] * Correspondence: [email protected] Abstract: In the 21st century, enteric fever is still causing a significant number of mortalities, espe- cially in high-risk regions of the world. Genetic studies involving the genome and transcriptome have revealed a broad set of candidate genetic polymorphisms associated with susceptibility to Citation: Ma, P.Y.; Tan, J.E.; Hee, and the severity of enteric fever. This review attempted to explain and discuss the past and the E.W.; Yong, D.W.X.; Heng, Y.S.; Low, W.X.; Wu, X.H.; Cletus, C.; Kumar most recent findings on human genetic variants affecting the progression of Salmonella typhoidal Chellappan, D.; Aung, K.; et al.
[Show full text]
Anti-PACRG Rabbit Polyclonal Antibody
Catalog # Aliquot Size P216-363R-100 100 µg Anti-PACRG Rabbit Polyclonal Antibody Catalog # P216-363R Lot # B3216-69 Cited Applications Sample Data ELISA, WB Ideal working dilutions for each application should be empirically determined by the investigator. Specificity Recognizes the human PACRG protein Cross Reactivity Human, Mouse and Chicken Host/Isotype/Clone# Rabbit, IgG Immunogen Western blot using affinity purified Anti-PACRG (1:1,500 dilution) The antibody was produced against synthesized peptide shows detection of a band ~40 kDa corresponding to human corresponding to amino acids 204-215 of human PACRG protein PACRG (arrowhead lane 1). Specific reactivity with this band is blocked when the antibody is pre-incubated with the Formulation immunizing peptide (lane 2). Load: ~ 35 ug of a mouse 0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2 + embryonic fibroblast (MEF) whole cell lysate. 0.01% (w/v) Sodium Azide Stability 1yr at –200C from date of shipment Scientific Background PACRG (also known as Parkin coregulated gene protein and PARK2 coregulated) is a gene located very close to parkin, in reverse orientation on the chromosome. It is thought to be co- transcribed with parkin by a bi-directional promoter between the two genes. PACRG is expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow and is also expressed in heart, brain, skeletal muscle, kidney, lung and pancreas. PACRG is expressed in primary Schwann cells and very weakly by monocyte-derived macrophages, which are the primary host cells of Mycobacterium leprae, the causative agent Anti-PACRG of leprosy.
[Show full text]
Genome-Wide Insights on Gastrointestinal Nematode
www.nature.com/scientificreports OPEN Genome‑wide insights on gastrointestinal nematode resistance in autochthonous Tunisian sheep A. M. Ahbara1,2, M. Rouatbi3,4, M. Gharbi3,4, M. Rekik1, A. Haile1, B. Rischkowsky1 & J. M. Mwacharo1,5* Gastrointestinal nematode (GIN) infections have negative impacts on animal health, welfare and production. Information from molecular studies can highlight the underlying genetic mechanisms that enhance host resistance to GIN. However, such information often lacks for traditionally managed indigenous livestock. Here, we analysed 600 K single nucleotide polymorphism genotypes of GIN infected and non‑infected traditionally managed autochthonous Tunisian sheep grazing communal natural pastures. Population structure analysis did not fnd genetic diferentiation that is consistent with infection status. However, by contrasting the infected versus non‑infected cohorts using ROH, LR‑GWAS, FST and XP‑EHH, we identifed 35 candidate regions that overlapped between at least two methods. Nineteen regions harboured QTLs for parasite resistance, immune capacity and disease susceptibility and, ten regions harboured QTLs for production (growth) and meat and carcass (fatness and anatomy) traits. The analysis also revealed candidate regions spanning genes enhancing innate immune defence (SLC22A4, SLC22A5, IL‑4, IL‑13), intestinal wound healing/repair (IL‑4, VIL1, CXCR1, CXCR2) and GIN expulsion (IL‑4, IL‑13). Our results suggest that traditionally managed indigenous sheep have evolved multiple strategies that evoke and enhance GIN resistance and developmental stability. They confrm the importance of obtaining information from indigenous sheep to investigate genomic regions of functional signifcance in understanding the architecture of GIN resistance. Small ruminants (sheep and goats) make immense socio-economic and cultural contributions across the globe.
[Show full text]
Associations of PRKN–PACRG Snps and G × G and G × E Interactions
www.nature.com/scientificreports OPEN Associations of PRKN–PACRG SNPs and G × G and G × E interactions with the risk of hyperlipidaemia Peng‑Fei Zheng1, Rui‑Xing Yin 1,2,3*, Bi‑Liu Wei1, Chun‑Xiao Liu1, Guo‑Xiong Deng1 & Yao‑Zong Guan1 This research aimed to assess the associations of 7 parkin RBR E3 ubiquitin protein ligase (PRKN) and 4 parkin coregulated gene (PACRG ) single-nucleotide polymorphisms (SNPs), their haplotypes, gene–gene (G × G) and gene-environment (G × E) interactions with hyperlipidaemia in the Chinese Maonan minority. The genotypes of the 11 SNPs in 912 normal and 736 hyperlipidaemic subjects were detected with next-generation sequencing technology. The genotypic and allelic frequencies of the rs1105056, rs10755582, rs2155510, rs9365344, rs11966842, rs6904305 and rs11966948 SNPs were diferent between the normal and hyperlipidaemic groups (P < 0.05–0.001). Correlations between the above 7 SNPs and blood lipid levels were also observed (P < 0.0045–0.001, P < 0.0045 was considered statistically signifcant after Bonferroni correction). Strong linkage disequilibrium was found among the 11 SNPs (r2 = 0.01–0.64). The most common haplotypes were PRKN C-G-T-G-T-T-C (> 15%) and PACRG A-T-A-T (> 40%). The PRKN C-G-C-A-T-T-C and PRKN–PACRG C-G-T-G-T-T-C-A-T-A-T haplotypes were associated with an increased risk of hyperlipidaemia, whereas the PRKN–PACRG C-G-T-G-C-T-C- A-T-C-T and C-G-T-G-T-T-C-A-T-C-T haplotypes provided a protective efect.
[Show full text]
Generation and Characterisation of a Parkin-Pacrg Knockout Mouse Line and a Pacrg Knockout Mouse Line Received: 22 January 2018 Sarah E
www.nature.com/scientificreports OPEN Generation and characterisation of a parkin-Pacrg knockout mouse line and a Pacrg knockout mouse line Received: 22 January 2018 Sarah E. M. Stephenson1,2, Timothy D. Aumann3, Juliet M. Taylor 4, Jessica R. Riseley1, Accepted: 25 April 2018 Ruili Li2,5, Jefrey R. Mann6, Doris Tomas3 & Paul J. Lockhart 1,2 Published: xx xx xxxx Mutations in PARK2 (parkin) can result in Parkinson’s disease (PD). Parkin shares a bidirectional promoter with parkin coregulated gene (PACRG) and the transcriptional start sites are separated by only ~200 bp. Bidirectionally regulated genes have been shown to function in common biological pathways. Mice lacking parkin have largely failed to recapitulate the dopaminergic neuronal loss and movement impairments seen in individuals with parkin-mediated PD. We aimed to investigate the function of PACRG and test the hypothesis that parkin and PACRG function in a common pathway by generating and characterizing two novel knockout mouse lines harbouring loss of both parkin and Pacrg or Pacrg alone. Successful modifcation of the targeted allele was confrmed at the genomic, transcriptional and steady state protein levels for both genes. At 18–20 months of age, there were no signifcant diferences in the behaviour of parental and mutant lines when assessed by openfeld, rotarod and balance beam. Subsequent neuropathological examination suggested there was no gross abnormality of the dopaminergic system in the substantia nigra and no signifcant diference in the number of dopaminergic neurons in either knockout model compared to wildtype mice. Parkinson’s disease (PD) is an age associated progressive neurodegenerative movement disorder that is estimated to efect over 5 million people worldwide1.
[Show full text]
A Semantic Relationship Mining Method Among Disorders, Genes
Zhang et al. BMC Medical Informatics and Decision Making 2020, 20(Suppl 4):283 https://doi.org/10.1186/s12911-020-01274-z RESEARCH Open Access A semantic relationship mining method among disorders, genes, and drugs from different biomedical datasets Li Zhang1, Jiamei Hu1, Qianzhi Xu1, Fang Li2, Guozheng Rao3,4* and Cui Tao2* From The 4th International Workshop on Semantics-Powered Data Analytics Auckland, New Zealand. 27 October 2019 Abstract Background: Semantic web technology has been applied widely in the biomedical informatics field. Large numbers of biomedical datasets are available online in the resource description framework (RDF) format. Semantic relationship mining among genes, disorders, and drugs is widely used in, for example, precision medicine and drug repositioning. However, most of the existing studies focused on a single dataset. It is not easy to find the most current relationships among disorder-gene-drug relationships since the relationships are distributed in heterogeneous datasets. How to mine their semantic relationships from different biomedical datasets is an important issue. Methods: First, a variety of biomedical datasets were converted into RDF triple data; then, multisource biomedical datasets were integrated into a storage system using a data integration algorithm. Second, nine query patterns among genes, disorders, and drugs from different biomedical datasets were designed. Third, the gene-disorder- drug semantic relationship mining algorithm is presented. This algorithm can query the relationships among various entities from different datasets. Results and conclusions: We focused on mining the putative and the most current disorder-gene-drug relationships about Parkinson’s disease (PD). The results demonstrate that our method has significant advantages in mining and integrating multisource heterogeneous biomedical datasets.
[Show full text]
Table S1. 103 Ferroptosis-Related Genes Retrieved from the Genecards
Table S1. 103 ferroptosis-related genes retrieved from the GeneCards. Gene Symbol Description Category GPX4 Glutathione Peroxidase 4 Protein Coding AIFM2 Apoptosis Inducing Factor Mitochondria Associated 2 Protein Coding TP53 Tumor Protein P53 Protein Coding ACSL4 Acyl-CoA Synthetase Long Chain Family Member 4 Protein Coding SLC7A11 Solute Carrier Family 7 Member 11 Protein Coding VDAC2 Voltage Dependent Anion Channel 2 Protein Coding VDAC3 Voltage Dependent Anion Channel 3 Protein Coding ATG5 Autophagy Related 5 Protein Coding ATG7 Autophagy Related 7 Protein Coding NCOA4 Nuclear Receptor Coactivator 4 Protein Coding HMOX1 Heme Oxygenase 1 Protein Coding SLC3A2 Solute Carrier Family 3 Member 2 Protein Coding ALOX15 Arachidonate 15-Lipoxygenase Protein Coding BECN1 Beclin 1 Protein Coding PRKAA1 Protein Kinase AMP-Activated Catalytic Subunit Alpha 1 Protein Coding SAT1 Spermidine/Spermine N1-Acetyltransferase 1 Protein Coding NF2 Neurofibromin 2 Protein Coding YAP1 Yes1 Associated Transcriptional Regulator Protein Coding FTH1 Ferritin Heavy Chain 1 Protein Coding TF Transferrin Protein Coding TFRC Transferrin Receptor Protein Coding FTL Ferritin Light Chain Protein Coding CYBB Cytochrome B-245 Beta Chain Protein Coding GSS Glutathione Synthetase Protein Coding CP Ceruloplasmin Protein Coding PRNP Prion Protein Protein Coding SLC11A2 Solute Carrier Family 11 Member 2 Protein Coding SLC40A1 Solute Carrier Family 40 Member 1 Protein Coding STEAP3 STEAP3 Metalloreductase Protein Coding ACSL1 Acyl-CoA Synthetase Long Chain Family Member 1 Protein
[Show full text]