DOCSLIB.ORG

Global Journal of Human Social Science Classical with Rival Views Concerning the Impact of Public Investments in Their Variance of Volumes and Qualities

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Global Journal of Human Social Science Classical with Rival Views Concerning the Impact of Public Investments in Their Variance of Volumes and Qualities Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS RoadmaptoDevelopment DevelopmentandEconomic ImpactofPublicandPrivate NewInsightsintoFinancialSector VOLUME18ISSUE6VERSION1.0 Global Journal of Human-Social Science: E Economics Glo bal Journal of Human-Social Science: E Economics Volume 18 Issue 6 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2018. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Globa l Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU Packaging & Continental Dispatching FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG Global Journals Pvt Ltd (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ E-3130 Sudama Nagar, Near Gopur Square, ULVN Indore, M.P., Pin:452009, India 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG Find a correspondence nodal officer near you &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ To find nodal officer of your country, please email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH eContacts UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI Press Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG Investor Inquiries: [email protected] RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Technical Support: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Media & Releases: [email protected] Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 Pricing (E xcluding Air Parcel Charges): Employer Identification Number (EIN): USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional) 250 USD (B/W) & 350 USD (Color) Editorial Board Global Journal of Human Social -Science Dr. Prasad V Bidarkota Dr. Periklis Gogas Ph.D., Associate Professor Department of Economics Department of Economics, Florida International University Democritus University of Thrace USA Ph.D., Department of Economics, Univer sity of Calgary, Canada Dr. Giaime Berti Dr. Stephen E. Haggerty Ph.D. Ph.D. Geology & Geophysics, School of Economics and Management University of London University of Florence, Italy Associate Professor University of Massachusetts, USA Dr. Gisela Steins Dr. Edward C. Hoang, Ph.D. Psychology, University of Bielefeld, Germany Ph.D., Professor, General and Social Psychology, University of Depart ment of Economics, Duisburg-Essen, Germany University of Colorado USA Dr. Ri ta Mano Dr. V alerie Zawilski Ph.D. Rand Corporation and University of California, Associate Professor, Los Angeles, USA Ph.D. - University of Toronto Dep. of Human Services, MA - Ont ario Institute for Studies in Education University of Haifa Dr. H eying Jenny Zhan Dr. Bruce Cronin B.A., M.A., Ph.D. Sociology, University of Kansas, USA B.A., M.A., Ph.D. in Political Science, Columbia University Department of Sociology Professor, City College of New York, US Georgia State University, US Dr. Adrian Armstrong Dr. Danielle Riverin-Simard BSc Geography, LSE, 1970 B.A., M.A., Ph.D., Cognitive training, University Laval, Ph.D. Geography (Geomorphology) Canada Kings College London 1980 Professor Emeritus of Education and Educational Ordained Priest, Church of England 1988 Psychology, Taunton, Somerset, Laval University, Canada United Kingdom Dr. Ar turo Diaz Suarez Dr. Raym ond K. H. Chan Ed.D., Ph.D. in Physical Education Ph.D., Sociology, University of Essex, UK Professor at University of Murcia, Spain Associate Professor City University of Hong Kong, China Dr. Kaneko Mamoru Dr. Luisa dall’Acqua Ph.D., Tokyo Institute of Technology Ph.D. in Sociology (Decisional Risk sector), Structural Engineering Master MU2, College Teacher in Philosophy (Italy), Faculty of Political Science and Economics, Waseda Edu-Research Group, Zürich/Lugano University, Tokyo, Japan Dr. Hugo Nami Dr. Helmut Digel Ph.D.in Anthropological Sciences, Ph.D. University of Tübingen, Germany Universidad of Buenos Aires, Argentina, Honorary President of German Athletic Federation (DLV), University of Buenos Aires, Argentina Germany Dr. Vesna Stanković Pejnović Dr. Tao Yang Ph. D. Philospohy Ohio State University Zagreb, Croatia M.S. Kansas State University Rusveltova, SkopjeMacedonia B.E. Zhejiang University Dr. Alis Puteh Dr. Asunción López- Varela Ph.D. (Edu.Policy) UUM BA, MA (Hons), Ph.D. (Hons) Sintok, Kedah, Malaysia Facultad de Filología. M.Ed (Curr. & Inst.) Universidad Complutense Madrid University of Houston, US 29040 Madrid Spain Dr. Thierry Feuillet Dr. Mohd Hairy Géolittomer – LETG UMR 6554 CNRS Mohd Hairy, PhD (Urban Climate), Masters (Université de Nantes) (Environmental Management) Institut de Géographie et d’Aménagement (National University of Malaysia) Régional de l’Université de Nantes. & Degree In Geography (Hons), Chemin de la Censive du Tertre – BP University Malaya, Malaysia. Rodez Contents of the Issue i. Copyright Notice ii. Editorial Board Members iii. Chief Author and Dean iv. Contents of the Issue 1. Impact of Public and Private Investment on GDP Growth in Bangladesh: Crowding-in or Out? 1-8 2. Effet De La Gouvernance Sur L’efficacité De L’aide Publique Au Développement Dans La CEMAC. 9-19 3. New Insights into Financial Sector Development and Economic Growth Nexus in Nigeria. 21-31 4. Efficacite Technique des Entreprises Agro Industrielles au Cameroun: Approche Non Parametrique. 33-43 5. The Activities of Niger Delta Militants: A Road March to Development. 45-61 v. Fellows vi. Auxiliary Memberships vii. Preferred Author Guidelines viii. Index Global Journal of HUMAN-SOCIAL SCIENCE: E Economics Volume 18 Issue 6 Version 1.0 Year 2018 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Impact of Public and Private Investment on GDP Growth in Bangladesh: Crowding-in or Out? By Md. Monirul Islam, Asif Hossain & Mohammad Tareque, PhD Bangladesh Institute of Governance and Management (BIGM) Abstract- The study investigates into the impact of public and private investment on GDP growth in Bangladesh over the period 1980-2016 within ARDL framework. It also enquires into the causal relationship between investment (public and private) and GDP growth using Block Exogeneity Wald Test. The study primarily finds that there exists a significant impact of both public and private investment on GDP growth in the long run. In the short run, public investment does not affect, but private investment has a positive impact on GDP growth. The study also uncovers a bidirectional association between public investment and GDP growth whereas unidirectional relationships from private investment to GDP growth and from public investment to private investment. Consequently, public investment crowds-in private investment. Therefore, increase in public investment is critical to moving to the next level of the country's growth. Keywords: public investment, private investment, GDP growth, crowding-in and -out effects, ARDL bounds te.st. GJHSS-E Classification: FOR Code: 149999 ImpactofPublicandPrivateInvestmentonGDPGrowthinBangladeshCrowding-inorOut? Strictly as per the compliance and regulations of: © 2018. Md. Monirul Islam, A sif Hossain & Mohammad Tareque, PhD. This is a research/review paper, distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License http://creativecommons.org/licenses/by- nc/3.0/), permitting all non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. Impact of Public and Private Investment on GDP Growth in Bangladesh: Crowding-in or Out? α σ ρ Md. Monirul Islam , A sif Hossain & Mohammad Tareque, PhD Abstract - The study investigates into the impact of public and government that increases production of a country, private investment on GDP growth in Bangladesh over the which is included in aggregate demand resulting in period 1980-2016 within ARDL framework. It also enquires into increasing employment opportunities for the people. the causal relationship between investment (public and This aggregate demand has multiplier effects on output private) and GDP growth using Block Exogeneity Wald Test. (Blinder, 2008). Keynesians also stated that private The study primarily finds that there exists a significant impact
Load more

Recommended publications
  • Downloaded for Personal Non-Commercial Research Or Study, Without Prior Permission Or Charge
    https://theses.gla.ac.uk/ Theses Digitisation: https://www.gla.ac.uk/myglasgow/research/enlighten/theses/digitisation/ This is a digitised version of the original print thesis. Copyright and moral rights for this work are retained by the author A copy can be downloaded for personal non-commercial research or study, without prior permission or charge This work cannot be reproduced or quoted extensively from without first obtaining permission in writing from the author The content must not be changed in any way or sold commercially in any format or medium without the formal permission of the author When referring to this work, full bibliographic details including the author, title, awarding institution and date of the thesis must be given Enlighten: Theses https://theses.gla.ac.uk/ [email protected] THE POLITICS AMO ADMINISTRATION OF COhTUNITY DEVELOPMENT IN THE RIVERS STATE OF NIGERIA BY LAURENCE A.8. lYAGOA Submitbed for the Degree of Doctor of Philosophy University of Glasgow Duly 1976 ProQuest Number: 10647271 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted. In the unlikely event that the author did not send a complete manuscript and there are missing pages, these will be noted. Also, if material had to be removed, a note will indicate the deletion. uesL ProQuest 10647271 Published by ProQuest LLO (2017). Copyright of the Dissertation is held by the Author. All rights reserved. This work is protected against unauthorized copying under Title 17, United States Code Microform Edition © ProQuest LLO. ProQuest LLO.
    [Show full text]
  • Does the Greater Port Harcourt Master Plan 2008 Meet Aspirations for Liveable City?
    Ede et al., Greater Port Harcourt Master Plan 2008, 47th ISOCARP Congress 2011 Does the Greater Port Harcourt Master Plan 2008 meet Aspirations for Liveable City? By Precious N. Ede, Opuenebo B. Owei and Chimbiko Iche Akarolo In 2007 the government of Rivers State, Nigeria contracted a South African firm to produce a master plan for a new city called Greater Port Harcourt to be situated in the outskirts of the old city. The Greater Port Harcourt Master Plan 2008 is here examined in the context of current thinking as to whether it has credentials that meet aspirations for modern liveable cities. The new city plan assumes that Port Harcourt will continue to grow at its current rate so there is need to respond pro-actively to the reality of meeting cogent challenges. The infrastructure to be provided must be sustainable, that is, there should be continuity of effective service delivery by operators, by way of renewal, upgrading and expansion to cope with the city growth. Provision of services will be private sector driven, while government is politically ready to amend laws, regulations and policies to create an enabling environment for private sector to thrive in driving the development initiatives. The plan provides a long-term vision for the city based on sustainability: social, economic and political equity. Sustainability is hinged on continual improvement based on accountability, transparency and good governance. The master plan aims at a development that positively encourages the creation of a mixed community of 350,000 housing units, initially. The energy infrastructure utilizes the natural resources in the region such as natural gas for powering turbines and providing domestic fuel, with a little solar power.
    [Show full text]
  • Environmental and Social Impact Assessment (Esia) Report
    FINAL ENVIRONMENTAL AND SOCIAL IMPACT ASSESSMENT (ESIA) REPORT FOR THE PROPOSED CONSTRUCTION OF 125 MWp UTILITY SCALE PV-BASED SOLAR POWER PLANT IN KANKIYA LOCAL GOVERNMENT AREA, KATSINA STATE, NIGERIA BY NOVA SOLAR 5 FARMS LIMITED SUBMITTED TO THE FEDERAL MINISTRY OF ENVIRONMENT DECEMBER, 2015 NSF SOLAR POWER PLANT ESIA – FINAL REPORT NSF SOLAR POWER PLANT ESIA – FINAL REPORT NSF SOLAR POWER PLANT ESIA – FINAL REPORT NSF SOLAR POWER PLANT ESIA – FINAL REPORT FINAL ENVIRONMENTAL AND SOCIAL IMPACT ASSESSMENT (ESIA) REPORT FOR THE PROPOSED CONSTRUCTION OF 125 MWp UTILITY SCALE PV-BASED SOLAR POWER PLANT IN KANKIYA LOCAL GOVERNMENT AREA, KATSINA STATE, NIGERIA REPORT NO.: S-1411A CLIENT: NOVA SOLAR 5 FARMS LIMITED 43 USUMA STREET, OFF GANA STREET, MAITAMA, F.C.T. ABUJA, NIGERIA DATE OF REPORT: DECEMBER, 2015 PROJECT MANAGER: PATRICK AGIOH Fugro Nigeria Ltd Quality Assurance: Name Position Signature Date Approved by Prof. G.C. Managing Director Ofunne Checked by Esa Odan Service Line Manager (Water and Environment) Version Status 1 Initial Draft Report 15/05/2015 2 Draft Report 18/09/2015 3 Final Report 09/12/2015 91 Odani Road (Fugro Avenue), Off PH-Eleme Expressway, Elelenwo, P.M.B 053, Port Harcourt. Tel.: +234-708-4102-400. E-mail: [email protected] 125 MWp Katsina Solar PV Power Plant - ESIA TABLE OF CONTENTS Table of Contents i of xiv List of Figures viii of xiv List of Tables x of xiv List of Abbreviations and Acronyms xii of xiv List of Preparers xv of xiv Executive Summary i of xvi Acknowledgement i of i CHAPTER ONE 1 of
    [Show full text]
  • Annual Report and Financial Statements
    ANNUAL REPORT AND FINANCIAL STATEMENTS ANNUAL REPORT AND FINANCIAL STATEMENTS 2015 STERLING BANK PLC TABLE OF CONTENTS Notice of AGM Governance Basic Information Overview Leadership – Corporate The Management Team 182 056 Governance Report Why Integrated Reporting 006 Branch Network 184 Directors, Officers and 060 Performance Highlights 007 Professional Advisers Change of Address Form 193 Chairman’s Statement 008 Board of Directors 061 E-bonus/offer/rights Form 195 Report of the Directors 066 Mandate for Dividend Payment to Bank 197 Strategic report Statement of Directors’ (e-dividend form) Responsibilities in relation to 073 Managing Director/ Chief Shareholder’s Data Update 012 the Financial Statements 199 Executive Officer’s Report Form Our Strategy/Business Model 018 Report of the External Consultants on the Board 074 Proxy Form 201 Key Performance Indicators 027 Appraisal of Sterling Bank Plc Economic Report 028 Independent Auditors’ Report 075 Performance Review 031 Report of Statutory Audit 077 Committee Statement of Compliance 078 Sustainability Sustainability Approach 044 Enriching Lives 044 Financial statements Education 045 Statement of Profit or Loss Environment 047 and other Comprehensive 080 Income Entertainment 049 Statement of Financial Community Development 050 081 Position Customer Service Initiatives 050 Statement of Changes in 082 For our Employees 051 Equity For our Shareholders 051 Statements of Cash Flows 084 Statement of Prudential For the Government 052 085 Adjustments Materiality Analysis 052 Notes to the Financial 086 Stakeholder Engagement 053 Statements Statement of Value Added 177 Five-year Financial Summary 178 Share Capital History 180 ANNUAL REPORT AND FINANCIAL STATEMENTS 2015 STERLING BANK PLC NOTICE OF ANNUAL GENERAL MEETING NOTICE IS HEREBY GIVEN that the 54th Annual General Meeting of Sterling Bank Plc will be held at Eko Hotel & Suites, Plot 1415, Adetokunbo Ademola Street, Victoria Island, Lagos on Tuesday, the 19th day of April, 2016 at 10.00 a.m.
    [Show full text]
  • Manner of Utilization of Implementation Funds for The
    International Journal of Scientific & Engineering Research Volume 12, Issue 3, March-2021 731 ISSN 2229-5518 Manner of Utilization of Implementation Funds for the Greater Port Harcourt City Master Plan Implementation Johnbull Simeipiri Wenike1 and Ikiriko Tamunoikuronibo Dawaye2 Urban and Regional Planning Department, Rivers State University, Nkpolu, Port Harcourt Email1: [email protected] 2 Email : [email protected] Abstract Policies, projects and programmes are adequately expressed through a plan and such plan can hardly be implemented in the face of paucity, inadequate and inappropriate disbursement of funds for implementation. This study engages both quantitative and qualitative investigations to ascertain the total amount of fund that was allocated and revenue generated in the Greater Port Harcourt City Development Authority from 2009-2019; and also ascertain the avenues these funds were distributed in the process of the implementation of the Greater Port Harcourt City Master Plan. This class of study belongs to the explanatory sequential mixed method research design. The geographical scope of the study is the Phase 1 area of the study location which comprises of the Mbodo-Aluu, Omagwa and Igwuruta communities in Ikwerre Local Government Area of Rivers State. Both in-depth key informant interview and secondary data from GPHCDA were annexed to adjudicate appropriate analysis of the submissions on the financial capacity of Greater Port Harcourt City Development Authority (GPHCDA) based on the inflow and outflow of funds within the planning period of 2009-2019. An analysis was made to determine the fiscal performance of the Authority during the implementation of the GPHCMP (2009-2019). Issues of compensation and land allocation (Land Compensation Claims Settled by GPHCDA, Educational Layout Compensation Payment at Mbodo-Aluu, Structures Acquired and Compensation Paid in Phase 1A, Compensation for Crops Paid in Phase 1A) were evidently captured as part of the activities in the implementation process.
    [Show full text]
  • Petro-Violence and the Geography of Conflict in Nigeria's
    Spaces of Insurgency: Petro-Violence and the Geography of Conflict in Nigeria’s Niger Delta By Elias Edise Courson A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Geography in the Graduate Division of the University of California, Berkeley Committee in charge: Professor Michael J. Watts, Chair Professor Ugo G. Nwokeji Professor Jake G. Kosek Spring 2016 Spaces of Insurgency: Petro-Violence and the Geography of Conflict in Nigeria’s Niger Delta © 2016 Elias Edise Courson Abstract Spaces of Insurgency: Petro-Violence and the Geography of Conflict in Nigeria’s Niger Delta by Elias Edise Courson Doctor of Philosophy in Geography University of California, Berkeley Professor Michael J. Watts, Chair This work challenges the widely held controversial “greed and grievance” (resource curse) narrative by drawing critical insights about conflicts in the Niger Delta. The Niger Delta region of Nigeria has attracted substantial scholarly attention in view of the paradox of poverty and violence amidst abundant natural resources. This discourse suggests that persistent resource- induced conflicts in the region derive from either greed or grievance. Instead, the present work draws inspiration from the political geography of the Niger Delta, and puts the physical area at the center of its analysis. The understanding that the past and present history of a people is etched in their socio-political geography inspires this focus. Whereas existing literatures engages with the Niger Delta as a monolithic domain, my study takes a more nuanced approach, which recognizes a multiplicity of layers mostly defined by socio-geographical peculiarities of different parts of the region and specificity of conflicts its people experience.
    [Show full text]
  • The Activities of Niger Delta Militants: a Road March to Development by Past
    Global Journal of HUMAN-SOCIAL SCIENCE: E Economics Volume 18 Issue 6 Version 1.0 Year 2018 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X The Activities of Niger Delta Militants: A Road March to Development By Past. Dr. Abomaye-Nimenibo, Williams Aminadokiari Samuel, Barrister, Miss Abomaye Nimenibo, Comfort Tamunobarasinpiri Emmanuel & Hannah Iyerikabo Obong University Abstract- This research work investigates the activities of the Niger Delta militants and how it affects the developmental strides of the Nigerian economy. We use primary data with a target population of students, oil company workers, civil servants, public servants, farmers, and entrepreneurs in Bayelsa State being the main hob of militancy and very rich in oil production than any other state. Tables were constructed to show the level of responses and their percentages. In the end, Chi-Square was used to test the relationship between militancy and the economy. The results revealed that militancy has a strong significant effect on crude oil production/supply as well as the Nigerian economy. Militancy in the Niger Delta Region has led to the loss of revenue accruable to the Federal Government of Nigeria. The activities of militants in the Niger Delta Region have significantly affected business life, create unemployment and devastated human lives in the Niger Delta region. Militancy also supports illegal bunkering. Keywords: militancy, unemployment, business activities, development, revenue, and economy. GJHSS-E Classification: FOR Code: 340299 TheActivitiesofNigerDeltaMilitantsARoadMarchtoDevelopment Strictly as per the compliance and regulations of: © 2018. Past. Dr. Abomaye-Nimenibo, Williams Aminadokiari Samuel, Barrister, Miss Abomaye-Nimenibo,Comfort Tamunobarasinpiri Emmanuel & Hannah Iyerikabo.
    [Show full text]
  • Citizens Report on State and Local Government Budgets in the Niger Delta, 2009
    BEYOND AMNESTY CITIZENS REPORT ON STATE 2009 AND LOCAL GOVERNMENT BUDGETS IN THE NIGER DELTA NIGER DELTA CITIZENS AND BUDGET PLATFORM BEYOND AMNESTY Citizens Report on State and Local Government Budgets in the Niger Delta, 2009 NIGER DELTA CITIZENS AND BUDGET PLATFORM Copyright © 2010 Social Development Integrated Centre (Social Action) All rights reserved. ISBN: 978‐978‐902‐962‐0 Published for: Niger Delta Citizens and Budget Platform www.citizensbudget.org By Social Development Integrated Centre (Social Action) 33, Oromineke Layout, Off Emekuku Street, D‐Line Port Harcourt, Nigeria Tel/Fax +234 84 765 413 www.saction.org Design and layout: TulipsConsult [Niger Delta Citizens and Budget Platform] 2009 CONTENTS Abbreviations.................................................................. V List of tables and figures.................................................. VI Acknowledgments........................................................... VII Summary......................................................................... 1 Recommendations.................................................. 4 Methodology................................................................... 6 Background: Beyond Amnesty......................................... 7 Akwa Ibom State............................................................. 15 Bayelsa State................................................................... 27 Delta State....................................................................... 36 Rivers State.....................................................................
    [Show full text]
  • Killing at Will
    KILLING AT WILL EXTRAJUDICIAL EXECUTIONS AND OTHER UNLAWFUL KILLINGS BY THE POLICE IN NIGERIA Amnesty International is a global movement of 2.2 million people in more than 150 countries and territories who campaign to end grave abuses of human rights. Our vision is for every person to enjoy all the rights enshrined in the Universal Declaration of Human Rights and other international human rights standards. We are independent of any government, political ideology, economic interest or religion – funded mainly by our membership and public donations. Amnesty International Publications First published in 2009 by Amnesty International Publications International Secretariat Peter Benenson House 1 Easton Street London WC1X 0DW United Kingdom www.amnesty.org © Amnesty International Publications 2009 Index: AFR 44/038/2009 Original language: English Printed by Amnesty International, International Secretariat, United Kingdom All rights reserved. This publication is copyright, but may be reproduced by any method without fee for advocacy, campaigning and teaching purposes, but not for resale. The copyright holders request that all such use be registered with them for impact assessment purposes. For copying in any other circumstances, or for re-use in other publications, or for translation or adaptation, prior written permission must be obtained from the publishers, and a fee may be payable. Cover photo: Nigerian policeman in Katsina, 21 April 2007. © Associated Press/George Osodi KILLING AT WILL EXTRAJUDICIAL EXECUTIONS AND OTHER UNLAWFUL KILLINGS
    [Show full text]
  • Urban Land-Use Dynamics in the Niger Delta: the Case of Greater Port Harcourt Watershed
    Article Urban Land-Use Dynamics in the Niger Delta: The Case of Greater Port Harcourt Watershed Nimi G. Dan-Jumbo 1,* , Marc J. Metzger 1 and Andrew P. Clark 2 1 School of Geosciences, The University of Edinburgh, Edinburgh EH8 9XP, UK; [email protected] 2 School of Environment and Life Sciences, The University of Salford, Salford M5 4WT, UK; [email protected] * Correspondence: [email protected] or [email protected]; Tel.: +44-7561120814 Received: 8 October 2018; Accepted: 16 November 2018; Published: 20 November 2018 Abstract: Cities in developing countries are urbanising at a rapid rate, resulting in substantial pressures on environmental systems. Among the main factors that lead to flooding, controlling land-use change offers the greatest scope for the management of risk. However, traditional analysis of a “from–to” change matrix is not adequate to provide information of all the land-use changes that occur in a watershed. In this study, an in-depth analysis of land-use change enabled us to quantify the bulk of the changes accumulating from swap changes in a tropical watershed. This study assessed the historical and future land-use/land-cover (LULC) dynamics in the River State region of the Niger Delta. Land-use classification and change detection analysis was conducted using multi-source (Landsat TM, ETM, polygon map, and hard copy) data of the study area for 1986, 1995, and 2003, and projected conditions in 2060. The key findings indicate that historical urbanisation was rapid; urban expansion could increase by 80% in 2060 due to planned urban development; and 95% of the conversions to urban land occurred chiefly at the expense of agricultural land.
    [Show full text]
  • Architecture and Ikwerre Culture: Hidden Dimensions
    Nar. umjet. 41/1, 2004, pp. 69-81, N. Ono Imaah, Architecture and Ikwerre Culture... Original scientific paper Received: 10th May 2004 Accepted: 21st June 2004 UDK 39(669):72 NAPOLEON ONO IMAAH Rivers State University of Science and Technology, Department of Architecture, Port Harcourt ARCHITECTURE AND IKWERRE CULTURE: HIDDEN DIMENSIONS The culture of a people determines their architecture. However many circumstances obliterate some vital aspects of their culture and invariably their architecture. This situation leads less critical historians to an erroneous conclusion that some people, particularly Africans, south of the Sahara, do not have a history. The reasons for these risible conclusions represent the absence of visual information about the concrete records of achievements. Visual absence is often confused with virtual presence on the premise that seeing alone confirms believing. Generally, people measure the history of world science, technology, and the arts in artefacts and architecture; hence, they regard any culture lacking documented physical and visual evidence as primitive. Happily, historians are now becoming more informed as science and information technology now reveal what was invisible. Our attention focuses on Ikwerre people generally, but particularly on those who are resident in Evo/Apara, Rebisi/Port Harcourt, and Obio/Akpor kingdoms, whom the unbridled expansion eroding the building culture of the Ikwerre people, mostly challenges. Since the Ikwerre people, according to Woke et al. (1993:20), Prof. Echeruo (1993), and Chief Ichegbo (1992:14) respectively, have several versions about their origins and times of arrival at their present abode, there are bound to be marginal variations in their customs according to communities.
    [Show full text]
  • Enter Naija: the Book of Places
    ENTER NAIJA: THE BOOK OF PLACES 1 ENTER NAIJA: THE BOOK OF PLACES ENTER NAIJA: THE BOOK OF PLACES 2 ENTER NAIJA: THE BOOK OF PLACES A publication of the ENTER NAIJA: THE BOOK OF PLACES Team in partnership with Brittle Paper. The authors have asserted their moral rights under the Copyright, Design and Patent Act, 1988, to be identified as the authors of this work. Individual Contributions Copyright © 2016 by The Authors. All rights reserved. No part of this book may be reproduced, stored in a retrieval system or transmitted, in any form or by any means, without the prior written permission of the copyright owners. Cover concept and design: Otosirieze Obi-Young. Cover typeset: Otosirieze Obi-Young and Osinachi Prince Jacon. Cover photo: Otosirieze Obi-Young. 3 ENTER NAIJA: THE BOOK OF PLACES “A gathering of unsung, young but vibrant new writers . lush narratives. Each city blessed by the sensitivities of these young writers comes alive. This is an unusual collection . retro-experimental. What a concept. A new generation of storytellers talking back to home.” IKHIDE R. IKHELOA, Introduction. 4 ENTER NAIJA: THE BOOK OF PLACES CONTENTS 9 EDITORIAL 23 “Of Experience” ∙ Jigawa State “There Is a Country” by Amaka Jovita Ezeuchu by Otosirieze Obi-Young 26 “Unrequited Lust” ∙ Zuma Rock, 12 INTRODUCTION Abuja “Of Home, Exile, and Those Places in by D.E. Benson the Heart” by Ikhide R. Ikheloa 27 “Grumi Player” ∙ Northern Music by Osinachi THE NORTH 28 “Someplace Safe” ∙ Sabon Gari, Kano 15 “New City” ∙ Kano by Nonso Anyanwu by Arinze Ifeakandu THE
    [Show full text]