PACRG (Human) Recombinant Gene Summary: This gene encodes a protein that is Protein (P01) conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the Catalog Number: H00135138-P01 adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. Regulation Status: For research use only (RUO) These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are Product Description: Human PACRG full-length ORF ( associated with susceptibility to leprosy. The parkin NP_001073847.1, 1 a.a. - 257 a.a.) recombinant protein co-regulated gene protein forms a large molecular with GST-tag at N-terminal. complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is Sequence: also a component of Lewy bodies in Parkinson's disease MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSL patients, and it suppresses unfolded Pael VSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFR receptor-induced neuronal cell death. Multiple transcript KFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF variants encoding different isoforms have been found for FDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLII this gene. [provided by RefSeq] PIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPY YRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQET LEAFERYGGENAFINIKYVVPTYESCLLN

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 55.7

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 135138

Gene Symbol: PACRG

Gene Alias: FLJ32724, GLUP, HAK005771, PARK2CRG, RP3-495O10.2

Page 1/1

Powered by TCPDF (www.tcpdf.org)