;“ufnf] SANGALO 2019

Board of Editors Bikram Gautam Dadin Pandey Manoj Pradhan Dr. Rishi Bastakoti Subas Dhakal

Youth Editor Ayushma Sharma

Computer Design Saru Shrestha

Published By Nepal Center of North Carolina (NCNC),Inc. 1020 Signal Creek Ln. Morrisville, NC

Printed At *ULI¿Q3ULQWLQJ&R5DOHLJK1&86$  

Disclaimer: The information, ideas, articles, and links provided herein do not represent official policies, proce- dures, or opinions of Nepal Center of North Carolina, Inc. (NCNC). The contents contained in the magazine have come from a variety of sources, including speeches, articles, field visits and public reporting's. Editors may not agree with all the contents of the magazine. NCNC is not liable for the damage to anyone due to the information contained in this magazine. Any error or information should be mailed to the editor at the above address. PAST EXECUTIVE COMMITTEES

Executive Committe 2000- 2001 Executive Committe 2006-2007 Executive Committe 2012-2013 Ishwar Devkota (President) Ishwar Devkota (President) Shilendra Devkota (President) Dr. Devendra M. Amatya ( Vice President) Nagendra Neupane (Vice President) 8GKDY.DUNL 9LFH3UHVLGHQW Annapurna Deo (Vice President) Dr. Sushama Pradhan (Vice President) Manoj Pradhan (Vice President) Dr. Bir Thapa ( Executive Secretary) Madhukar Devkota (Exec. Secretary) 6KLVKLU.KDQDO ([H6HFUHWDU\ Bibhor Rimal (Treasurer) Lekh Nath Dulal (Treasurer) Bharat Shrestha (Treasurer) Pramod Mishra (BoD) Shanti Rajlawat (BoD) Madhab Raj Bhattarai (BoD) Madan Risal (BoD) %DVDQWD.KDGND %R' Deepa Dawadi (BoD) -DQDN0DUKDWWD %R'  .LVDQ8SDGKD\D %R' Dr. Chiranjivi Bhattarai (BoD) 5DYL.& %R' 5DELQGUD.DUNL %R' Executive Committe 2002- 2003 Annapurna Deo (President) Executive Committe 2008- 2009 Executive Committee 2014-2015 Madhav Dhakal (Vice President) Nagendra Neupane (President) 'U7KDNXU.DUNHH 3UHVLGHQW Dr. Dasharath Lohar (Exe.Secretary) Yagya Acharya (Vice President) Dr. Tika Adhikari (Vice President) .LVDQ8SDGKD\D 7UHDVXUHU  3DP8SDGKD\D 9LFH3UHVLGHQW 5DELQGUD.DUNL 9LFH3UHVLGHQW Danile Goetz (BoD) Madhukar Devkota (Exec.Secretary) Dr. Batu Sharma (Executive Secretary) Shanti Rajlawat (BoD) 8GKDY.DUNL 7UHDVXUHU Sujata Dhungel (Treasurer) 6KUHH.DQWD*DXWDP %R' Shanti Rajlawat (BoD) Deepa Dawadi (BoD) Dr. Padam Poudel (BoD) 5DELQGUD.& %R' Dr. Shreekant Adhikari (BoD) Shiva Prakash Mishra (BoD) Dil Bhattarai (BoD) Executive Committe 2004-2005 Bhimsen Basnet (BoD) %DONULVKQD8SDGK\D %R' Ishwar Devkota (President) Nagendra Neupane (Vice President) Executive Committe 2010- 2011 Executive Committee 2016-2017 Madhukar Devkota (Vice President) Arun Dhital (President) Dr. Sushama Pradhan (President) Dr. Roshan Shrestha (Exe. Secretary) 8GKDY.DUNL 9LFH3UHVLGHQW Dr. Batu Sharma (Sr. Vice President) .LVDQ8SDGKD\D 7UHDVXUHU 6KUHH.DQWD*DXWDP 9LFH3UHVLGHQW Dr. Archana Lamichhane (Vice President) Madhav Dhakal (BoD) Shailendra Devkota (Exec. Secretary) Yam Shreshtha (Executive Secretary) Bibhor Rimal (BoD) 8WWDP6HGDL 7UHDVXUHU 'U8QQDWL2MKD -RLQW6HFUHWDU\ Yagya Acharya (BoD) Dr. Rajesh Subedi (BoD) Bhimsen Basnet (Treasurer) Srijana Guiliford (BoD) %DVDQWD.KDGND %R' Bhim Timalsina (BoD) Shashi Bhatta (BoD) Amar Ale (BoD) Prabha Marhatta (BoD) Ram Poudel ‘RP’ (BoD) Arun Sapkota (BoD) Ghanendra Adhikari (BoD) Editorial

:H DUH YHU\ SOHDVHG WKDW WKH WK LVVXH RI /RQHO\3ODQHW¶VDQQXDO%HVWLQ7UDYHO/LVWLQ 6DQJDOR FROOHFWLRQ WKHRI¿FLDOSXEOLFDWLRQRI1HSDO Besides disseminating the information about Nepal Center of North Carolina (NCNC) is in your hands. In to potential travellers, Sangalo also sheds lights on this issue of Sangalo, we chose to feature Visit Nepal the achievements of Nepalese immigrants living in 2020 on the cover page of the magazine to reinforce North Carolina. In this issue of the magazine, we the fact that Nepal remains the pristine place on the are featuring prominent Nepalese entrepreneurs planet earth to explore and praise its beauty. NCNC who took the business risk and managed to turn urges everyone to consider visiting Nepal in 2020 that into meaningful return. We hope the advice and also requests all Nepali organizations around the IURP WKHVH H[SHUWV ZRXOG EH RI VLJQLILFDQWYDOXH WR world to spread the message to make the campaign a aspiring newcomers vying to venture into the world of grand success. entrepreneurship. We’ve also asked senior members $IWHU WKH VXFFHVV RI 9LVLW 1HSDO Lumbini, Sangalo in its current shape and we express our sincere and improper transportation infrastructure led the gratitude to NCNC executive committee, Tourism Board to postpone the campaign to 2020. writers and contributors, and all the individual and :RUNVDUHXQGHUZD\WR¿QLVKFRQVWUXFWLRQRI*DXWDP business advertisers who chose to patron Sangalo. Buddha International Airport before 2020 and the Despite our due efforts, there could still be some government has planned various activities through errors and omissions. We apologize in advance out the year to surpass the target of 2 million tourist IRU WKHVH GHILFLHQFLHV DQG H[SHFW \RXU YDOXDEOH arrival in 2020. Currently, the country sees nearly one suggestions to make Sangalobetter in days to come. PLOOLRQWRXULVWYLVLWRUV\HDUO\1HSDOLV¿IWKDPRQJWKH Finally, the board of editors would like to wish all the Top 10 countries to visit in the world and number one community members a very happy Dashain & Tihar in Best Valued Destination in the World, according to  3UHVLGHQW V0HVVDJH

Respected Community Members, signifying the importance of our rich cultural diversity; both Wake County and HAPPY BIJAYA DASHAMI AND Town of Morrisville have proclaimed the TIHAR 2076! third Saturday in April of every year as NEPAL DAY throughout the Wake This is again the time of the year and I County. This is the most significant feel highly honored and privileged for achievement and the moment of great the opportunity to wish all of you and pride and honor to all the Nepalese living your families the happiest Bijaya in and around Wake County, North Dashami and Tihar 2076. On behalf of Carolina and the United States of NCNC Board of Directors, my wife America. This was possible because of Puja, and my kids Ayushma & Aarnav, consistent efforts and dedications of our I wish that the upcoming festivals be senior leadership including past the harbinger of good health, presidents, trustees and advisors; and our prosperity, success and happiness in community’s unity and commitments every step of your life ahead. May towards the community service over the Goddess Durga and Laxmi bestow all last 20 years under the umbrella of of you with her blessings! NCNC. I urge every community member to work responsibly and maintain the For the last 20 years, NCNC has been working consistently dignity of this utmost attainment. to preserve the cultural heritage, traditions and customs of Nepal and to protect the Nepalese identity. Celebrating Our team came with the vision of making NCNC more festivals like Dashain and Tihar together with all transparent, institutionalized, professional, accessible, community members creates the exuberant feeling of welcoming, inclusive and well organized for future togetherness and homely despite being thousands of miles generations. We continue to seek your full cooperation and away from home. It also helps us to protect and pass on the active participation. Collaboration, partnership, teamwork, goodness of our rich traditions and cultures to the future inclusiveness and participatory approach have remained generations and the broader community. In a long run, it our topmost priorities. We have successfully collaborated will help us to strengthen our roots and engrave our unique with several local and regional organizations like NASeA, identity in the hearts of our future generations. NCAAT, HSNC, NRNNC, NCNLS, NepaRhythm, EVC, Humsub, HSS etc. on varieties of activities. Through our In my close association with NCNC for last 10 years, I have MDPRC committee, we have been very successful in been very fortunate to witness its proud history, an significantly boosting the membership strength of our incredible growth, and very rich social and moral values. organization. Through our community outreach program, This flourishing Nepalese community has provided our team has been putting a tremendous effort to listen to volunteers like me with an implausible opportunity for every concerns of the community member, provide community service. It has been a wonderful opportunity for necessary help whenever needed and maintain a constant me to serve this community as the president of NCNC for and cordial relationship with every member of the the years 2018-2019. Our dynamic team have thriven to community. Our vision has remained very clear in making work diligently to maintain the dignity of NCNC and propel NCNC a common home for all Nepalese living in North its proud history further by means of several community Carolina and I would like to sincerely request all of you to activities. Few of the signature community activities get the NCNC membership and encourage others to gain include the weekly Nepali Pathashala, Adopt- a- highway the membership as well. and Blood Drive. In order to meet our goals of preserving the cultural heritage, traditions and customs of Nepal; Finally, I want to reiterate the fact that all these community promoting Nepalese arts, literature, music, dances and services have been possible because of this current BOD of customs; promoting educational, charitable, social and highly accomplished personalities with varieties of sport activities; providing networking opportunities for its knowledge and experience. I truly honor each BOD’s members; providing assistance to increase the welfare of leadership styles, spirit, enthusiasm and dedication to the the people of Nepal; providing information and moral community service. Once again, I would like to support to Nepali immigrants, students and new comers congratulate all the BOD members for outstanding with the integration in to the main stream of the USA and accomplishments under each of your committees. “Good providing emergency support to the people in need; we actions give strength to ourselves and inspire good organize countless activities for the community throughout actions in others.” - Please continue to serve the the year. I would like to take this opportunity to thank each community with positive attitude in whatever capacity you and every volunteer for your selfless service and could. wholehearted support, contribution, dedication and participation in these activities. As Mahatma Gandhi “I am only one, but I am one. I cannot do everything, said “Satisfaction lies in the effort, not in the but I can do something. And because I cannot do attainment, full effort is full victory”, all of us just everything, I will not refuse to do the something that I need to keep on contributing on our part and can do.” – I am very thankful for this great opportunity to transformation will happen spontaneously. serve this community as the president of NCNC, and I will continue providing my selfless service towards the benefit Nepalese are one of the fastest growing communities in of the entire community. North Carolina. Since its establishment in 1999, NCNC has been facilitating all of us to be more organized and increase our visibility to the broader community and local Sincerely, governments. In recognition of our significant contribution to the socioeconomic wellbeing of the Wake County, North Dr. Batu Sharma Carolina and the United States of America as a whole, and President, Nepal Center of North Carolina, Inc.      


*4,04*'4  (*4 *$ 4 '4 )0%4
 4 *+ (-4 *4!4 *+ (-4  4 *+ (.4

 #*'40.'4 '%4 &4  '+(4+(.4 20, 14*,*34 ) (,4*,*34 *+0**4

(" 4*%4 '4 * +(4%4 '4/,4 ) '*4 )4 '*4 )4 '*4

 14,.* 4 )4 (34 )4 '*4 )4 '*4

BoT AND ADVISORS MESSAGE

Dr. Thakur Karkee, BoT Chair $VDFKDLURIWKH1HSDO&HQWHURI1RUWK&DUROLQD,QF 1&1& %RDUGRI7UXVWHHV %27V    DQG IRUPHU 3UHVLGHQW   , ZRXOG OLNH WR UHÀHFW RQ WKH VXFFHVVHV WKLV organization has achieved over the years and activities it offers. The success has been possible due to visions and unconditional love of the leaders and volunteers of this RUJDQL]DWLRQ OLNH \RX 2Q EHKDOI RI P\VHOI DQG IDPLO\ , ZRXOG OLNH WR ZLVK \RX DOO D YHU\ SURPLVLQJ DQG IXO¿OOLQJ IHVWLYDO VHDVRQ DQG 1HZ

Ashok Khanal, BoT Member I will like to congratulate current and past BoD members of NCNC for their outstanding work to preserve our culture and heritage, and giving continuity to it. Nepal Day parade, 5XQ1HSDO%ORRG'RQDWLRQ1HSDOL6FKRRODQG$GRSW$+LJKZD\DUHWKHPDMRUZRUNVWKDW ORFDOFRPPXQLWLHVDUHEHQH¿WHGIURP$V1HSDOLFRPPXQLW\JURZVH[SRQHQWLDOO\WKHUHLVD QHHGRI1&1&¶VRZQFRPPXQLW\FHQWHULQWKLVDUHD7KHUHDUHPDQ\LGHDVÀRDWLQJDURXQG to build Nepali Temple and have community center within, which is an excellent idea that majority members agree upon and it is sustainable to run. Last but not least, Happy Bijaya 'DVKDPL WR DOO /HW¶V EH XQLWHG DQG ZRUN WRJHWKHU IRU WKH EHQH¿W RI ORFDO FRPPXQLWLHV

Arun Dhital, BoT Member NCNC’s long history, dedicated and able leaderships throughout its period from the inception has made NCNC more vibrant. Yearly celebration of festivals like Dashain, Teej, and educational services such as Nepali school for kids is serving well for the Nepali community to preserve Nepali culture and language among second Nepali generation. Programs like Nepal Day, Blood drive and Highway cleanup are noble ways to serve the broader community as well as means to establish Nepali identity. NCNC’s desire and the work towards building its own community center and place to convene and worship is yet another exemplary goal. Even though, there has been some concern of NCNC not been able to reach out to younger generation and broader community, I am sure we all can set aside our ego, and mend small differences and work for common good of the whole community. My best wishes to all Nepali community members and NCNC leadership team.

Manoj Pradhan, BoT member +DSS\'DVKDLQDQG7LKDU0\EHVWZLVKHVWRDOORI\RX I would like to congratulate the current executives for successfully carrying out the multitude of NCNC programs and bringing the community members together in all the activities. I hope this harmonious effort will keep continuing like a Himalayan river forever.

Udhav Karki, BoT Member cd]l/sf l:yt gy{ Sof/f]lngf /fHodf 5l/P/ /x]sf g]kfnLx?nfO{ ;+ul7t ub}{ g]kfnL efiff / ;+:s[ltsf] ;+/If0f tyf ;Daw{gdf ljz]if cu|0fL e"ldsf v]n]/ ;dfhsf] x/]s tx / tKsfsf] hgd'bfonfO{ cfk;L ;dembf/L tyf ldqtfdf afFWg ;kmn o; ul/dfdo ;+u7g NCNC sf] af]8{ ckm 6«i6Lsf] x}l;otn] o; ;+u7gsf] ljsf; ljZjf; tyf ;'b[l9s/0fdf cxd\ e"ldsf lgjf{x ug'{x'g] kbflwsf/L, sfo{;ldlt ;b:o tyf o; ;+u7gnfO{ z'?b]lv g} dfof tyf ;xof] u ug'{x'g] ;a} hg;d'bfodf ljhof bzdL tyf lbkfjnLsf] xflb{s d+undo z'esfdgf ;lxt cfufdL lbgdf ;+:yfsf] ;jn tyf ;Ifd g]t[Tjsf] sfdgf ub{5' . Dr. Dasharath Lohar, Advisor 1DPDVWH ,W LV D JUHDW SOHDVXUH WR VHH DQRWKHU LVVXH RI 6DQJDOR SUHVHQWHG WR WKH community by Nepal Center of North Carolina (NCNC). In the last 20 years, we have JURZQPDQ\IROGQRWRQO\LQQXPEHUVEXWDOVRLQWKHUDQJHRIDFWLYLWLHVWKDWZHGRDVD community. In spite of challenges in meeting expectations of an ever JURZLQJ FRPPXQLW\ , FRPPHQG WKH WUHPHQGRXV HIIRUWV RI 1&1& RI¿FHUV LQ bringing quality programs for us. We continue to mature as a community in a faraway land in choosing our representatives and interacting with the larger FRPPXQLW\ ZH OLYH LQ 2XU VFULSWXUHV VDLG6DQJKH 6KDNWL .DOL\XJH XQLW\ LV WKH VWUHQJWKLQ.DOL\XJDWKHSUHVHQWWLPH 0D\ZHDOOUHPDLQXQLWHGDVDFRPPX nity in preserving our Sanatana tradition, and serving the land we call home.

Dr. Achyut Sharma, Advisor Congratulations to the Nepal Center of North Carolina (NCNC), on the proclamation of an annual Nepal Day by the government of Wake County, North Carolina. I would like to thank the executive committee of NCNC for their hard work and their involvement in community service. In particular, I would like to thank the NCNC for their cultural programs and social activities supporting the Nepali Community. I ZLVKWRVHHWKHLUFRQWLQXHGVHUYLFHWRZDUGVEHQH¿WWLQJWKH1HSDOLFRPPXQLW\LQ1RUWK Carolina. I am so proud to have such a dynamic team members of executive com mittee.

Dr. Sushama Pradhan, Advisor NCNC has come a long way from being an organization with only a few activities a year to more than an activity a week. It shows the tremendous growth and success the NCNC has achieved over the 20 years. It would not have been possible without the persistent SDVVLRQDWHHIIRUWE\1&1&YROXQWHHUVDQGFRPPXQLW\PHPEHUVSUHVHQWDQGSDVW 2XUDFWLYLWLHVKDYHJURZQLQPDQ\GLUHFWLRQVFXOWXUHFHOHEUDWLRQ 'DVKDLQ1HZ

         

    
 

 
 
 


    

    

     

;)E 9=A-)#@AI #2).+- #=F 9=A-I #2).+- [email protected]) "#1)I9=)@A )7A=#2I #2).+- ")@AI#=F C=-#5 2#FA97 #=7)= 7.+-A'#2) 922FI!;=.7+@ !9CA-I-#;)2I.22

  
 

DRAFT BEER FOOD SERVICE BEER TO-GO

A variety of beer styles will rotate through our The diverse restaurant menu includes; We have a curated beer selection of over 100 bar with 12 constantly changing taps. Our Canadian poutine, Montreal smoked meat, bottles ready for take-out. Any item can be draft list updates automatically to notify our Nasheville-style hot chicken, gourmet mixed and matched to allow the customer the customers what they wLOO¿QGLQWKHVKRS hotdogs, sandwiches, and SL]]D ODWEUHDGV freedom to expand their palate.

dĞůϵϭϵϴϱϲϱϱϳϵ :ĞƐƐŝĐĂE͘,ŽůŵĞƐ &Ădžϵϭϵϴϱϲϱϲϵϵ ŽĂƌĚŽĨŽƵŶƚLJŽŵŵŝƐƐŝŽŶĞƌƐ W͘K͘ŽdžϱϱϬZĂůĞŝŐŚ͕EϮϳϲϬϮ

August 19, 2019

Dear Nepalese Community and Members of the Nepal Center of North Carolina,

As chair of the Wake County Board of Commissioners, I would like to send you warm greetings as you celebrate Dashain and Tihar and thank you for your contributions to our community. It was my pleasure this year to honor our Nepalese population by officially proclaiming the third Saturday of April as “Nepal Day” in Wake County and by participating in your celebration.

Wake County is growing by an average of 63 people a day—12 of those people are moving here from other countries, including Nepal. Each person who comes here brings different experiences, knowledge and perspectives. Diversity is one of our biggest strengths.

With your presence here in Wake County, you contribute to the cultural, academic and economic richness of our community. Your presence and contributions enhance our community and make Wake County among the best places to live, work, play and learn in the world.

Thank you to the Nepal Center for the important work that you do, and best wishes for the year ahead. Please always know that you have a friend in me.

Sincerely,

Jessica N. Holmes Chair, Wake County Board of Commissioners Dear Nepalese Community,

I am honored to have the opportunity to thank you for your friendship and contributions to help make North Carolina a great place to live and raise a family on behalf of the entire Morrisville Town Council. In Morrisville we recognize that our strength is in our diversity, and we value each and every member of our community. We all come from different SDUWVRIWKH8QLWHG6WDWHV, and from different parts of the World, and we each bring our own unique perspective and traditions.

The greater Morrisville Region is very fortunate to have a large Nepalese community that chooses to devote their time and energy to helping others and building community. From blood drives, to litter sweeps to sharing the benefits of Yoga with your neighbors, you have inspired us and many others.

2QHRIRXUFRPPXQLW\KLJKOLJKWVWKLV\HDUZDVWhe NCNC Nepal Day Parade 201 in Morrisville. Many people, including numerous dignitaries, came out to celebrate the Nepalese community. We truly enjoyed all the friendly faces, colorful clothing, beautiful dance performances and other festivities. In addition to those who participated directly, many residents came out to enjoy the parade and join the celebration in the park.

It was my honor to recognize the contributions of the Nepalese community to Morrisville with a public proclamation in 201. I want to thank you for choosing to make your home in North Carolina. Every time you share a smile or conversation with a neighbor, we are a stronger community. Thank you for your continued contributions to the rich tapestry of cultures which has helped Morrisville be a vibrant, inclusive community, and great place to raise a family.

All the best, 7-&DZOH\ Mayor of Morrisville on behalf of the Town Council of Morrisville www.TownofMorrisville.org

7RZQ+DOO'ULYH_0RUULVYLOOH1&_3_)_WR ZQRIPRUULVYLOOHRUJ 

 

‡’ƒŽ‡–‡”‘ˆ‘”–Šƒ”‘Ž‹ƒ   –‘„‡”ͷǡʹͲͳͻ ›‡ƒ”‡’ƒŽ‡•‡”‘–Š‡”•ƒ†‹•–‡”•ǡ  ˆ‡™‘–Š•ƒ‰‘ǡ ƒ––‡†‡†–Š‡—•‹ ƒŽŽ‡šƒ†‡” ƒ‹Ž–‘ƒ––Š‡ǡƒ‘˜‹‰—•‹ ƒŽ–”‹„—–‡‘ˆƒ ‹‹‰”ƒ–ǡ™Š‘™‘—Ž†‰‘‘–‘„‡ ‘‡–Š‡ƒ–‹‘•ǯ–‡†‘ŽŽƒ”ˆ‘—†‹‰ˆƒ–Š‡”ǡ•‡”˜‹‰ƒ––Š‡•‹†‡‘ˆ ”‡•‹†‡– ‡‘”‰‡ƒ•Š‹‰–‘Ǥ  • Ž‘‘ƒ––Š‡‰”‘™‹‰‡’ƒŽ‡•‡‡”‹ ƒ ‘—‹–›‹–Š‡”‹ƒ‰Ž‡‡‰‹‘ǡ •‡‡ƒ›Ž‡šƒ†‡” ƒ‹Ž–‘•Ǥ‡”‹ ƒ•ǡŽ‹‡›‘—ǡ™Š‘Šƒ˜‡Ž‡ˆ––Š‡‹”‘–Š‡”Žƒ†ǡ–‘–ƒ‡–Š‡‹”•Š‘––‘‰”‡ƒ–‡••‹‘”–Š ƒ”‘Ž‹ƒƒ†–Š‡‹–‡†–ƒ–‡•‘ˆ‡”‹ ƒǤ  •ƒ‡Ž‡ –‡†‘ˆˆ‹ ‹ƒŽ‹ƒ‡‘—–›ǡ ƒ˜‡”›’”‘—†‘ˆ–Š‡”‡ƒ”ƒ„Ž‡ —Ž–—”ƒŽǡ‡ ‘‘‹ ǡƒ†•’‹”‹–—ƒŽ –”ƒ•ˆ‘”ƒ–‹‘‡ƒ Š‘ˆ›‘—ƒ”‡„”‹‰‹‰–‘–Š‡–ƒ–‡‘ˆ‘”–Šƒ”‘Ž‹ƒǤ  ‘—””‡ƒ”ƒ„Ž‡ˆŽ‹‰Š–‹‘”–Šƒ”‘Ž‹ƒ™‹ŽŽ ‘–‹—‡–‘•‘ƒ”–‘–Š‡‰”‡ƒ–‡•–‘ˆŠ‡‹‰Š–•Ǩ  ‘ƒŽǡ‘‹ƒǡƒ›ƒƒ† ™‹•Š‡ƒ Š‘ˆ›‘—ƒ˜‡”› ƒ’’›ƒ†”‘•’‡”‘—•ƒ•Šƒ‹ƒ†‡™‡ƒ”Ǩ  ‹ ‡”‡Ž›ǡ

Steve S. Rao Council Member At Large, Former Mayor Pro Tem, Town of Morrisville Š––’•ǣȀȀ™™™Ǥˆƒ ‡„‘‘Ǥ ‘Ȁ–‡˜‡ƒ‘Ȁ

7KLVJUHHWLQJZDVSDLGIRU6WHYH5DR1RWD[SD\HUIXQGVZHUHXVHG

7RZQ+DOO'ULYH_0RUULVYLOOH1&_3_)_WR ZQRIPRUULVYLOOHRUJ

ASPIRING TO START A NEW BUSINESS? HEAR FROM THE EXPERT ENTREPRENEURS North Carolina houses Nepalese immigrants from all walks of life – people working in blue collar jobs WR WKRVH ZRUNLQJ LQ ZKLWH FROODU MREV$QG WKHUH DUH WKH HQWUHSUHQHXUV ZKR E\ GH¿QLWLRQ RUJDQL]HV DQG RSHUDWHVDEXVLQHVVRUEXVLQHVVHVWDNLQJRQJUHDWHUWKDQQRUPDO¿QDQFLDOULVNVLQRUGHUWRGRVR,QWKLVLVVXHRI Sangalo, we are featuring some selected Nepalese entrepreneurs from different sectors with a goal of providing expert advice to the newcomers aspiring to start a new business. We hope such advice would be YHU\EHQH¿FLDOWRWKHHQWLUHFRPPXQLW\ Note:We reached out to as many entrepreneurs as possible living in the RTP area to collect their information, but few of them declined our request. Q. Please provide a brief plan guides you through each summary of your business: stage of starting and managing $ (TXDJHQ LV D IXOOVHUYLFH your business. You’ll use your PXOWLGLVFLSOLQDU\ HQJLQHHULQJ business plan as a roadmap for DQGGHVLJQ¿UPZLWKDGHGLFDWHG how to structure, run, and grow team of experienced personnel your new business. It’s a way to SURYLGLQJDIXOOUDQJHRIFRVWHI think through the key elements fective engineering, and con of your business. You can use struction management services. this business plan to get funding We cover wide range of markets or bring on new business part such as power, industrial, build ners. Investors want to feel con LQJRLODQGJDV,WVPDLQRI¿FH ¿GHQWWKH\¶OOVHHDUHWXUQRQWKHLU is located in Cary, NC with a investment. Your business plan EUDQFKRI¿FHLQ+RXVWRQ7; is the tool you’ll use to convince Q. What prompted you to people that working with you start the business? What were or investing in your company. the underlying motivational Q. What was the break-even factors? What previous jobs period? How did you manage did you have? to go through the period? $ 3DVVLRQ DQG 6HOIH[SUHVVLRQ 6WDUWLQJ P\ RZQ $ )RUPHWKHSHULRGODVWHGIRUPRQWKV,XVHGP\ business allowed me to make a living while pursuing LQLWLDOLQYHVWPHQWWRPDLQWDLQWKHFDVKÀRZ VRPHWKLQJIRUZKLFK,KDGDVWURQJSDVVLRQ2ZQLQJ 4 :KDWDUHWKH¿QDQFLDOULVNVDQGJDLQVRQHKDV a business also allowed me to be more creative and to consider before getting into a profession you express myself. are in? %HIRUH,FDPHWR86,ZDVDOHFWXUHUDW,QVWLWXWHRI $ :KHQ\RXKDYHDVWHDG\MRE\RXU¿QDQFLDOULVNV (QJLQHHULQJ781HSDO0\SUHYLRXVHPSOR\PHQW are very low. You can rely on your paycheck to come LQ86LQFOXGHG6HQLRU(QJLQHHUDW(QWHUJ\&RUSR in regularly and you know what to expect. Starting a ration and Duke Energy, and Principal/Engineering business means that your stable income may disap Manager at Siemens. pear, especially if you are going full time. This is a Q. What knowledge and licenses you had to KXJH¿QDQFLDOULVNWKDW,FDOFXODWHGEHIRUH,VWDUWHGD acquire before starting the business? Did you get business. It is probably one of the most uncomfort any help from fellow Nepalese in the process? able parts of going out on your own. A. You will need a professional engineering license. Q. What would be your suggestion to an aspiring 1&ODZUHTXLUHVWKDWWKH¿UPPXVWKDYHWZRWKLUG entrepreneur trying to start a business similar to of its members licensed professional engineer to yours? perform engineering services in North Carolina. $ &DVK ÀRZ LV RQH RI WKH PRVW FRPPRQ UHDVRQV Q. What was your initial investment (approx- for startup failure. If you have a steady job, you set imate) for starting the business? Did you take up a business before you leave your current job. any loans? If so, please summarize the process of Write a business plan, obtain all required business applying for a business loan. permits/licenses, ensure you will not have a cash $ ,KDGDQLQLWLDOLQYHVWPHQWRI.,ZDVQRW ÀRZ able to get a business loan, but I did have a home problem for few quarters and then you may quit your equity line of credit. In my experience, it was very current job. GLI¿FXOWWRJHWDEXVLQHVVORDQIURPWKHEDQNIRUD Identify best opportunities and focus on few things VWDUWXS7RJHWDEXVLQHVVORDQ\RXZLOOQHHGDJRRG ¿UVW

Sangalo 2019 2 Issue 19, Year 19 Q. Please provide a brief ZRUOG DQG WR IXO¿OO 1RUWK summary of your business: Carolina’s licensing require $ , DP WKH &(2 RI (YHUHVW ments. I attended Fonville Technology Services LLC. Morisey Center for Real 8QGHU WKLV //& ZH KDYH Estate Studies for the Real Estate three main businesses, Real Broker Prelicensing Course, Estate, Professional Technical ZKLFK LV  KRXU LQFODVV Servicesand Retail. The LLC introductory level real estate was registered in Durham principles and practices course &RXQW\ LQ  7KH WRWDO with heavy emphasis on real revenue is approximately three estate brokerage law and millions. In this piece, I will practice. I passed National and focus my discussion on real State Licensing Exams and estate business. became a Licensed Provi I am an independent Real sional Broker (PB). After ad (VWDWH $JHQW DI¿OLDWHG ZLWK GLWLRQDO  KRXUV RI &RQ Lifstyl Real Estate Raleigh. I tinuing Education and one VWDUWHGWKLVEXVLQHVVLQ$SULO0\H[SHUWLVHLVWR year of active practice, I ‘dropped’ my “P” to help buy, sell, and lease residential and commercial become a full Broker, actively facilitating real properties. I also provide help in securing loans and estate transactions in the State of North Carolina. provide a wide range of real estate services. I was inspired by fellow Nepalese in the business, Q. What prompted you to start the business? and should I have requested help, I am sure I would What were the underlying motivational factors? have gotten it. What previous jobs did you have? Q. What was your initial investment $,DPSDVVLRQDWHDERXWVHUYLQJFRPPXQLW\DWODUJH (approximate) for starting the business? Did you What better way to serve, then to make their take any loans? If so, please summarize the process of $PHULFDQ GUHDP RI KRPH RZQHUVKLS D UHDOLW\ applying for a business loan. Working for resettlement agencies for over 10 years, A. My initial investment to start my real estate PDGH PH DZDUH RI KRZ GLI¿FXOW LW ZDV IRU QHZ EXVLQHVVZDVDSSUR[LPDWHO\ZKLFKLQFOXGHG immigrants to navigate the real estate world tuition, books, and licensing exam fees. I didn’t take and eventually buy homes and businesses. The any loan; however, loan is available for people who passion to help people to realize their dream, is the QHHGLW,QDQ\EXVLQHVVWKH¿UVWVWHSLVWRGHYHO underlying motivational factor that prompted me to op a business plan and contact a funding institution start my real estate business. (banks, credit unions, etc.) and to do that the best I had a wide range of jobs in the past, from school point of contact for anyone wanting to start small teacher in Nepal to university administrator in business is your local Small Business Administration Canada. In Bangkok, I worked as Chief RI¿FHDQG6&25( KWWSVZZZVFRUHRUJXVVPDOO Administrator of renewable energy project funded EXVLQHVVDGPLQLVWUDWLRQVED DQG KWWSVFDUROL by the European Commission. As project manager in QDVPDOOEXVLQHVVRUJ  )RU EXVLQHVV SODQ 6&25( WKH8QLWHG1DWLRQV(QYLURQPHQW3URJUDP 81(3  volunteers will walk you through the process and I was instrumental in producing Environmental more. For business loan, the banker will guide you Atlas of Change series that produced over 10 through the loan process. Small Business Adminis DWODVHVRIHQYLURQPHQWDOFKDQJH,HQWHUHGWKH¿HOGRI tration (SBA) loans are available at low interest rates. UHVHWWOHPHQW LQ  ZKHQ WKH %KXWDQHVH Q. What was the break-even period? How did UHIXJHHVVWDUWHGEHLQJUHVHWWOHGLQWKH86,ZRUNHGDV you manage to go through the period? Resettled Coordinator at Lutheran Social A. The real estate business is a low (monetary) in Services of South Dakota, until I moved to North vestment, high return business, meaning you can &DUROLQD LQ  &XUUHQWO\ , DP DQ (PSOR\PHQW EUHDNHYHQZLWKLQ\RXU¿UVWIHZWUDQVDFWLRQV6LQFH &RRUGLQDWRU DW 8 6 &RPPLWWHH IRU 5HIXJHHV DQG WKLV LV P\ SDUWWLPH MRE EUHDNHYHQ SHULRG ZDV ,PPLJUDQWV 86&5,1& LQ5DOHLJK around six months. Personally, I felt that the time Q. What knowledge and licenses you had to and hard work that went into getting my license and acquire before starting the business? Did you get keeping it active was more of an investment. Thanks any help from fellow Nepalese in the process? to my family, friends, and Nepali community mem A. I went back to real estate school to acquire bers who have trusted me, and stuck with me through knowledge and understanding of the real estate WKHVWDUWXSSHULRGDQGEH\RQG

3 4:KDWDUHWKH¿QDQFLDOULVNVDQGJDLQVRQHKDV ethical standards, has the potential to reach their to consider before getting into a profession you goals, serving their own community members. are in? Q. Please share any other relevant factors or your $7KHUHLVORZ¿QDQFLDOULVNEXWKLJKHWKLFDOULVN unique experiences not covered above? in the real estate business. Agents are required to A. Working with the community has been a reward abide by the rules and regulations set forth by North ing experience. I feel privileged to witness the hand Carolina Real Estate Commission (NCREC) and any ing over of keys to new homeowners and see the comprises made, will lead to severe consequenc smiles and joy of the family. es, and bad reputation. Maintaining high ethical Q. What would be your suggestion to an aspiring VWDQGDUGLVDPXVW7KHUHLVGH¿QLWHO\SRWHQWLDOIRU entrepreneur trying to start a business similar to KLJK ¿QDQFLDO JDLQV LQ WKLV SURIHVVLRQ  7KH EHVW yours? part of this profession is that you can set your own A. Go for it, there is room for all of us practicing in ¿QDQFLDO JRDOV DQG LQ D JURZLQJ FRPPXQLW\ OLNH 1RUWK&DUROLQD5HDO(VWDWHLV¿QDQFLDOO\DQGVRFLDO the Nepali community, every Agent that maintains O\UHZDUGLQJSURIHVVLRQ:HOFRPHWRWKHFOXE

First of all, I am very glad and happy that NCNC have some knowledge and skills about the related is publishing Sangalo. I am ¿HOG 7KH NLQG RI EXVLQHVV sure that there will be very that I started did not re useful and knowledgeable TXLUH DQ\ VSHFL¿F OLFHQVH information available in the 2I FRXUVH PDQ\ 1HSDOHVH Sangalo. I really appreciate friends helped me through NCNC family for giving me lots of ways in the beginning a chance to express my opin and I am very fortunate and ions and experience. thankful to them. Q: Please provide a brief Q: What was your initial summary about the busi- investment for starting the ness: business? Did you take any $,QWKHEHJLQQLQJRI loans? If so, please summa- I started a convenience store rize the process of applying DVP\¿UVWEXVLQHVVDQGUHJ for a business loan. istered a company named $:KHQ , VWDUWHG WKH EXVL Diamond H Inc. in Newton ness it was very different *URYH1&:HKDGDERXW than how it is now. However people working together to initially the investment was run the business at the time. DURXQG N WR N SOXV I purchased a running franchise business therefore it liquid assets but it depends on the location and vol was already doing good sales which helped to grow ume of the business. In my case, I didn't get any loan the business even faster with making satisfactory towards the business. LQFRPH1RZLQ,RZQWKHVDPHEXVLQHVVLQ Q: What was the break-even period? How did Glenwood Ave Raleigh NC. you manage to go through the period? Q: What prompted you to start the business? $6WDUWLQJDEXVLQHVVLVQRWHDV\LWLVYHU\GLI¿FXOW What were the underlying motivational factors? We have to follow all the rules and regulations of the What previous jobs did you have? county and state. We have to be up to date for every $(YHQWKRXJKDVDSURIHVVLRQ,ZDVLQWKHHGXFD inventory and sales of the business. We have to pay WLRQDO¿HOG UHVRXUFHSHUVRQ LQ1HSDOZHDOVRUDQD rent, taxes, salaries and other bills for the business. business together with the family. Perhaps that was 6RPHWLPHVLWLVYHU\GLI¿FXOWWRPDQDJHWKRVHELOOV the reason I am interested in owning a business. Here And I had to work myself to minimize the labor cost LQWKH8QLWHG6WDWHVSUHYLRXVO\,ZRUNHGLQFRQYH etc. nience stores and manufacturing company as well. 4:KDWDUHWKH¿QDQFLDOULVNVDQGJDLQVRQKDV Q: What knowledge and licenses you had to ac- to consider before getting into a profession you quire before starting the business? Did you get are in? any help from fellow Nepalese in the process? $:HQHHGWRLQYHVWODUJHLQLWLDODPRXQWWRVWDUWWKH $'H¿QLWHO\WRVWDUWDQ\NLQGRIEXVLQHVVZHVKRXOG business and there can be a risk if we don't follow the

Sangalo 2019 4 Issue 19, Year 19 proper way to run it. There are lots of competitions Q: What would be your suggestion to an aspiring among the business. So we have to be careful about entrepreneur trying to start a business similar to that each and every thing. yours? Q: Please share any other relevant factors or your $

Q. Please provide a brief sum- feel free to contact me with mary of your business: out hesitation. $ , DP SURYLGLQJ ¿QDQFLDO Q. What was the break- VHUYLFHV VLQFH  /LIH ,Q even period? How did you surance, Retirement planning, manage to go through the Investment, Real estate are the period? NH\DUHDV,KDYHRI¿FHVDW*DU A. I owned a running busi QHUDQG)XTXD\9DULQD3ULRUWR ness. It had already recovered these things, I did retail busi cost. However, investment ness, restaurants, fast foods and portion was recovered gradu liquor stores. ally. I have invested my own Q. What prompted you to saving to start the business. start the business? What were 4 :KDW DUH WKH ¿QDQFLDO the underlying motivational risks and gains one has to factors? What previous jobs consider before getting into did you have? a profession you are in? A. I always want to do my own A. Every business has own things. This gives me pleasure. risks and advantages. As Financial freedom, Time man there are various knowledge agement and belongingness are and licensing requirements, the factors that motivates me to do own business. I people management is always an essential area in our graduated as computer science major but never did business. We need people who perfectly understand any jobs. After graduation in the year 2000, I started customers’ needs. A right recommendation will bene liquor business. ¿WFXVWRPHUVDQGDZURQJRQHZLOOFUHDWHULVN Q. What knowledge and licenses you had to ac- Q. Please share any other relevant factors or your quire before starting the business? Did you get unique experiences not covered above? any help from fellow Nepalese in the process? A. I had spent so many years to do other businesses. $,QRXUEXVLQHVVEDVLFDOO\ZHQHHG¿QDQFLDOSURG But the satisfaction I got after starting this business XFW NQRZOHGJH WD[DWLRQ DQG EXVLQHVVUHODWHG ODZV LVGLIIHUHQW2QFH,VHOODOLIHLQVXUDQFHSROLF\,JHW We need work related licenses like Life Insurance an immense pleasure. This way I can protect a family license, Health Insurance License, Real Estate agent and manage the wealth as well. While I close a real license etc. The main thing is continuing education HVWDWH,JHWDJUHDWVDWLVIDFWLRQ,KHOSSHRSOHWR¿QG WKDWVKRXOGEHGRQHHYHU\\HDU0U5DELQ.DUNLZKR their dream homes. Helping others always gives you has been associated with the similar business helped great pleasure. me and still supporting me. Q. What would be your suggestion to an aspiring Q. What was your initial investment (approxi- entrepreneur trying to start a business similar to mate) for starting the business? Did you take any yours? loans? If so, please summarize the process of ap- A. You must be focused and up to date. You must plying for a business loan. have people friendly skill. Don’t waste time to do un A. Investment in service business is lower in compar necessary things, do the things that needs to be done. ison to other businesses. Anybody interested should

5 Q. Please provide a brief summa- a lot farther than it actually ry of your business: is. After some perseverance, A. Mega Inc. dba Mega Spa & we gained more insight on Brows. We opened a beauty salon the business strategies as for LQ-XO\RI,WLVORFDWHGDW what track we wanted our ( 1& +:<  6WH 3 'XUKDP business to take. As a result, 1&  :H FXUUHQWO\ KDYH  we started to gain hope and employees. meet our expected goals by Q. What prompted you to start the end of the second year. the business? What were the un- 4:KDWDUHWKH¿QDQFLDO derlying motivational factors? risks and gains one has What previous jobs did you to consider before getting have? into a profession you are A. Basically, my background is in? in accounting. In the beginning, A. The biggest thing you it seemed quite hard to establish have to understand is that P\VHOILQWKLV¿HOG%XWIHZRIP\ LWZRQ¶WKDSSHQRYHUQLJKW family friends recommended me to It generally takes a couple grab a good opportunity in the job of years to grow a business market if you can get an Estheti to your standards and you FLDQ/LFHQVH$IWHUEHLQJFHUWL¿HG must work hard to make as an Esthetician, we decided that it would be a good WKDWKDSSHQ,ZRXOGVD\,ZRUNHGIRUWKH¿UVW idea to join forces and start a beauty salon. two years which was the biggest challenge. It was Q. What knowledge and licenses did you acquire YHU\KDUGWRPDQDJHWLPHIRUP\IDPLO\2EYLRXVO\ before starting the business? Did you get any help hard work always pays off. from fellow Nepalese in the process? Q. Please share any other relevant factors or your A. Before starting the business, I was determined unique experiences not covered above? to have my own license so that I don’t have to rely A. There are so many hidden challenges that you only on others. I completed the licensing process within come across when you’re in that situation. During a year from Texas College of Cosmetology. There one year’s period, at some point we almost thought are pros and cons of everything and we got the same to quit business. But, because of my family support, feedback from fellow Nepalese. specially my husband who had managed some busi Q. What was your initial investment (approxi- QHVVRUJDQL]DWLRQVLQ1HSDOHQFRXUDJHGPHDQG¿ mate) for starting the business? Did you take any nally we did it. Last but not the least, competitive loans? If so, please summarize the process of ap- market, very low service rate, and mushrooming sa plying for a business loan. lon businesses around are the biggest challenges of A. For this type of business, you need initial capital this business. for the interior, equipment, and beauty supplies. You Q. What would be your suggestion to an aspiring have to have some liquid assets and it depends on entrepreneur trying to start a business similar to how you want to start. Regarding the investment, I yours? ZRXOGVD\WR*HWWLQJDORDQLVRQH $2QHWKLQJZHKDYHUHDOL]HGWKURXJKRXWRXUH[SH of the biggest challenges at the beginning. Fortunate ULHQFHLVKRZGLI¿FXOWLWUHDOO\LV7KHPDUNHWIRURXU ly in our case, we had assets saved up that we could profession has grown exponentially and you have to invest in the business. move strategically to prosper. That being said, own Q. What was the break-even period? How did you ing a business has been one of the most enriching manage to go through the period? experiences and we have learned so much in the pro $7KH¿UVW\HDURUWZRDIWHUVWDUWLQJDEXVLQHVVDUH cess. Although it is tough path to take, we believe that the most challenging times because the goal can seem anyone can achieve their goal if they want it enough.

Sangalo 2019 6 Issue 19, Year 19 Q. Please provide a brief summary of A. Service businesses like Liberty Tax require your business: low investment in contrast to retail, restaurants, and construction businesses. A. I have several businesses in North Investment amount also depends on various Carolina (Tax Service, Realtor, aspects such as advertising, size, and location Construction, and Restaurant), but my of the business. The process of business loan is very first business was Liberty Tax complicated; if you have any questions, please Service, which I started in the year feel free to contact me. 2003. Since then, I have gradually added offices in various other locations Q. What was the break-even period? How did around the Triangle. Now I have several you manage to go through the period? tax offices. Business is not just about making a profit, but also about creating A. The break-even period (BEP) is different for job opportunities and helping make each type of business. For example, the BEP for people’s life easier. I will be more than a restaurant is short, but it consists of ongoing happy to share any information with RABINDRA KARKI operating hassles. Unlike restaurants, the anyone interested in starting a Liberty Tax Service service industry generates cash flow slowly but business. without other extra hassles.

Q. What prompted you to start the business? What were the Q. What are the financial risks and gains one has to consider underlying motivational factors? What previous jobs did you before getting into a profession you are in? have? A. There are many risks to consider for a business because it A. I moved from Nepal in the year 1997 to Maryland. At first, requires a lot of time and dedication without the guarantee it was very difficult because I came without my family to a of achieving one's goals. Risk and gains change each year and place where I did not know anyone. I encountered it fluctuates constantly. You have to know that not differences in culture, work environment, and people’s everything is in your hands, even things like the weather can behavior. It took a long time and lots of struggle for me to influence customer influx. This means that you cannot eventually settle in North Carolina with my family. The years compromise on things that are under your control, such as before starting Liberty Tax, I worked for IBM. During those customer service, standard operating procedures, years, I researched a lot about starting a business and also marketing, and employee satisfaction. In order to be a worked part-time at a tax office to gain experience. My business entrepreneur, one has to have the capacity to face motivation came from my desire to work for myself and to bad times and endeavor. I believe perseverance is the key to create something for people like myself who were struggling the success of any business. initially. That is why I always say to take time when making Q. Please share any other relevant factors or your unique important decisions. Once you decide on something, you experiences not covered above? should never give up and put all of your effort to make it successful. A. I never felt like I had a unique experience, but now, when I look back and think about what I have achieved over the Q. What knowledge and licenses you had to acquire before past years, I feel a unique kind of satisfaction and happiness. starting the business? Did you get any help from fellow My struggles have made me successful and now I have the Nepalese in the process? luxury to help others. A. To start and operate my business activities, I needed Q. What would be your suggestion to an aspiring different kinds of licenses as well as continuing education entrepreneur trying to start a business similar to yours? courses. There were very few Nepali people in the Triangle area when I started this business. However, I did receive A. I would recommend aspiring entrepreneurs to take the support from my family and friends. They supported me by initiative to get started by learning everything about the coming to do their taxes at the Liberty Tax office I opened, business of their interest. For example, when I decided to and also referred customers. Now we have a much bigger open up the Liberty Tax, I first learned everything about Nepali community in the Triangle. I am always happy to help doing taxes and how to maintain a business. You have to stay anybody interested in starting a business or requiring any focused and dedicated through the ups and downs. I believe other assistance. that a positive attitude is everything because it gives you both strength and satisfaction. Q. What was your initial investment (approximate) for starting the business? Did you take any loans? If so, please summarize the process of applying for a business loan.

MY JOURNEY TO NEPAL

SHREYA DHAKAL 9LVLWLQJ1HSDOZDVDJUHDWH[SHULHQFHPokhara. We went by tourist bus which was a new went when he was young. It was very different from experience to me and I enjoyed a lot. The good thing WKHVFKRROVHWWLQJKHUHLQ86$ about this bus is that it has air conditioner and toilet I went to school there for 1 week. Teacherswere very LQVLGH5RDGVVLGHVZHUH¿OOHGZLWKEHDXWLIXOVFHQ nice so were my new friends. They had textbooks for ery which was very enjoyable. They also stopped at study but in America we study using work sheets. places where we could eat. In Pokhera we rented a They also have different types of benches for stu taxi and visiteddifferent places such as David Falls, dents to sit. It was different than in America. What I Mahendra Gufa (cave), Chemero Gufa, Begnas and like the best is that they have school uniform, but in )HZDODNHVHWF2QHGLIIHUHQFH,IRXQGEHWZHHQDQG America you have trouble choosing which cloths to .DWKPDQGXZDVWKDW3RNKDUDLVPXFKFOHDQHUWKDQ wear to school.Some teachers gave me books so that .DWKPDQGX,GLGQRWVHHSROOXWLRQLQ3RNKDUD I can catch up with what they were learning with. I stayed in Nepal almost 2 and half month. It was a After 1 week I couldn’t continue school because they great experience atour motherland. I learned Nepali were having summer vacation. culture and language. Maybe I will visit Nepal every My little brother and I liked to see baby goat and car other year. It was really nice to see my family and ry them in our hands while in the village. Sometime many relatives. I would like to go next year and also they would come in our garden and eat our corn and recommend for my friends in Nepali Pathasala here other plants. We would sometime help our neighbors in Morrisville to visit Nepal. put grass for goat and cattle. The best part was that

Sangalo 2019 8 Issue 19, Year 19

THE NEWSMAKERS:NC NEPALESE IN THE NEWS The Newsmakers is a new column the Sangalo has fessor of civil and environmental engineering who started this year. In this column, we are delighted to VSHFLDOL]HV LQ HDUWKTXDNH HQJLQHHULQJ$IWHU ¿QGLQJ showcase the achievements of Nepalese youth espe Professor Gavin the following fall semester, Sharma cially the second generation in our community in and took his advice that she should work on creating a around the RTP area. They are our pride. We want sensor that could reliably detect an earthquake and to recognize the youth achievers on their success in alert people living nearby. She wouldn’t have to start WKHLUUHVSHFWLYH¿HOGVWRLQVSLUHRWKHUV%DVHGRQWKH from scratch, as one of Gavin’s recent PhD students, facts and media coverage, this year we have chosen Anton Zaicenco, had developed an earthquake early two youth to feature. We will continue this initiative warning system for Vancouver, and had published his in future. Therefore, we urge our community mem methodology. bers to inform the Sangalo editorial team about the Three years later, Sharma has advanced algorithms media coverage received by our youth so that we can designed to detect pressure waves that travel through highlight them in the forthcoming issues. the Earth’s surface, and has implemented the meth RGLQSURWRW\SHGHYLFHV2YHUVSULQJEUHDNWKLV\HDU PRATIKSHA SHARMA Sharma demonstrated her work to 3UDWLNVKD6KDUPDLVD'XNH8QL Dr. Lok Bijay Adhikari, the chief versity Senior who is leading an of Nepal’s National Seismologi effort to install a nationwide cal Center and installed one of her earthquake early warning sys VHQVRUVLQKLVRI¿FH tem in Nepal. In the aftermath “If sensors of such a network were of the devastating Nepal Earth FORVH WR WKH HSLFHQWHU RI WKH  TXDNHVKHWRRNDQDFWLYH earthquake, they potentially could role in fundraising at her univer have alerted the people living in sity and helping out the victims .DWKPDQGXPRUHWKDQDPLQXWHEH in Nepal. Pratiksha teamed up fore it reached them,” said Gavin. with four other Nepalese stu “That’s enough time to have saved GHQWVDQGUDLVHGLQUH a lot of lives.” lief funds. They then visited Ne The technique Sharma decided to pal and spent a month visiting damaged areas and XVH WR GHWHFW WKHVH 3ZDYHV UHOLHV RQ D WULD[LDO DF deciding where the funds should be spent. This expe celerometer similar to those found in cell phones or ULHQFHPDGH3UDWLNVKDUHVROYHGWR¿QGDORQJHUODVW ¿WQHVV ZDWFKHV $ WULD[LDO VHQVRU FDQ GHWHFW WKHVH ing way to help people from such earthquakes in the disturbances along three axes. The challenging part future. After coming back from Nepal, Pratiksha of using a chip like this to detect earthquakes is in started working with Professor Gavin on creating a determining if signals coming from the three axes sensor that could reliably detect an earthquake and FRUUHVSRQGWRDXQLGLUHFWLRQDOFRPSUHVVLRQZDYH alert people living nearby. Her work was featured in “To test the system using actual ground motion mea 'XNH8QLYHUVLW\¶V3UDWW6FKRRORI(QJLQHHULQJQHZV surements taken with our sensor, we put it inside a KWWSVSUDWWGXNHHGXDERXWQHZVVKDUPDHDUWK long metal pole and stuck it into the ground, and then quake. I hit the ground nearby with a sledgehammer as hard After contributing to relief efforts in Nepal following as I could,” said Gavin. “And the sensor picked up WKHIRXUPDMRUHDUWKTXDNHVRI$SULODQG0D\ WKH3ZDYHVFDXVHGE\WKHLPSDFWDVFOHDUDVDEHOO ZKLFKNLOOHGPRUHWKDQSHRSOH3UDWLNVKD6KDU I was happily surprised at how well it worked right ma found she needed to do more to help prevent such off the bat.” DPDMRUORVVRIOLIHLQWKHORQJWHUP :LWKWKHGLI¿FXOWWHFKQLFDOSLHFHV¿JXUHGRXW6KDU “Entire villages were levelled to the ground. It was ma implemented her hardware setup into two earth KHDUWZUHQFKLQJ´VDLG6KDUPDDJUDGXDWLQJVHQLRU quake detection boxes and took them to Nepal during DW'XNH8QLYHUVLW\DQGQDWLYHRI1HSDOZKRKDGMXVW WKHVSULQJEUHDN2QHLVVLWWLQJDWWKH1DWLRQ ¿QLVKHGKHUIUHVKPDQ\HDUDWWKHWLPH$VDGRXEOH al Seismological Center while the other resides at a major in electrical and computer engineering and nearby radio station to test each in different environ computer science, Sharma believed she could scope ments. The latter works so well that Sharma can keep a project related to her studies that could help the WUDFNRIWKHGD\¶VFKDQJLQJWUDI¿FSDWWHUQVDVWUXFNV people of her home country. After contacting various roll over potholes on the roads outside. The former professors at Duke, she found Henri Gavin, a pro was left as a demonstration for the chief of the Na 9 tional Seismological Center, Lok Bijaya Adhikari. WOHRI%HDWPDNHUVKHOGLQ7RURQWR&DQDGD+LV “Heseemed impressed with the prototypes and ex musical works have been featured in Lyrical Lemon cited about the potential of a national early warning ade, Complex, Genius, earmilk, Sidewalk Hustle and system,” said Sharma. “He’ll be our main point of etc. Most of his works can be found in his spotify contact moving forward, which is a really important SDJH contact to have.” KWWSVRSHQVSRWLI\FRPDUWLVW-E(M8,*WS;6]\W There are logistical hurdles standing between Shar Q\0J8 ma and her ambition of implementing an early The following media coverage was prepared by Sea earthquake warning system for Nepal. A true nation mus Fay and published in Lyrical Lemonade on his ZLGHV\VWHPZLOOUHTXLUHWRVHQVRUVVSUHDG recently released song. throughout the country. While the components for the sensors themselves are not expensive, paying The Feelings Tend To Stay The Same people to install and monitor them in remote areas There’s something inherently venerable about song across the entire country would be, and the Nepalese ZULWLQJWKDWUHÀHFWVWKHWUXWKHYHQLIWKHWUXWKGRHVQ¶W government has many issues vying for space in their necessarily work toward the songwriter’s favor. Es budget. pecially when it comes to songs about love gained and even more so, love lost, this truth can often be come twisted due to the songwriter’s power to skew perspective, and as a result, songs can often lose their sense of reality, imperfect as it may be. Here to count er this with one of the most honest, heartfelt accounts of love that I’ve heard in quite some time, an artist by the name of Curtis Waters makes his way onto our pages with his new song, “The Feelings Tend To Stay The Same.”

Simply put, it’s no secret that feelings aren’t black While Sharma plans to continue pursuing the project and white, nor even after graduation, her job will limit the time she have they ever can spend on it and complicate the logistics of talking been. For Wa and meeting with the people needed to keep the ball ters, this con rolling.But if successful, her efforts would be well cept comes worth the trouble.“Even a warning of 20 seconds is a into play with lot of time,” said Gavin. “Enough time for people to a lost love of his a person whom he’ll always have get underneath something sturdy is really all it takes feelings for, regardless of how far apart they grow. to save a lot of lives.” Instead of painting a simplistic image of longing for this person’s love, “The Feelings Tend To Stay The CURTIS WATERS Same” admits, right off the bat, that Waters is a mess. Curtis Waters is an He refuses to stray from the harsh truth that had prob artist and music pro lems of his own, but regardless, his undying love for ducer from Nepalese this person shines throughout the entire song, taking descendant in North into account the numerous times when he felt loved Carolina. Waters in spite of his personal issues. began producing With this, complementing the vulnerability of this music for other art subject matter, the song arrives with a smooth, gui ists during his high WDUOHG LQVWUXPHQWDO WKDW \RX VLPSO\ FDQ¶W KHOS EXW school years before love. Waters may not be perfect, but none of us are, recording his own just as the galvanizing instrumentation and airy lyrics, releasing a hooks seem to make peace with. series of bubbly SoundCloud singles and creating I could go on about this one all day, but the truth is, KLVJHQUHEHQGLQJGHEXWDOEXP3URP1LJKW+HZDV “The Feelings Tend To Stay The Same” is the kind of DPRQJWKHWRSHLJKWEHDWPDNHUVVHOHFWHGLQWKH%DW song that speaks for itself. Sangalo 2019 10 Issue 19, Year 19 WHO IS A HINDU?

Dr. DASHARATH LOHAR In popular Western culture, whoever eats curry, has .ULVKQDLQ%KDJYDG*HHWDFOHDUO\HVWDEOLVKHVWKHGL a casteand worships a cow is a Hindu. Even though vinity of all things around us. many Hindus do eat curry, may belong to a caste of] df+ kZolt ;j{q ;j{+ r dlo kZolt . t:ofx+ g k|0fZofld ; r d] (jaati to be accurate) and may worship cows, this g k|0fZolt| 6.30| characterization is childish to say the least. If so, [yo mam pasyati sarvatra, sarvam ca mayi pasyati; ZKRLVD+LQGX"+RZVKRXOGZHGH¿QH+LQGXLVP" tasyaham na pranasyami, sa ca me na pranasyati] ,W LV UHODWLYHO\ VWUDLJKWIRUZDUG WR GH¿QH IDLWKIXO RI “For those who see me everywhere and see all things RWKHUUHOLJLRQV,I\RXSUD\WR*RG;FRQVLGHU<DV in me, I am never lost, nor are they ever lost to me.” His messenger and follow Z as the scripture, you are That is the reason Hindus consider nature as divine WKLVRUWKDW+RZHYHU+LQGXVGRQRW¿WWKLVPRGHO and revere rivers, animals, trees, rocks and so on. of religious identity. Hindu groups pray to so many The Hindu greeting ‘Namaste’ is an embodiment of Gods (with form or no form), there are so many mes this realization, which means ‘I bow to the divinity in sengers, and hundreds of scriptures. Practically, each you’. This is the reason Hindus have freedom to pray Hindu has a unique religion of his or her own. Giv to and worship any socially acceptable form or no en this diversity, what is there that makes a person a form of Parmatma. This practice has led to thousands Hindu? Is there a common thread encompassing this of forms of Parmatma as personal deities. Since ev great diversity and yet distinguishing it from the rest? erything has one source, Parmatma, Hindus proclaim Hinduism, also known as Sanatana Dharma, is con WKHFRQFHSWRIµ9DVXGKDLYD.XWXPEDNDP¶WKDWLVWKH sideredSanatanathat is without a beginning or an end. whole world is one family. Academics have argued endlessly of when Hinduism A Hindu knows that Parmatma is in each living be originated. Nevertheless, there is no doubt that its or ing (jiva), including humans. Parmatma, the truth, igin predates recorded human history and precedes is called the Atmain living beings. The Parmatma is the beginning of other world religions. Hinduism Sanatana (without beginning and end, imperishable), developed organically through millennia enriched so is the Atma. The body takes birth, grows, and dies by experiences of millions of people. It was the only in the control of nature. After the death of the body, one that existed before the advent of ‘History’ centric the embodied Atma(jivatma) can enter another body. religions such as Christianity and Islam. Therefore, 7KHUHIRUHUHLQFDUQDWLRQLVDQRWKHUORJLFDOLQWHUQDO WKHUHZDVQRQHHGWRGH¿QH+LQGXLVP+LQGXLVPZDV L]DWLRQE\D+LQGX%KDJZDQ.ULVKQDH[SODLQHGWKLV everything that existed for spirituality, religion and FRQFHSWRIUHLQFDUQDWLRQEHDXWLIXOO\LQWKHIROORZLQJ culture. Time has changed. Now we have groups of VKORNDRI%KDJYDG*HHWD SHRSOHZKRLQVLVWWKDWWKH\DUHGLIIHUHQWDQGQRQ+LQ jf;f+l; hL0f{lg oyf ljxfo, gjflg u|X0fflt g/f]˜k/fl0f . tyf z/L/fl0f du. Therefore, there is a need to examine who we ljxfo hL0ff{, GoGoflg ;+oflt gjflg b]xL . 2.22[vasamsi jirnani are and how we are different from those who insist yatha vihaya, navani grhnati naro ‘parani; tatha sa they are not Hindus. Fundamentals that make Hindus rirani vihaya jirna, anyani samyati navani dehi] unique are not found propounded as such in any one ³-XVWDVDSHUVRQJLYHVXSKLVROGFORWKHVWRSXWRQ place ina Hindu Scripture. Rather, we have to intro new ones, so does the embodied Atma, having dis spect ourselves as Hindus with guidance from our FDUGHGWKHZRUQRXWERG\SXWVRQDQHZRQH´7KH VFULSWXUHVWRVHHNRXURZQGH¿QLWLRQ0\LQWURVSHF body (type of life and condition) the embodied At tion led me to the following essence of Hinduism that mawill enter next is determined by past actions or most, if not all, Hindus can identify with. .DUPD1RKXPDQDFWLRQJRHVZDVWHG,WSURGXFHVD The entire universe is pervaded by one truth, Parmat result sooner or later, in this life or in the next life. All ma (we can call this truth the God in English). The SDVW DFFXPXODWHG .DUPD LV FDOOHG 6DQFKLW .DUPD universe itself is a manifestation of Parmatma, which 7KHSRUWLRQRI6DQFKLW.DUPDSURGXFLQJUHVXOWLQWKH is divine. Parmatma is everywhere and in everything, FXUUHQWOLIHLVFDOOHG3UDUDEGK.DUPD$QGZKDWHYHU including us. We do not have to look up in the sky actions we are doing in the current life comprises the WR¿QGWKH*RG7KHIROORZLQJVWDWHPHQWRI%KDJZDQ $JDPL.DUPD$QGWKXVHQGOHVVF\FOHRIELUWKDQG

11 GHDWKDVGHWHUPLQHGE\.DUPDFRQWLQXHV,QIDFWWKH LVERXQGE\.DUPD2QO\KXPDQEHLQJVGXHWRWKH +LQGXFRQFHSWRI.DUPDLVWKHRQO\WKHRU\WKDWORJ power of the mind and intellect, are capable of com ically explains the diversity of living conditions that prehending and experiencing this truth. Therefore, a we see on the earth from conception to death. Hindu knows that Moksha can be the only ultimate A Hindu knows that suffering is a given in life. No goal of each human being. living being, including humans, canconsistently re So, who is a Hindu? A Hindu is anyone who consid PDLQKDSS\WKURXJKRXWOLIHWLPH+DSSLQHVVLVVKRUW ers the entire universe, including humans, as divine, lived. Thus, taking a life form is an invitation to suf practices freedom of worship, knows that the Par fering. The liberation from suffering can only come matmais ever present in him/her as Atma, has inter from cessation of birth and death. Hindus call this QDOL]HGUHLQFDUQDWLRQRIHPERGLHG$WPDDVJXLGHG liberation Moksha. The liberation can only come E\ .DUPD DQG NQRZV WKDW 0RNVKD LV WKH XOWLPDWH from the realization that Atmais ever pure, not bound goal of each human being to be liberated from end E\DQ\.DUPD:HDUHWKDW$WPDZLWKWKHVDPHDW less suffering. WULEXWHVDVWKH3DUPDWPD2QO\WKHHPERGLHG$WPD

PARENT AND CHILD RELATIONSHIP

SHRIYADITA DHAKAL

$SDUHQWFKLOGUHODWLRQVKLSLVDVSHFLDOUHODWLRQVKLS Working parents must note this point and always put that has a huge effect on the way that the child will their child in front before their work. After this stage turn out. This relationship is formed through preg is the toddler stage. The parents now change from nancy, adoption and step parenting. The relationships caretakers and nurturers to teachers also. This is the between parents and their children can determine ¿UVW SKDVH RI VKDSLQJ WKH FKLOG¶V VRFLDO EHKDYLRXU the personal growth of children as it can likewise During the school years, the children will slowly start LQÀXHQFHWKHEHKDYLRUDODGMXVWPHQWVQHHGHGRQWKH moving with peers. This is not to be noted as a neg part of parents in order to meet the emotional needs ative impact on their relationship. The parent child of their children. Parenting requires a great deal of connection continues to develop the child throughout adaptation. I believe that a child without a mother this stage. Next is the most important stage which loses certain aspects of life and a child without a fa SDUHQWVQRUPDOO\¿QGLWGLI¿FXOWWRKDQGOH$GROHV ther loses a type of understanding and guidance in cence. It is the stage were the child matures emotion life. Without a parent the child’s ability to do right ally, mentally and biologically. There may be many fails and they end up looking for the guidance in the misunderstandings and arguments between the par wrong groups such as gangs or groups doing some ents and children at this stage. Children will like to thing that might destroy their life. The absence of pa be independent and will want to be left alone. This is UHQWDOLQÀXHQFHFDQDIIHFWDFKLOG¶VOLIHQHJDWLYHO\ their normal nature. Parents should always encour However, there are many kids who have parents but age and show affection to their children no matter are not doing good in their life. That is the result of what. Authoritative parenting that combines love and their relationship with their parents. Having a strong ¿UPQHVVLVWKHNH\WRWDFNOLQJDGROHVFHQWV+RZHYHU and unbreakable bond with parents pushes children it has been seen that children become more close to towards happy and successful life. their parents after this stage. Every relationship starts with trust and re Parents should not fear or get angry while handling spect from both sides. Trust and respect between par FKLOGUHQ ,I WKH\ ¿QG VRPHWKLQJ ZURQJ ZLWK WKH ents and children build a healthy relationship until the child’s attitude or behaviour, they must work to cor end.Characteristics that may affect the parent child rect it. Discipline must be taught in a proper way and relationship will keep varying as the child grows. must not be confused with punishment. Children are Parent infant attachment is crucial for the infant’s like a mirror of their parents. If the children are ad survival and development. It is strengthened by mu vised to follow a certain principle, the parents must tual interaction. Hence it is very much essential that PDNHVXUHWKDWWKH\IROORZLW¿UVW$VWKH\VD\³3UDF the parents spend adequate time with their babies. tice what you preach”.

Sangalo 2019 12 Issue 19, Year 19

THE LOCH NESS MONSTER

SHREYA KUWAR

7KH /RFK 1HVV 0RQVWHU LV D P\WKLFDO VHDFUHDWXUH museum, and it was reported that the tracks were that that is believed to live in Loch Ness, a large fresh RI D KLSSRSRWDPXV VSHFL¿FDOO\ RQH KLSSRSRWDPXV water lake near Inverness, Scotland. There have been IRRWSUREDEO\VWXIIHG7KHKRD[WHPSRUDULO\GHÀDWHG accounts of an aquatic beast living in the lake for Loch Ness Monster mania, but stories of sightings RYHU\HDUVQRRQHKDVIRXQGDQ\FUHGLEOHHY continued. idence that the animal exists. Although no one has ,Q  WKH IDPRXV SKRWRJUDSK RI WKH /RFK 1HVV ever proven the beast’s existence, scholars of the 0RQVWHUVKRZHGDGLQRVDXUOLNHFUHDWXUHZLWKDORQJ Loch Ness Monster have found dozens of references neck emerging out of the murky waters. This lead to WR³1HVVLH´GDWLQJEDFNWRDURXQG$'LQ6FRWWLVK some theories that “Nessie” was a solitary survivor history. RI WKH ORQJH[WLQFW SOHVLRVDXUV7KH DTXDWLF SOHVLR The seventh century biography of Saint Columba saurs were thought to have died off with the rest of was the earliest written reference to a monster in WKHGLQRVDXUVPLOOLRQ\HDUVDJR7KLVWKHRU\KRZ Loch Ness, and according to him, St. Columba was ever was proven wrong because the Loch Ness was about to visit the king when he saw large beast about frozen solid in the ice ages so it would have had to to kill a man and stopped to confront it. He invoked come from the sea in the past 10,000 years. The ple in the name of god that the monster “go back with all VLRVDXUVZDVDOVREHOLHYHGWREHFROGEORRGHGVRWKH speed.” and the creature never harmed another man beast could not have survived in the cold waters of again. Loch Ness. 7KH,QYHUQHVV&RXULHUUHSRUWHGRQ0D\WKDW Some suggested it was an archeocyte, a primitive a couple claimed to have seen “an enormous animal whale with a serpentine neck that is thought to have rolling and plunging on the surface.” This made the EHHQH[WLQFWIRUPLOOLRQ\HDUVZKLOHVRPHZHQW story of the Loch Ness Monster famous. It became a completely different route, and argued what the a social media sensation with London newspapers people saw were “seiches”—oscillations in the water sending correspondents to Scotland and a circus of VXUIDFHFDXVHGE\WKHLQÀRZRIFROGULYHUZDWHULQWR fering a 20,000 pound reward for the beast’s capture. the slightly warmer loch. 6RRQDIWHUWKHVLJKWLQJLQWHUHVWJUHZ$QRWKHU Year after year more and more mysterious things couple claimed to have seen the beast, several Brit were found like how a sonar search detected large, ish newspapers sent reporters to Scotland, includ moving underwater objects they could not explain, ing London’s Daily Mail, which hired Marmaduke D SKRWR WKDW UHVHPEOHV D ÀLSSHU RI D JLDQW SOHVLR :HWKHUHOODELJJDPHKXQWHUWRFDSWXUHWKHEHDVWDQG VDXUOLNHFUHDWXUHDQGORWVRIPRUHSHRSOHFODLPLQJ DIWHU D IHZ GD\V RI VHDUFKLQJ KH UHSRUWHG ¿QGLQJ they have seen the beast. IRRWVWHSVRIDODUJHIRXUOHJJHGDQLPDO Although most of these discoveries were proven to A large road was built around the lake that gave a be a hoax this didn’t make a dent on the enthusiasm clear view of the Loch Ness and tons of tourists came, that tourists and investigators had for the Loch Ness sat in boats or decks chairs and waited for the beast’s Monster. appearance. Plaster casts of the footprints were sent a

13 DIABETES, A SILENT KILLER

SAGAR WAGLE, MD Diabetes is highly prevalent in our modern society. 7KHUHDUHWZRW\SHVRIGLDEHWHVW\SH,DQGW\SH,, 2YHUWKHDJHRIRI$PHULFDQVKDYHGLDEHWHV In type I diabetes, the pancreas is unable to make You probably know someone in your family, who has any insulin. As a result, patients with type I diabe diabetes. tes need lifelong supply of insulin. Type I diabetes Afterall, what is diabetes? What causes it? What kind usually happens in little kids. So if you see little kid of damage does it do to your body? How can we pre who needs to inject insulin, you can be almost certain vent it? And how is it treated? In this article, we will that they have type I diabetes. Type I diabetes is less discuss these topics. common than type II diabetes. History of diabetes In type II diabetes, the body becomes resistant to the ,QWKHGRFXPHQWHG:HVWHUQKLVWRU\DERXW\HDUV DYDLODEOHLQVXOLQ7KHSDQFUHDVLV¿QHLWLVSURGXFLQJ ago, a doctor in Egypt noted that some of his pa enough insulin. However, the liver and other organs tients were peeing a lot andlosing weight. Interest don’t respond to the available insulin. As a result, ingly, ants were attracted to those patients’ urine. there is high sugar in the blood. Every obese person Soon enough, an unusual way was developed to di who doesn’t exercise will have some degree of insu DJQRVHWKLVGLVHDVHWRWDVWHSDWLHQW¶VXULQH'RFWRUV lin resistance. When the insulin resistance gets bad would taste urine of their patients, and if the urine enough, we call it type II diabetes. Type II diabetes is was sweet, patients were diagnosed with a new dis more common than type I diabetes. Type II diabetes ease named diabetes mellitus. Mellitus means hon LVFRPPRQO\VHHQLQROGHUSHRSOHPRVWO\DIWHU ey. Diabetes means “to suck”. To early physicians, it years of age. However, with diet high in sugar, and appeared that patient’s good health was sucked out increasing obesity, we sometimes see type II diabetes through their sweet tasting urine, and they named the LQSDWLHQWVDV\RXQJDV\HDUVROG,QWKHUHVWRI disease diabetes mellitus. the article, I will talk focus the discussion on type II What is diabetes? diabetes. When I say the word diabetes, you should In diabetes mellitus, the regulation of blood sugar is understand that I am talking about type II diabetes. disrupted, resulting in high amount of sugar in the What are the risk factors of (type II) diabetes? blood. The sugar gets so high that it starts to spill in The important factors that leads to insulin resistance, WKHXULQHKHQFHWKHXULQHEHFRPHVVZHHW7KHUHDUH and eventually to type II diabetes, are excessive body WZRW\SHVRIGLDEHWHVGLDEHWHVLQVLSLGXVDQGGLDEH weight, too much belly fat, lack of exercise, and tes mellitus. In diabetes insipidus, patients pee a lot, smoking. These are the factors we can change in our but they don’t have problem regulating blood sugar. OLIH2QHFDQVWRSVPRNLQJDQGH[HUFLVHUHJXODUO\ Diabetes insipidus is a disease of the kidney, or the There are some factors that leads to insulin resistance, brain. This disease is extremely rare, and we will not EXW ZH FDQQRW FKDQJH WKHP7KRVH QRQPRGL¿DEOH talk about it in this article. When people commonly risk factors include increasing age, genetics, ethnic talk about diabetes, they are talking about diabetes ity, and family history of diabetes. People of cer mellitus. In the rest of the article, when I say diabe tain ethnic groups, for example, Native Americans, tes, I will be referring to diabetes mellitus. Hispanics, and Blacks have higher rate of diabetes What causes diabetes? compared to White people. Similarly, if someone has After we eat food, the nutrients and sugar in our diet parents or grandparents with diabetes, they are more is absorbed from the intestines to our blood. Most likely to develop diabetes compared to someone who of this absorbed sugar is stored in liver. Some of the doesn’t have anyone in their family with diabetes. remaining sugar is stored in muscles, fat and other What are some complications of diabetes? tissue. When the sugar in our blood gets high, the When the amount of sugar in our blood is high, the pancreas produces an enzyme called insulin. Insulin sugar gets converted to fat. This fat and sugar then stimulates the liver and other tissues in our body to deposit in the wall of blood vessels making the blood take sugar from the blood. Hence, insulin helps to vessels narrow. Many different complications of dia regulate the amount of sugar in our blood. betes are result of this narrowing of the blood vessels. Sangalo 2019 14 Issue 19, Year 19 FRPSOHWHNLGQH\IDLOXUH:KHQVXI¿FLHQWGDPDJHWR kidney is done, they are not able to make any urine. As a result, patients are forced to undergo dialysis. ,Q8QLWHG6WDWHVGLDEHWHVLVWKHQXPEHURQHFDXVHRI kidney failure and dialysis.  1HUYH GDPDJH DQG QHXURSDWK\ WKH QHUYHV WKDWVXSSOLHVRXU¿QJHUVDQGWRHVKDYHWRWUDYHODOOWKH way from the spinal cord in our back. Those nerves are very long. Damage to the blood vessels supplying these nerves can cause nerve damage and neuropa thy. Patients can have pain and tingling in hands, feet, and loss of sensation as a result of nerve damage. The pain and tingling can get worse as diabetes gets worse.  )RRW LQIHFWLRQ DQG QRQKHDOLQJ ZRXQG D good blood supply is needed for proper wound heal ing. Due to nerve damage and bad sensation, diabetic )LJXUHFRPSOLFDWLRQVRIGLDEHWHV,PDJHIURPZZZ patients are more likely to get wound in their foot. umassmed.edu Because wounds heal poorly in diabetics, it can prog  +HDUWDWWDFNZKHQWKHEORRGÀRZWRWKHKHDUW ress to infection of the bone (called osteomyelitis). is stopped or seriously reduced, the heart muscles Many times, foot wounds in diabetics heal poorly, die, and we call it heart attack. The blood vessels sup and patients end up having to cut off their foot. Dia plying the heart are tiny, with their diameter about betic foot wound is a common cause of amputation in PLOOLPHWHUV:KHQ\RXEORFNWKRVHDOUHDG\WLQ\ WKH8QLWHG6WDWHV blood vessels, the heart’s blood supply drops down 0DQ\WLPHVWKH¿UVWPDQLIHVWDWLRQRIGLDEHWHVLVWKH VLJQL¿FDQWO\DQGSHRSOHGHYHORSKHDUWDWWDFN FRPSOLFDWLRQIURPGLDEHWHV8QWLOWKHQGLDEHWHVFDQ  6WURNHWKHEORRGYHVVHOVVXSSO\LQJWKHEUDLQ remain silent. As symptoms from diabetes are seen are even more tiny than the ones supplying the heart. only in late stages, many patients live with diabetes :KHQWKHEORRGÀRZWRWKHEUDLQLVVWRSSHGRUVH]UL for years before they are diagnosed. ously reduced, that leads to permanent loss of brain How can we prevent and treat diabetes? function, and we call it stroke. Example of loss of For the most part, type II diabetes is a preventable function from stroke includes paralysis, loss of abili disease. If someone has diabetes, it can usually be ty to speak or eat, blindness, personality change, de managed easily. In my own experience, I have seen pression, urinary and fecal incontinenzce, and many people with really bad diabetes be completely cured. more. If the diabetes is in its early stage, healthy balanced  %OLQGQHVV WKH EORRG YHVVHOV VXSSO\LQJ WKH diet and frequent exercise are the best place to start. eyes are even smaller than the ones supplying the Diet is usually hard to change. We Nepali people brain. Due to reduction in blood to the eyes, patient KDYHEHHQHDWLQJULFHDOORXUOLIH,WLVVLJQL¿FDQWO\ with diabetes are more likely to have vision problem challenging to stop eating rice after eating it multiple and go blind. In developing countries like Nepal, WLPHVDGD\IRU\HDUV+RZHYHUDGGLQJH[HU cataracts is the most common cause of blindness. In cise to our daily routine is easier compared to chang GHYHORSHGFRXQWULHVOLNHWKH86$YLVLRQORVVGXHWR ing our diet. The American Heart Association rec GLDEHWHVLVDVLJQL¿FDQWFDXVHRIEOLQGQHVV'LDEHWHV RPPHQGVPLQXWHVRIH[HUFLVHLQDZHHN,WFDQ also increases the risk of other eye diseases such as EHGLYLGHGWRPLQXWHVDGD\WLPHVDZHHN7KH cataracts, and glaucoma. Therefore, patients with di exercise can include brisk walking, running, swim abetes are recommended to visit an ophthalmologist ming, tennis, dancing, biking, or some type of cardio (eye doctor) at least once a year to monitor their vi vascular exercise. Therefore, my recommendation is sion. to focus your effort on exercise rather than changing  .LGQH\ IDLOXUH DQG GLDO\VLV WKH PDLQ IXQF diet. Don’t get me wrong. Improving your diet can WLRQRINLGQH\VLVWR¿OWHUEORRG7LQ\EORRGYHVVHOV KDYHDVLJQL¿FDQWLPSDFWLQ\RXUGLDEHWHVEXWWKLVLV VXSSO\LQJ WKH EORRG ¿OWHULQJ V\VWHP RI NLGQH\ FDQ harder to attain compared to adding exercise to your be easily be damaged by diabetes. The damage gets daily routine. worse with time, and patients can eventually develop Many of my patients ask me what they can and can 15 not eat once they get diabetes. My answer is that they EOHV7KHQ¿OODTXDUWHUZLWKVWDUFK\IRRG OLNHULFH  can eat whatever they want even after they diabetes. and remaining quarter with protein. -XVWHDWLQPRGHUDWLRQ,IWKHUHLVRQHGLHWDU\FKDQJH )LJXUHWKHSODWHPHWKRG,PDJHIURPZZZFGFJRY ,UHFRPPHQGLWLVWRVWRSGULQNLQJVXJDU\GULQNV If the diabetes is bad enough, your doctor can start coke and other soda, fruit juice, and such. They con you on an oral medication. Metformin is usually the WDLQVLJQL¿FDQWDPRXQWRIVXJDUDQGZLOOPDNHGLDEH ¿UVWPHGLFDWLRQVRPHRQHZLWKGLDEHWHVZLOOVWDUWRQ tes worse. You can replace the sugary drinks with diet This medication is usually safe and is well tolerated. version of those drinks, like diet coke. Despite com Common side effects include stomach pain and di PRQ PLVFRQFHSWLRQ WKH DUWL¿FLDO VZHHWHQHU LQ GLHW arrhea. If you cannot tolerate metformin due to side drinks (called aspartame) does not cause cancer. The effects, don’t worry. There are plenty of other oral 86)RRGDQG'UXJ$GPLQLVWUDWLRQDQGWKH(XURSHDQ medications. If the diabetes is really bad, your doctor Food Safety Authority has concluded that aspartame can recommend insulin in addition to metformin and is safe for consumption. other oral medications. 2QHFRPPRQGLHWDU\PHWKRGUHFRPPHQGHGLQGLD 2QFH\RXUGLDEHWHVLVXQGHUFRQWURO\RXUGRFWRUPD\ betes is called the Plate method. This helps to control decide to stop the medications. Many complications amount of carbohydrate containing food in diet. In a of diabetes can be prevented if diabetes is kept under meal, it is ideal if half of the plate contains vegeta control. Conclusion 'HVSLWHGLDEHWHVWDNLQJDVLJQL¿FDQWWROORQSHRSOHV¶ lives, we have made a large stride in its treatment. First of all, it is mostly preventable if one adapts a KHDOWK\OLIHVW\OHHDWLQJDZHOOEDODQFHGGLHWDQGH[ ercising regularly. As diabetes remains silent until very late, I highly advise annual regular check up with a doctor to see if diabetes is quietly develop ing in you. If you already have diabetes, most of the complications can be prevented if diabetes is kept un der control. Good news is that with a healthy lifestyle and medications, diabetes can be easily kept under control.

COMPARING DASHAIN CELEBRATED IN NEPAL AND AMERICA

SAURYAVI DHAKAL Comparing Dashain celebrated in Nepal and Amer As a kid I would like to mention that the dakshina is ican is quite different in many ways.For example in way more in Nepal since we go to a lot more places. 1HSDOZHFHOHEUDWH'DVKDLQIRUDOOGD\VDQGWUDYHO In America you don’t get so much dakshina because a lot. But in America people keep it pretty simple and you just get it from your parents and nearby relatives. XVXDOO\MXVWSXW³7LNDDQG-DPDUD´RQ9LMD\'DVKD It’s ok though since the blessings are the main point. mi( the 10th day of Dashain).In Nepal your whole As a whole from my experience I would like to say family can travel all around on Dashain because it is that Dashain feels much more real and fun in Nepal a government holiday.In America on the other hand, than any other countries.But we all appreciate that during Dashain America does not have government we are keeping up on our Nepali culture and tradi holiday hence we celebrate on the 10th day. WLRQV LQ IRUHLJQ FRXQWULHV2QH PRUH WKLQJ , ZRXOG Another way Dashain In Nepal and America are dif like to say is that sometimes I feel like Dashain is ferent is the activities done on Dashain.For example just taking pictures and posting on Facebook.Lastly in Nepal they different types of swings especially I know that Dashain In America will eventually im PHDQWIRU'DVKDLQDQGWKH\KDYHSHRSOHÀ\LQJNLWHV prove and overall Dashain is one of the best festivals on rooftops.Yet in America we don’t set up special LQ+LQGXFXOWXUHHYHU7KDQN\RX VZLQJVIRUWKHIHVWLYDOEXWVRPHPLJKWÀ\NLWHV

Sangalo 2019 16 Issue 19, Year 19

INTRODUCTION TO BHAGWAT GEETA IN BRIEF

MINA SHARMA

Shreemadh Bhagwat Geeta is one of the most glori had forgotten theseteachings, so Rishi Vedvyashcol ous Holy Texts of our ancient religion.The other two lected these spiritual teachingsand presented it as the DUH WKH 8SDQLVKDGV DQG WKH %UDKPDVXWUD7KLV LP Bhagawat Geeta as it is today. Actually Rishi Ved PRUWDOZULWLQJZDV¿UVWVSRNHQE\/25'.5,6+1$ Y\DVK LV DQRWKHU LQFDUQDWLRQRI /RUG .ULVKQD KLP the supreme Godhead Himself in his Divine Avatar VHOI9HGY\DVKLVDOVRNQRZQE\WKHQDPHRI.ULVK for the wellbeing of all mankind. The text was orig nadwapar too. inally written in Sanskrit language (called the Twi The exact date when this teachings was collected and light language) and is in the form of poetic verses, or presented as as a Holy Spiritual Text is estimated to Slokas.This has now been translated and explained EH%&RU\HDUVEHIRUHWKHEHJLQQLQJRI LQWRPRUHWKDQ¿IW\ODQJXDJHVZRUOGZLGH7KLVHSLF WKH1HSDOLFDOHQGD7KH7H[WFRPSULVHVFKDSWHUV SRHPLVDOPRVW¿YHWKRXVDQG\HDUVROGEXWLVVWLOOD DQGYHUVHV(DFKFKDSWHUKDVDGLIIHUHQWQXPEHU sacred text for more than a billion people today.It is of verses. The lowest number of verses is in chap greatly used in oathtaking ceremonies. WHUZKLFKFRQWDLQVRQO\YHUVHVDQGKLJKHVWLV From ancient times, this text has given inspiration LQFKDSWHUZLWKYHUVHV,QHDFKFKDSWHU/RUG and guidance to people in different walks of life to .ULVKQDLQFRQYHUVDWLRQZLWKSULQFH$UMXQKDVSUH attain highest goal in achieving success. The main sented a profound insight into the workings of human purpose of studying the priceless teachings of Geeta nature providing useful guidance that is needed in is to develop a spiritual wisdom which helps peo every walk of life leading to a perfectharmony with SOHDFKLHYH6HOIUHDOL]DWLRQDQG*RGUHDOL]DWLRQ,WV oneself and with others. It has also been explained study helps to train the individual to live a life that that humans are not only these temporary material is balanced and productive, as well as peaceful and bodies but spiritual souls and conscious entities that joyful. RQHFDQ¿QGJHQXLQHSHDFHDQGKDSSLQHVVRQO\E\ Rishi Vedvyash, the great sage, complied the Geeta spiritual devotion to God. which takes the form of a poetic dialogue between From time immemorial, famous people, scholars, /RUG .ULVKQD DQG SULQFH $UMXQ ZLWK WKH IRUPHU philosophers, educationalists, andpoliticians have speaking in his form as a divine avatar. Therefore, it turned to the study of the Geetawhen they have en LVHVWDEOLVKHGDVD6KUXWLDQGD8SDQLGKDGZKLFKDUH FRXQWHUHGGRXEWVDQGGLI¿FXOWLHVLQWKHOLYHV6RPH two of the widely accepted categories of scriptures examples are Dr. Paul Brunton, a British philoso in Hinduism. The whole text of the Geeta appears in pher,Mahatma Gandhi, Dr. Radhakrishna, Indian the sixth chapter of the great epic Mahabharat during President, and Aldous Huxley,an English writer and WKHZDUEHWZHHQ3DQGDYDVDQG.DUDXYDVZKRZHUH SKLORVRSKHU HWF 2QH LQWHUHVWLQJ IDFW PD\ EH FLWHG cousins. This war is presented as being between forc KHUHWKDWWKHLQYHQWRURI¿UVWQXFOHDUERPE5REHUW es of righteousness (Dharma)and that of unrighteous 2SSHQKHLPHUZDVLQÀXHQFHGE\WKH*HHWDDQGFLWHG FRQGXFW $GKDUPD /RUG.ULVKQDUHYHDOVWRSULQFH DYHUVH  XSRQLWVVXFFHVVIXOWHVW Arjun of the Pandavas, his sacred teachings,when This is a small attempt to spread the message of the Arjun gets mentally agitated and confused seeing all Geeta to a younger generation. Hope they will make the elders, teachers,friends and relatives as the op a habit of creating interest in such a reading.More de SRQHQWVLQWKHEDWWOH¿HOG .XUXFKKHWUD DWWKHWLPH tailed explanation of each chapter may be continued when the war was about to begin. in further issues of the Sangalo. At the time the people who saw and listened this To sumup, one can recite the following verse teaching were Geyam Geetanam sahasshram [Read Geeta along 1 Sanjaya, personal secretory of kingDhirtarastraof with Bishnu’s numerous names] WKH.DXUDYDVWRZKRPLWZDVWKHQQDUUDWHG Dheyam shreepatiroop majasshtram [Always re 2 The four divine horses of Arjun’s chariot member Laxmipati’s picture in mind] (NODEE\DDJUHDWZDUULRUZKRZDVJUDQWHGDSUR Neyam sajjanasange chittam [listen to wise and longed life, just to see the war learned teachers by heart]  3ULQFH$UMXQKLPVHOI Deaym deenjanaya cha bittam [serve the poor and  6DJH9HGY\DVKWKHFRPSRVHURIWKLVJUHDWZRUN needy people donating goods and money] After the war all the listeners except Rishi Vedvyash 17 NCNC and RTP’s Nepali-American Community Seen Through the Eyes of an American Friend Richard (“Pete”) Andrews

It was a great privilege for me to serve in Nepal as a RTP Nepali community and for me personally. For 863HDFH&RUSV9ROXQWHHUIURPWRDQG the Nepali community it was the year of the found to participate in a small way in H.M. Government’s ing of NCNC, in coordination of Ishwar Devkota efforts to bring the “Green and so many others. In 5HYROXWLRQ´ RI KLJK\LHOG -XQHRIWKDW\HDU5DOHLJK wheat to Nepal’s agriculture. Durham and Chapel Hill This experience also provided also sponsored the World me with an unusually reward 6SHFLDO 2O\PSLFV DQG ing opportunity to get to know Nepal sent a soccer team. Nepal’s people and culture. The team had a great I lived in Chitwan District, experience and great ¿UVW LQ WKH VPDOO DJULFXOWXUDO success– if I remember village of Gitanagar and then correctly, they may have for one and a half years with won second place in the a family in the larger town of world competition – and 1DUD\DQJKDW2IDOOWKHSODFHV before they returned, the where I might have been sent, local Nepali community Narayanghat was the home of hosted a backyard bhoj WKH1DUD\DQL.DOD0DQGLUDQ for them, and I discov organization which has done ered that their coach so very much to preserve and was the headmaster of present Nepal’s many musi the elementary school cal, dance and theatrical and cultural traditions, in across the street from the house where I had lived which I also participated and found many friends. LQ1DUD\DQJKDW7KLVFKDQFHUHXQLRQSXWPHEDFNLQ ,UHWXUQHGKRPHWRSXUVXHJUDGXDWHVWXGLHVDW81&LQ touch with my host family there, and led to a vis environmental planning, and after nine years teach it to them two years later with my family. Several ing elsewhere, moved back to Chapel Hill to teach weeks later I also received a phone call out of the LQ,WZDVDVSHFLDOSOHDVXUHWRGLVFRYHUWKHEH blue from one of my closest friends from my Peace JLQQLQJVRIVXFKDQDFWLYH1HSDOL$PHULFDQFRPPX &RUSV\HDUV .ULVKQDQDQGD1HXSDQH±ZLWKZKRP nity in the Triangle. In those early days it seemed ,KDGQRWEHHQLQWRXFKIRUPRUHWKDQ\HDUV±WHOO that most of the Nepalishere had come as students to ing me that he was visiting his son Sujan in Raeford, HDUQSURIHVVLRQDOGHJUHHVLQSXEOLFKHDOWKDW81&RU 1RUWK&DUROLQD.ULVKQDQDQGDDQGKLVZLIH%KDUDWL forestry or engineering at Duke or N.C. State;some are now retired in Cary, and Sujan and his wife Parita returned later to live and work in the Triangle. There have become active and valued supporters of NCNC. also were a number of enthusiastic American friends Beyond these personal connections, my wife Han of Nepal, including returned Peace Corps Volunteers nah and I have developed a profound admiration for VXFKDV/\QQ.QDXIIDQG-RKQ3DXODQGP\VHOIDQG NCNC and for the goals and values it represents. TXLWHVLJQL¿FDQWO\*RYHUQRU-LP+XQWDQGKLVVFL 0DQ\SHRSOHLPPLJUDWHWRWKH8QLWHG6WDWHVDQG¿QG ence advisor Dr. Quentin Lindsey, who had both their way to new lives here, but do not have the ben served in Nepal with the Ford Foundation and shared H¿WRIVXFKDQRUJDQL]DWLRQWRSUHVHUYHWKHLURZQFXO a deep and enduring love for its people. In the ear ture and pass it on to their children, and to serve so O\V*RYHUQRU+XQWVSRQVRUHGWKH¿UVW³1HSDO many other admirable purposes as well. How many Day” celebration at the Governor’s Mansion, includ such organizations can one think of that are commit ing not only the local community but also the Nep ted and effective in preserving the best of their own alese Ambassador and several busloads of Nepalis musical, dance, and literary cultures, and passing from Washington, D.C. them on to their children through the Nepali school;in 7KH\HDUZDVDPDMRUPLOHVWRQHERWKIRUWKH building and maintaining community among Nepalis

Sangalo 2019 18 Issue 19, Year 19 and their American friends in the RTP region; and Richard (“Pete”) Andrews and his wife Hannah are life in supporting new arrivals and students in adapting members of NCNC. Pete is Professor Emeritus of Public to American society; but also are mobilizing support Policy at UNC-Chapel Hill, where he taught environmen- for relief from natural disasters and personal crises, tal policy for 34 years. His publications include books on not only the earthquakes in Nepal but also similar the history of American environmental policy and on the crises in other parts of the world? Very few. National Environmental Policy Act, and scholarly arti- To me NCNC is thus quite special and perhaps even cles on many aspects of U.S. and comparative environ- unique. It demonstrates the highest goals and values mental policy. He earned the bachelor’s degree in philos- of both the Nepali and the American traditions, and ophy from Yale University in 1966 and served as a Peace stands as a model for other such organizations. Han Corps Volunteer in Nepal from 1966 to 1968, then earned nah and I are deeply proud to support it as life mem master’s and doctoral degrees from UNC in environmen- bers, to celebrate its dramatic growth as more and tal planning in 1970 and 1972. He taught at the Universi- ty of Michigan from 1972 to 1981, then at Carolina until more Nepalis have moved to this area, and to join his retirement in 2015. He and Hannah live in Chapel in its annual celebrations of Dashain, Tihar and the Hill; they have two adult children, Sarah and Chris, both Nepalese New Year. We hope to continue to partici of whom visited Nepal with them in 2001. pate and support it for many years to come.

THE BAGMATI AND BISHNUMATI RIVERS OF KATHMANDU VALLEY DIZA PANDEY

Recently I have visited the beautiful country of of untreated sewage and the dumping of chemicals Nepal, I went sightseeing around the valley. I real have affected the pH levels for it almost to be acidic. L]HG WKDW WKH RXWVLGH ZDV SHUIHFWO\ ¿QH EXW WKH DLU Which is causing some of the Bagmati to be used as quality in the inside was heavily affected. I somehow DODQG¿OO/RWVRISHRSOHKDYHEHHQLQIRUPHGDERXW was astonished by the quality of the Bagmati and the conditions of the river but not yet done anything WKH%LVKQXPDWL5LYHU7ZRRIWKHPRVWZHOONQRZQ to preserve the cleanliness of how the water is sup VRXUFHVRIZDWHULQWKH.DWKPDQGXDUHD%RWKWKH posed to be. rivers are very well known for many reasons going The second river is the Bishnumati River; it origi from religious causes to crop cultivation. nates in Tokha on the Shivapuri Hills, north of the The Bagmati River originated in the Shivapuri Hills YDOOH\7KHULYHUÀRZVWKURXJKWKHZHVWHUQSDUWRI QHDU WKH YLOODJH RI %DJGZDU ,W ÀRZV WKURXJK WKH WKHROG.DWKPDQGXFLW\0DQ\GLGEHQH¿WIURPWKH .DWKPDQGX9DOOH\VHSDUDWLQJ.DWKPDQGXIURP3D water source as it provides water for drinking, cul WDQ7KHULYHULWVHOIH[WHQGVDIXOOPLOHVDQGODWHU tivating agriculture and ritual purposes of the local HQGVDWWKH.RVKL5LYHU$QDYHUDJHUDLQIDOOLQWKH FLWL]HQV%XWIRUWKHODVW\HDUVLWKDVEHHQXVHGDV YDOOH\LVPPRIWKHUDLQLVIURPPRQVRRQ a dumping site for unwanted trash. With the same VHDVRQJRHVIURP -XQH6HSWHPEHU :KLFKDUHWKH conditions as the Bagmati river. PRQWKVZKHQWKHULYHUVPD\H[SHULHQFHRYHUÀRZLQJ Both of these rivers used to be a clean source of wa The Bagmati River also washes up the steps of the WHUWRWKHUHVLGHQWVRI.DWKPDQGXQRZVRPHSHRSOH sacred Pashupatinath Temple, a religious symbol not who care about the environment are taking action to only for the Hindus in Nepal but also India and other help save and preserve their beautiful and loved riv South Asian countries. The river is considered holy ers. A lot of cleaning campaigns are starting to make by both Hindus and Buddhist; many Hindu temples a difference before everything is gone. From what I are located on its bank as a sign of respect towards saw was a shock to my parents used to tell me about the religious waters. The river is used for religious their home country, as both of them would say “we ceremonies, as a water source for crop cultivation, use to play in the river with our siblings and have fun and for chemical and human waste disposal. all day” As I think about how I can make a difference  -XVW QRZ WKH ZDWHU IURP WKH ULYHU KDV EHHQ WR[LF is very different from what the people of Nepal think for any form of life to be living in. Large amounts about their rivers.

19 GLOBAL WARMING

AYUG POUDEL Global warming is one of the up and coming problem work utilizing various strategies of the world. A worldwide temperature alteration is and informational as of now having noteworthy and destructive impacts indexes,” said Stefan Brönnimann, on our networks, our wellbeing, and our atmosphere. IURPWKH8QLYHUVLW\RI%HUQDQGWKH3DJHV.FRQ 2FHDQ OHYHO DVFHQW LV TXLFNHQLQJ 7KH TXDQWLW\ RI sortium of atmosphere researchers. HQRUPRXV ¿HUFH EOD]HV LV GHYHORSLQJ +D]DUGRXV Remarking on the investigation, different research warmth waves are winding up increasingly normal. HUVVDLGLWZDVDVLJQL¿FDQWDFKLHYHPHQWLQWKH³¿Q 2XWUDJHRXVWHPSHVWRFFDVLRQVDUHH[SDQGLQJLQQX gerprinting” errand of demonstrating how human ob merous regions. Progressively serious droughts are ligation has changed the atmosphere in manners not happening in others. found previously. The logical agreement that people are causing a dan “This paper ought to at long last stop environmental gerous atmospheric deviation is probably going to change deniers asserting that the ongoing watched KDYHSDVVHGSHUFHQWDVLQGLFDWHGE\WKHOHDGFUH reasonable a dangerous atmospheric deviation is a ator of the most legitimate examination regarding the piece of a characteristic atmosphere cycle. This pa matter, and could rise further after isolated research per demonstrates the really distinct contrast among that clears up a portion of the rest of the questions. provincial and restricted changes in atmosphere of Three examinations distributed in Nature and Nature the past and the genuinely worldwide impact of an Geoscience utilize broad chronicled information to thropogenic nursery emanations,” said Mark Maslin, appear there has never been a period over the most HGXFDWRURIFOLPDWRORJ\DW8QLYHUVLW\&ROOHJH/RQ recent 2,000 years when temperature changes have don. been as quick and broad as in ongoing decades. Past examinations have appeared close unanimity It had recently been idea that comparatively emo among atmosphere researchers that human elements tional pinnacles and troughs may have happened be YHKLFOH GHSOHWHV SODQW ¿UHSODFHV ZRRGODQG IUHH fore, incorporating into periods named the Little Ice dom, and different wellsprings of ozone harming Age and the Medieval Climate Anomaly. Be that as substances are in charge of the outstanding degree of it may, the three investigations use reproductions de an unnatural weather change. SHQGHQWRQLQWHUPHGLDU\UHFRUGVRIWHPSHUDWXUH A recent report in Environmental Research Letters change, for example, trees, ice, and residue, from all GLVFRYHUHG  SHUFHQW RI DWPRVSKHUH UHVHDUFKHUV mainland’s that demonstrate none of these move concurred with this connection in 12,000 scholar ments occurred in the greater part the globe at any O\ SDSHUV WKDW FRQWDLQHG WKH ZRUGV ³DQ (DUWKZLGH one time. temperature boost” or “worldwide environmental The Little Ice Age, for instance, achieved its out FKDQJH´IURPWR$ZHHNDJRWKDWSDSHU UDJHRXVSRLQWLQWKH¿IWHHQWKFHQWXU\LQWKH3DFL¿F hit 1 million downloads, making it the most gotten to 2FHDQ WKH VHYHQWHHQWKFHQWXU\ LQ (XURSH DQG WKH SDSHUHYHUDPRQJWKHRUPRUHGLDULHVGLVWULEXWHG nineteenth century somewhere else, says one of the by the Institute of Physics, as per the creators. investigations. This restriction is particularly not The pushback has been political as opposed to logi quite the same as the pattern since the late twentieth FDO,QWKH86WKHFRQVHUYDWLYHUHVHDUFKRUJDQL]D century when records are being broken a seeming tion the Competitive Enterprise Institute is suppos ly endless amount of time after year over nearly the edly putting weight on NASA to expel a reference whole globe, including this present summer’s Euro WRWKHSHUFHQWH[DPLQDWLRQIURPLWVZHEVLWHSDJH pean warmth wave. 7KH &(, KDV JRWWHQ RFFDVLRQ ¿QDQFLQJ IURP WKH Real temperature moves in the inaccessible past are American Fuel and Petrochemical Manufacturers likewise liable to have been basically brought about DQG&KDUOHV.RFK,QVWLWXWHZKLFKKDYHDORWWRORVH by volcanic ejections, as indicated by one more of IURPDFKDQJHWRDORZFDUERQHFRQRP\ WKH H[DPLQDWLRQV ZKLFK FODUL¿HV WKH VROLG ZRUOG Be that as it may, among scholastics who concentrate wide vacillations in the principal half of the eigh the atmosphere, the assembly of conclusion is like teenth century as the world moved from a volcanical O\IRUWLI\LQJDVSHU-RKQ&RRNWKHOHDGFUHDWRURI ly cooled period to an atmosphere warmed by human WKH¿UVWDJUHHPHQWSDSHUDQGDVXEVHTXHQWUHSRUWRQ discharges. This has turned out to be especially ar the “accord about agreement” that took a gander at a ticulated since the late twentieth century, when tem scope of comparable gauges by different scholastics. perature ascends more than two decades or longer +HVDLGWKDWWRZDUGWKH¿QLVKRIKLV\HDUFRQVLGHU have been the quickest in the previous two centuries, period there was more understanding than toward the takes note of the third. VWDUW³7KHUHZDVSHUFHQWORJLFDODFFRUGLQ The creators state this features how surprising warm that people are causing a worldwide temperature al ing has moved toward becoming as of late because of teration.” With ever more grounded research from mechanical discharges. that point forward and expanding warmth waves and “There is no uncertainty left as has been indicated extraordinary climate, Cook accepts this is probably broadly in numerous different investigations tend going to have risen further and is presently taking a ing to a wide range of parts of the atmosphere frame shot at an update. Sangalo 2019 20 Issue 19, Year 19

THE TELESCOPE WONDERS!!!

NIRBIRODH TIMALSINA

Have you ever heard of a Telescope?Have you pressing.Galileo used his telescope to do some cool looked in one?If you haven’t your questions might things.There was a belief that the moon was smooth be answered. but Galileo found out that the moon was really not A telescope is an optical instrument that makes dis smooth,it has mountains and craters and was bumpy. WDQWREMHFWVDSSHDUPDJQL¿HGE\XVLQJDQDUUDQJH $OVRKHORRNHGDW-XSLWHUDQGIRXQGWKDWWKHPRRQV ment of lenses or curved mirrors and lenses, or var were moving.He did alot of these types of research ious devices used to observe distant objects by their and published a book. HPLVVLRQDEVRUSWLRQRUUHÀHFWLRQRIHOHFWURPDJQHW 7HOHVFRSHVKDYHKHOSHGSHRSOH¿QGRXWPDQ\WKLQJV ic radiation. about space and it will keep doing so.Telescopses Telescopes are like binocluars.They help you see have been around for a long time.Telescopes were things that a naked eye might not see and might not not always perfect things to look at. Some did not see that clearly.There are alot of different types but work clearly and some couldnt see far .Before Tele they all do basiclly the same thing. scopes were just lends to look at things. They were There are two basic types of telescopes, refractors like magnifying glasses. Later on this Telescope DQGUHÀHFWRUV7KHSDUWRIWKHWHOHVFRSHWKDWJDWKHUV got improved to the Telescope that we know today. the light, called the objective, determines the type of Telescopes are good to look in at night but some telescope. you could look in the day time too. The telescope The main purposeof a Telescope is look in the sky has many parts in order to make it work good. It has for stars and such things but I use them to look at D¿QGHUVFRSHWKHOHQGVVWDQGDQGH\HSLFHV7KHVH landscape too.It is quite a common belief that Ital work together to make a proper Telescope. There are ian astronomer Galileo Galilei invented the tele different types of Telescopes for different purposes. scope but this is not strictly true. The earliest work Some are to view far away stars and planets, some to ings towards the design of the refracting telescope view the landscpe and very much. ZHUHPDGHE\*HUPDQ'XWFKOHQVPDNHU+DQV/LS There are alot of wonders in a Telescope from the top SHUVKH\LQ*DOLOHR*DOLOHLGLGQRWPDNHLWWKH to bottom.These all work together to make a Tele Telescope but he used it to get more famous,this is VFRSH7KHQH[WWLPH\RXVHHRQHPDNHVXUHWRUHPH also why people mistake Galileo Galilei for making ber how amazing it is from a small peice of glass the Telescope.Galileo Galilei made a telescope later lends to this amazing product. on and improved.However he did not see the Tele scopes made by the Dutches so that was still very im NEPAL

DIVYA PANDEY Nepal is a beautiful place Amazing sights to see Great places to go to For different people to see. Asking ourselves can we fix this? Rivers that are polluted Some issues that can be fixed Polluted air we aren’t supposed to breathe in Scary roads to drive on We know that we can fix this Pollution we need to fix Traffic no one really likes A place to see different sights For you to see and everyone else. Wires tangled everywhere Nepal is a beautiful place People trying to fix the problem An amazing place to be Because Nepal is a beautiful place 21 ASPIRING YOUNGSTER: SUKRITY DHUNGEL

AYUSHMA SHARMA

2XU ORQJWLPH FRPPXQLW\ PHPEHU everyone chooses to express their culture Sukrity Dhungel, daughter of Sunil LQDGLIIHUHQWZD\DQGWKDW¶VRND\,ID Dhungel and Sujata Dhungel placed 1HSDOHVH$PHULFDQ FKLOG GRHVQ¶W VSHDN WRS  LQ WKH  0LVV 1HSDO 86$ Nepali, that’s nothing to be ashamed competition. Since moving to North RI7KDWGRHVQ¶WPHDQWKH\¶UH³OHVVFXO Carolina in 2011, she has been a role tured”, they still partake in our beauti model to all the youth in the commu IXOFXOWXUHLQRWKHUZD\V2ULIDIDPLO\ nity. She taught at our Nepali School, chooses to go to the “Mandir” just once performed at our celebrations, and a month, rather than every week, that’s volunteered at many different events. RND\ 7KDW GRHVQ¶W PHDQ WKH\¶UH DQ\ ,QVKHEHJDQKHUFROOHJHOLIHDW ³OHVV+LQGX´ 81&&KDUORWWHZKHUHVKHLVFXUUHQWO\ 4. Being a Nepalese-American, how pursing a degree in Philosophy with a GLG \RX OHDUQ WR ¿QG D JRRG EDODQFH double minor in International Studies between both cultures? and Anthropology. After college, she Like I previously said, culture is not a bi intends on going to Law School to further her educa nary concept. It’s not just “oh you’re American” or tion. ³RK\RX¶UH1HSDOL´WKHDPD]LQJWKLQJLVWKDW\RXJHW Below is an interview with Sukrity Dhungel, where to pick and choose what aspects of the two cultures VKHWDONVDERXWKHU0LVV1HSDO86$MRXUQH\DQGKHU \RX ZDQW WR LQFRUSRUDWH LQWR \RXU OLIHVW\OH ,¶YYH involvement in the Nepali community. found a good balance by mixing my two worlds 1. Tell us a little bit about yourself? Where were together. I introduced my mom to pizza and pasta, you born? Where did you go to school? while introducing my friends to Momos. We go to Currently, I’m 21 years old pursuing a Bachelor of the “mandir” and celebrate Laxmi Puja, while also Arts in Philosophy, with a double minor in Interna opening gifts in December under our Christmas Tree. tional Studies and Anthropology. I was born in Iowa, I’m friends with girls like Ayushma, Neha, and Sa EXWOLYHGLQ2PDKD1HEUDVNDIURPWKHDJHRIWR PHHNVKD  ZKLOH DOVR EHLQJ EHVW IULHQGV ZLWK JLUOV After that, I moved to North Carolina and have been like Lauren, Chloe, and Claire. My music playlist KHUHVLQFH KDVDUWLVWVOLNH$'DQG5RKLW-RKQ&KKHWULEXW 2. How did you begin getting involved in the Nep- I also love listening to Ariana Grande and Drake. alese community, and in what ways have you been 5. As a child, did you ever think that you would involved since then? take part in a competition such as Miss Nepal 0\SDUHQWV VSHFL¿FDOO\P\PRP ZHUHZKDWSDYHG USA? P\ MRXUQH\ LQ WKH 1HSDOL FRPPXQLW\ 0\ ¿UVW LQ As a child, I had competed in a couple pageants that YROYHPHQWZDVDGDQFHSHUIRUPDQFHDWWKHDJHRI my parents put me in, so yes, I always dreamed of on stage at an event hosted by Nebraska’s Nepalese P\VHOIRQVWDJHDVD³JURZQXS´ZLWKDFURZQRQ Society. A few years later, my mom began teaching my head.Did I ever think I would be in a competition at the Nepali school of that organization, and I went OLNH0LVV1HSDO86"1RZD\,QHYHUNQHZVXFKD with her and began learning how to read and write in competition would ever come into existence, and I’m Nepali. Taking my experience from that, after mov VRJODGWKDWLWGLG,W¶VJLYLQJVRPDQ\1HSDOL$PHUL ing to North Carolina, I volunteered as an assistant can girls an opportunity to grow as a person and truly WHDFKHUIRU\HDUVDWWKH1HSDOLVFKRROKHOGE\WKH PDNHDGLIIHUHQFHLQRXUFRPPXQLW\,ORYHHYHU\ Nepal Center of North Carolina. In terms of arts, I’ve WKLQJDERXWWKHRUJDQL]DWLRQ found a lot of joy in performing dances every year at 6. When did you decide that you wanted to take Dashain, Teej, New Year, and International Festivals. part in Miss Nepal USA, and what made you de- ,Q,WRRNDVWHSRXWRIP\FRPIRUW]RQHDQG cide? DXGLWLRQHGIRUDQGSDUWLFLSDWHGLQWKH0LVV1HSDO86 I had seen applications open months before I applied, 3DJHDQWDQGSODFHGLQWKH7RS I saw it, thought about it, and forgot. Miraculously 3. What is the biggest life lesson that you have  WKH GD\ RI WKH GHDGOLQH , VRPHKRZ UHPHPEHUHG learned through your volunteering experiences about the competition. I looked at the website and with the Nepalese community? FRXOGQ¶WEHOLHYHP\H\HVLWZDVWKHODVWGD\WRDSSO\ The biggest lesson I’ve learned is that culture is not ,WRRNWKDWDVDVLJQDQGMXVWZHQWIRULW$Q\RQHZKR an absolute concept, it is rather a phenomenon that knows me knows that I am not one to shy away, and KDVPDQ\OD\HUVDQGDVSHFWVLW¶VFRQVWDQWO\FKDQJ ,FRXOGQ¶W¿JKWP\FXULRVLW\HLWKHUZKDWZRXOGLWEH LQJDQGDGMXVWLQJZLWKJURZLQJWHFKQRORJ\QHZSRO like? What was I getting myself into? I had no clue, itics, and new societal values. And I’ve learned that but I went for it, and I don’t regret it one bit.

Sangalo 2019 22 Issue 19, Year 19 7. Is there a connection between your involvement a person. Even if you don’t win, you will leave the in the Nepalese community, and your decision to SDJHDQWIHHOLQJFRQ¿GHQWDQGFDSDEOH$OVRLQOLIH take part in Miss Nepal USA? If so, what is that it’s not good to judge others, nor do we like being connection? judged. However, being watched for days makes you $ KXJH FRQQHFWLRQ 0RUH WKDQ DQ\WKLQJ , NQHZ , UHÀHFWRQ\RXUDFWLRQV$UH\RXDNLQGSHUVRQ"$UH KDG VXSSRUW )RU  \HDUV , YROXQWHHUHG DQG WDXJKW you understanding? Are you always positive? It’s a community members’ children how to read and write JUHDWZD\WRUHÀHFWRQ\RXUVHOI Nepali, how to sing Nepali songs, and how to dance 13. What platform has participating in Miss Ne- to them as well. I had parents constantly come up to pal USA, and placing top 5 in the competition PHDQGWKDQNPHIRUP\HIIRUWVDQGLWZDVWKDWVXS provided for you? SRUWWKDW,UHFHLYHGWKDWJDYHPHWKHWDGELWRIFRQ¿ ,PHWVRPHDPD]LQJSHRSOHOLNH0DOLQD-RVKL1LPD dence I needed to decide to participate. I knew that I Rumba, and board members that put together events had a huge team rooting me on and who believed in OLNH 0LVV 1HSDO 86 DQG WKH 1HSDOL 1DWLRQDO &RQ me, and even if I didn’t win the competition, I knew vention. I’ve been given the contacts I need to create I had a community of people who would be proud some real change in the Nepali community of me 14. What are your plans for the future? 8. What is the journey like for Miss Nepal USA? At the moment, I’m really just focusing on school so How long was it? How much training did it require? WKDW,FDQKHDGWRODZVFKRROLQWKHQHDUIXWXUH2Q It was amazing and I wouldn’t trade it for any other the side, however, I’ve begun working on a project H[SHULHQFH3HRSOHDVVXPHWKDWWUDLQLQJIRUDEHDXW\ involving the Nepali community that I hope to share pageant consists of focusing on beauty, but honestly E\)DOO we didn’t even think twice about our looks until the 15. What are your hobbies? What do you enjoy day of the pageant. It was a few days long and we doing in your free time? worked on different techniques for tackling different As a college student, most of my free time is occu portions of the pageant like our walks, public speak SLHG ZLWK KRPHZRUN VWXG\LQJ DQG ZRUNLQJ EXW LQJFRQ¿GHQFHWKHWDOHQWVKRZDQGFKRUHRJUDSK\ when I’m not, I love listening to podcasts on un From early in the morning until late at night, we solved murders and conspiracy theories, watching ZRUNHGUHDOO\KDUG,WZDVVRPXFKIXQEHLQJZLWK VSRNHQZRUG SRHWU\ GRLQJbeauty pageant, but in life as well. ZDVQ¶WDJHQHUDWLRQRI1HSDOL$PHULFDQNLGVERUQLQ 12. Would you encourage others to participate in WKH86ZKRZHUHROGHUWKDQPHIRUPHWRUHDFKRXW Miss Nepal USA as well? And if so, for what rea- WREXW\RXJX\VDUHOXFN\

23 A DAY IN NEPAL

HISHI ULAK

The crack of dawn paints streaks of coral on the awakening sky As chirps from birds sing in harmony, calling everybody to open their eyes The people of Nepal stir as rays of sunlight burst into their homes As they talk across their balconies about the weather and where they will roam. The shouts of the mango sellers intertwine with this melodious chatter The people may not have much but to them it does not matter The sun rises overhead, staring at the busy life below, As umbrellas shelter the people from its gaze and its glow The engines of the motorcycles and buses hum on the traffic packed roads As students dressed in navy walk, conversing about their workloads The antique buildings stand bold with their scrapes and scars, Welcoming nearby visitors as well as those traveling from afar Meanwhile in Patan, the pigeons rest, perching on temple tops, And the people enjoy each others’ company, whether in restaurants or in shops The day begins to end, one would think, But the country never sleeps, not a second nor a blink The sun becomes tired and leaves way for the moon, The two only seen together on the Nepali flag, but will see each other soonvz The hum of the country never fades away, As the orbs of light illuminate the cities through every crook and alleyway Festive dances and costumes fill the town square, While grandparents and children ignite with joy, never wishing they were elsewhere. Friends and couples hand in hand roam the streets, Looking for momo, bursts of flavor encased in dough, to eat The people return to their homes to their loved ones, Before they sleep, they tell stories about their midday runs, They close their eyes and the crickets sing and call, As another day ends in Nepal. MY NEPAL

SALIL DHAKAL Nepal here I come! Waterfalls, Boating and more What do we see? FUN! FUN! FUN!

Kathmandu: We see big temples, Where are we now? Busy streets with a log of cars, We are in Gorkha! Motercycle, buses and peole We see Sneaky Monkeys, Cows, Buffalos, Goats, VROOM, VROOM, VROOM! Crops and more! WONDER, WONDER, WONDER! Where are we now? we are in Pokhara! I saw many thigs in Nepal What do we see? But, I like Mountains the BEST, BEST, BEST! We see calm streets, Fish-tail Mountain, I LOVE NEPAL Fewa and Begnas Lakes, MORE, MORE, AND MORE!

Sangalo 2019 24 Issue 19, Year 19 HELP WANTED: ALL Call: 919-380-0113POSITIONS

PATEL PLAZA: Additional Parking with two entrances for a much easier shopping experience! • Indian & Pakistani Groceries Fresh Vegetables: • Frozen Foods & Ice Cream Every Tues.,Thurs., & Sun. • Fresh Sweets & Snacks • Halal Meat Get SALES INFO via TEXT, • Assorted Fish simply enter your cell phone # at store! • Stainless Steel Utensils or LIKE us on FaceBook • Clean & Organized at Patel Brothers Cary. • 12,000 sq ft Super Store! We Accept EBT Cards Khanna & Son Jewelers Visa, MC, Discover & Am Ex Located next door to Patel Bros.

OPEN 7 DAYS WEEK (10:30 AM - 9 PM) 919.380.0113 / Patelbros.com 802 E. Chatham Street, Cary, NC 27511 Mahesh Patel, Pravina Patel and Umang Patel

&DU\/HH)DPLO\'HQWLVWU\  We offer personalized high-quality care in general and specialty dentistry  to patients of all ages. We are accepting new patients now!

We are in-network with all major insurance ™ Cleaning & Exam companies, including Medicaid and Cigna DHMO. ™ Fillings ™ Root Canals New Patient Special (Patients w/ No Insurance) ™ Crowns/Bridges $99 Comprehensive Exam, X-rays, Cleaning* ™ Implants *regular prophylaxis ™ Periodontics ™ Dentures Ask us about our in-house plan, J-Plan! ™ Emergency Treatment

We are open Monday – Saturday 8:30AM-5:00PM



Cary Lee Family Dentistry

1500 Piney Plains Road, Ste. 101

Cary, NC 27518

(919) 388-7777 [email protected] www.carydentalgroupnc.com

Dr. Jae Lee, DDS, PA Dr. Jaehee Yoo, DDS Dr. David Kwon, DMD, Board Certified Perio/Implant Specialist cd]l/sfdf klxnf] kfOnf 6]Sg] æg]kfnL sf]nDa;Æ cd]l/sf g]kfnLsf nflu ;kgfsf] b]z aGb} cfPsf] g]kfnsf] klxnf] On]lS6«sn OlGhlgo/ eP/ 5 . s] afnaflnsf, s] lszf]/, s] o'jf, s] j[4– ;a} kBd;'Gb/ !(@% df g]kfn kms]{ . t/, /f0ff pd]/sf g]kfnLdf Psk6s cd]l/sf x]g{ kfP x'GYof] ;/sf/sf] cg'dlt glnO{ ljb]z uPsf] eg]/ pgnfO{ eGg] ;f]rsf] ljsf; ePsf] 5 . cfPkl5 a:g] cj:yf g]kfn k|j]z ug{ g} lbOPg . To;kl5 pgL ef/tsf] ldn] kms{g]sf] eGbf a:g]s} ;+Vof a9\bf] 5 . clxn] t bflh{lnª glhs} v:of{ªdf lgjf{l;t eP . pgn] cd]l/sfsf x/]s /fHodf y'k|} ;+Vofdf ldgL g]kfn cfkm\gf] klxnf] of]hgfsf ?kdf kmfhL xfO8«f]On] ag]sf 5g\, aGg] qmd lS6«s k|f]h]S6 :yfk- hf/L 5 . gf u/] / v:of{ªdf nfvf}F g]kfnLn] ;kgfsf] lah'nLaQL afn] . b]z agfO;s]sf] cd]l/sf ;g\ !(#( df ef/ cfpg] klxnf] g]kfnL sf] tdf zf;g ul//x]sf] xf]nf < w]/}sf] dgdf of] tTsflng la|l6; k|Zgn] 3/ agfPsf] x'g zf;sn] pgnfO{ df]/ª ;S5 . ToxL k|Zgsf] pQ/ xfO8«f]On]lS6«s sDkgLsf] lnP/ cfPsf] 5 of] cfn]v . lrkm OlGhlgo/ agfP/ cd]l/sf cfpg] klxnf] g]kfn k7fof] . pgn] g]kfnL lyP– kBd;'Gb/ lj/f6gu/ h'6 ldnsf dNn . eQmk'/] dNn nflu kfj/ :6];g /fhfsf ;Gtfg kBd;'Gb/ agfP . kl5 pgn] sf] hGd ;g \ !*() df w/fg / jL/uGhdf klg eQmk'/sf] vf}df 6f]ndf kfj/ :6];g l8hfOg ePsf] lyof] . pgsf] u/]sf lyP . kl/jf/kl5 sf7df8f}+sf] g]kfndf /f0ff zf;g c;gdf a;fO { ;¥of} . ktg ePkl5 ;g= !(%) To;kl5 pgL b/af df kBd;'Gb/ sf7df8f}+ xfO:s'ndf egf{ eP/ kms]{ / ;g\ !(&$ df k9\g yfn] . ha pgn] :ju{jf; x'g'cl3 pgn] Pshgf hfkfgL af}4 leIf' afFsL hLjg g]kfnd} / hfkfgL gful/s PsfO latfP . sfjfu'rLnfO{ sf7df8f}+df pgnfO{ g]kfnL xfO8«f] e]§fP, pgnfO{ hfkfg kfj/sf hgs cyf{t\ uP/ pRr lzIff lng] /x/ kmfb/ ckm g]lKnh xfO8«f] hfUof] . t/, g]kfnsf] tTsflng /f0ff zf;gsfndf /} kfj/sf ?kdf ;Ddflgt ul/b} cfPsf] 5 . tLsf 5f]/fnfO{ To;f] ug{ 5'6 lyPg . o;/L kBd;'Gb dNnsf kfOnf klxnf] g]kfnL kfOnfsf egfO g} 5 lg, hxfF OR5f ToxfF pkfo . kBd;'Gb/n] ?kdf cd]l/sfdf 6]lsPsf] Oltxf; kfOG5 . Oltx- klg Pp6f pkfo lgsfn] . ;g\ !(!^ df pgL cfkm\gf f;sf] of] klxnf] kfgfn] s] b]vfpF5 eg] cfheGbf bfh' hut;'Gb/ dNnnfO{ lnP/ snsQf uP . ToxfFaf6 !)) jif{cl3 Pshgf :jKghLjL g]kfnL cj;/sf] hxfh r9]/ hfkfg k'u] . pgnfO{ 6f]Sof] OlG:6Ro'6 ckm vf]hL ub}{ cd]l/sf cfOk'u]sf lyP . 6]Sgf]nf]hLdf egf{ u/]/ cWoogsf] rfFhf]kfFhf] ldnfPkl5 pRr lzIff xfl;n u/]/ cfkm\g} dft[e'ldsf] ;]jf bfO hut;'Gb/ eg] ToxL af6f] eP/ u'kr'k g]kfn kms]{ . ug{ kms{bf klg pm Tof] cj;/af6 al~rt x'g'k/]sf] lj1fgdf :gfts u/]kl5 pgL s]xL hfkfgL ;fyL;Fu lyof] . cfh kl/l:yltdf cfgsf tfg km/s ePsf] ldn]/ ;g\ !(!( df pRr lzIff cWoogsf nflu 5 . kBd;'Gb/sf] kbrfk k5\ofpFb} nfvf}F g]kfnL cd]l/sf xflgP . of] ldltsf cfwf/df xfdL s] eGg kBd;'Gb/ cd]l/sf cfO;s]sf 5g\ . t/, b'ef{Uo km/s ;S5f}F eg] ;g\ !(!( df cd]l/sfdf klxnf] g]kfnL s] 5 eg] clxn] g]kfn kms{g kfP klg cem} g]kfn kfOnf 6]lsof] . cd]l/sf k'u]/ kBd;'Gb/ ldlrug kms{g] jftfj/0f rflxF alg;s]sf] 5}g . /fHosf ] k|ltli7t o'lgel;{6L ckm ldlrugdf On] tL dxfg :jKgb|i6f kBd;'Gb/ dNn h;n] cd]l/sfdf lS6«sn OlGhlgol/ªdf egf{ eP . pgn] ToxLaf6 ;g= klxnf] g]kfnL kfOnf 6]s] / nfvf}F g]kfnL kfOnfsf !(@@ df On]lS6«sn OlGhlgol/ªdf :gfts u/] . nflu uf]/]6f] sf]l/lbP, pgL g]kfnLsf nflu sf]nDa; o;/L pgL cd]l/sfdf klxnf] kfOnf 6]Sg] g]kfnL dfq lyP eGbf klg cTo'lSt gxf]nf . ePgg\ . g]kfns} klxnf] On]lS6«sn OlGhlgo/ klg eP .

25 df}g cfGbf]ng

lzv/ b'nfn p;nfO{ lbSs nflu;s]sf] lyof] . slt gd:sf/ rf;f] 5}g . p;n] h:tf] nfP klg x'G5 . h;/L lxF8] ul//xg] xf]nf . xfO{ x]Nnf] ubf{ dfq} x'g] 7fpFdf b; klg x'G5 . l:nk cf]e/ klg p;nfO{ k/ld;g 5 . pm cf}+nf hf]8]/} gd:sf/ ug]{ rng s;n] rnfPsf] :jtGq 5] / t p;n] ;w}F AA klg NofpF5] . lbdfudf xf]nf x} g]kfndf < cem lgx'/]/ v'§} 9f]Ug] rng t p;nfO{ s'g} j8{g eGg] g} 5}g . pm ;w}F k|]m; d'8df 9'Ëfsf] kx/} x'g] u5{ bz}+tfsf . v} cd]l/sgx?sf] x'G5] . p;sf] AofOk|]mG8nfO{ lg 3/df Nofpg Pnfp8 Toqf] lqm;d;df s]jn xfO{n] rN5 . s;}n] s;}sf] 5 . pgLx? ljs]G8 l:jldª hfG5g\ . lhddf ;fy v'§fdf 9f]Ub}g . xfd|f] dfq} sflxF gePsf] p6\k6\ofª . ;fy} . hLjg eg]sf] To:tf] kf] x'g'k5{ . p;sf x'Fbfx'Fbf cd]l/sfdf klg xfdLn] kmnf] ul//xg' k/]sf] 8\of8 dd ufpFaf6 ;f]em} l8=eL= k/]/ cfPsf . d]/f af 5 . To} gd:sf/ d} t e'n]sf /x]5g\ g]kfnLx? . cfdf :6'8]G6 leiffdf cfP/ k9]/ oxfF cem x'nd]n eO{ 5f]/fn] B, C Nofof], casf] kfnf] r} A g} Nofpg] ;s]sf . lk=Pr=8L= wf/Lx? . s] eGg] v} < k9]/ klg agfOlbg' k|e' eg]/ dlGb/ leqsf] 9'Ëf h;nfO{ cgk9 h:tf] u/]kl5 s:sf] s] nfU5 < yfxf kfO{ kfO{ b]jtf elgG5 . To;nfO{ km"n k};f kmnkm"n oflS6ª ug]{nfO{ s] eGg] < r9fP/ k'sfl/G5 . d t lbSbf/ e};s]F slxn] xfO slt ;Demfpg] d}n] < slt dfq} ;?sf] pbfx/0f :s'n ;lsG5 / sn]h hfg kfOG5 . To;kl5 dld lbg] < d / p:df km/s 5 /] < p;sf] h:tf] afafsf] ;f/f srsrx? t ;'Gg kb}{g . To;kl5 t h] :jtGqtf lbof] eg] d emg\ lau|G5' /] . P afaf Ps u/]klg ef] . h] vfP klg h] nfP klg . hlt a]nf;Dd k6s t k|flS6sn ul/ x]/ d lau|Fbf] /x]5' ls ;lk|Fbf] ;'t]klg, /fte/ Uofd v]/ latfPklg s;}sf] 8/ /x]5' . x'Gy]g . labfdf klg 3/ guP/ ;fyL efO;Fu xfOlsª, lxhf] dfq} 8\of8n] elg:of] . lalu|of] eg] t d'le htf htf /dfOnf] x'G5 Tot} uP e} xfNof] . ;lSsuf] lg 5f]/L < xfd|f] vfGbfgLkg ;f/f rf}k6 x'G5 cfkm\gf] dg nfu]sf] vr{ ug{ klg kfOof] . /] < 5f]/L nfO{ ldof]df afFw]/ /fVbf dfq} vfGbfgL sIff !! df kl9/x]sL lbkf;fnfO{ 3/af6 lgl:sxfNg hf]lug] s:tf] hftsf] vfGbfgL xf] of] Kofs'/]nsf] dfq} < dg 5 t/ cem} Ps jif{ s'g{ kg]{5 sn]hsf nflu . uf]tfd], e08f/L, l;Ub]n v} s;}sf] vfGbfgL s]xL ef pm al;/x]sf] :6]6af6 6f9f cs}{ :6]6sf] o'lgel;{l6 5}g < pgsf 5f]/Lx? 8fG; /]i6'/]G6 hfg 5f]8\b}gg\ < HjfOg x'g rfxG5] t ;don] p;nfO{ To:tf] h'/fpF5 jlnª v]Ng lg:s]s} x'G5g\ xfkmk]G6 nfP/ . pgsf] h'/fpFb}g Tof] t csf]{ jif{ yfxf x'g] g} 5 . 3/df ;fyL vfGbfgL st} lrKn]g t < lnPsf] cfPsf ] 8\of8nfO{ dg kb}{g . :Gofk Rof6 casf] cfGbf]ng :jtGqtfsf] < 8\of8n] km'6]sf] cfFvfn] b]lv ;lxl;Gg . s;/L k9fOsf] casf] n8fO{ 3/}af6 ;'? x'g'k5{ < clt ePkl5 s] hLjg rN5 < Psl5g df]jfOndf a:of] ls ufnL ug]{ < Ps jif{ t s] PsIf0f klg ca s'g{ x'Gg . unf}h . k9 k9, k9 . x}g slt k9\g] s] k9\g] < hlt gf/L d'lQmsf efif0f g]tfn] g]kfnd} l;sfPsf 5g\ . xf]djs{ Yof] Tof] t ul/ ;lsG5 Ps cfwf g]kfns} s'/f kmnf] u/fpg] Kof/]G6\;nfO{ g]kfnd} l;s]sf] 306fdf . k9\g] s'/} x'Gg . lsg ga'lem;s]sf] xf]nf dd cfGbf]ng h?/L 5 . oxfFsf] n] kf/ gnfpg] ef] . 8\of8n] . ahf/ uof] cfkm"n] eg] h:tf] n'uf lsGg cfhaf6 cfGbf]ng hf/L . ef]s x8\tfn . kfP lkhf kfOGg . ;fyLx? s:tf] /fd|f] n]6]:6 km];g nufP/ au{/ vfg] xf] ca gq s]xL vfOGg . bfneft ;fu bfn lxF8\5g\ . xfd|f] dd 8\of8nfO{ 5flt k"/} 8Dd 5f]Kg} aGb . k]K;Lsf]nf x}g ca lao/ g} lkpg] xf] . s'tf{ k5{ /] . udL{df klg km'n l:nk . afkm /] Ps jif{sf] DofS;L x}g ca xfkm k]G6 l6 ;6{ g} leg]{ xf] . hf/L ef] nflu !)) jif{ e};Sof] . x] eujfg ls t d]/f] 8\ cfdf ;d"x la?4 5f]/L cfGbf]ng . lkl8t 5f]/L Ps xf}+ . of8 ddnfO{ a'l4 b]pm ls t dnfO{ of] em\ofnvfgfaf6 pm n]Vb} uO{ . cfkm\gf efjgf ;a} kf]lv sfuhdf lgsfn . p;nfO{ w]/} xNsf eof] . cfh lgGb|f klg lgSs} ;fyLsf] ljjfxdf ;f8L rf]nf] g} nfpg'kg]{ /] . 8«];n] /fd|f] k¥of] . cfhsn p;n] cfkm\gf] cfGbf]ngsf] ;fx/f gx'g] . d]sk ug{ gx'g] . sfnf] r:df aGb]h . x}6 8fo/LnfO{ agfPsL 5 . p;nfO{ s]xL xb;Dd cf/fd sNr/n] lbdfu g} sNr/ ul/;Sof] . s:tf] sNr/ xf] ldn]sf] 5 . ;fFem kmf]g, l6=eL= eGbf olx Kof/f] 5 . of] < PsfO;f}F ztflAbdf cfP/ klg tfgfafgf klx/g < 8\of8 ddsf] s]xL u'gf;f] klg 5}g . ca t d yfls ;s]F . ;?sf 8\of8 ddnfO{ s]xL Sangalo 2019 26 Issue 19, Year 19 k'/fgf k':tfsf] cg'ej

;'jf; 9sfn != oxfFx¿ s'g jif{ ;+o'Qm /fHo cd]l/sf cfpg'ePsf] /x]sf] dlGb/ eg] ;g\ !(*^ df :yfkgf ug'{ePsf] xf] < xf], xfn cfP/ olt ljzfn ePsf] 5, c? klg slQ xfdLx¿ ;g\ !(*$ df klxnf] k6s cd]l/sf dlGb/x¿ v'n]sf 5g\ . clxn] t 3/ 3/df ehg cfPsf xf}F . d, gf/fo0f 1&6WDWH8QLYHUVLW\ 1&68  lst{g klg x'g] u5{ . g]kfnLx¿ klg w]/} 5f}F . df cWoog (Master of Science in Forestry) sf] ;fdflhs ;+:yfx¿ klg w]/} 5g\, xKt}lkR5] hd36 lznlznfdf cfPsf] x' / d, lgd{nf jxfF cfpg'ePsf] x'G5, e]63f6 x'G5, ;fx|} v';L nfU5 . bz}F, ltxf/, ^ dlxgf kZrft\ cfPsL x'F . cWoog kZrft\ ;g\ lth, g]kfn lbj; ldn]/ dgfpg] u/]sf 5f}F, dgaf6} !(*^ df xfdL g]kfn kms]{sf xf}F . cfgGb cfpF5 . xfdL t Psbd v';L ;g\ !(() df k'gM cWoog (PhD) Pj+ pT;flxt 5f}F . s} lznlznfdf d, gf/fo0f oxfF %= Toltv]/sf] cj:yfaf6 clxnsf] cfPsf] x'F / ;g\ !((! df cj:yfdf cfOk'u]sf] l:yltsf af/]df d, lgd{nf 5f]/Lx¿ h]lgsf / oxfFx¿sf wf/0ffx¿ /flvlbg' x'GYof] h]legfnfO{ lnP/ oxfF cfPsL x'F . ls < d, gf/fo0fn] ;g\ !((% df PhD xfdLn] w]/} kl/jt{gx¿ b]Vof}F . Toltv]/ ;SofPF clg 1&68 VI@ :DWHU OlG8og :6f]/x¿ / /]:6/' ]G6x¿ 5Fb} Quality Program cGtu{t Modeling lyPgg\ . d/d;nfx¿ xfdL g]kfnaf6 g} ug]{ ljifodf Post Doc sf] Position Nofpg] uYof}F . g]kfn ;Dks{ ug{ kfPF . d, lgd{nf klg cWoog ug{ cK7\of/f] clg dx+uf] lyof] clxn] slt yfn] / ;g\ !((% df Master of ;:tf] ;'ne ePsf] 5 . g]kfnL uLtx¿ 6FLHQFH LQ %LR 7HFK *HQHWLF ;'Gg gkfP slt ufx|f] x'GYof] . xfd|f ;SofPF . cWoog kZrft\ d, gf/fo0f Pshgf ldq ;'lgn g]kfn;Fu uLtsf Alabama sf] $10 8QLYHUVLW\ df Sof;]6 5g\ eGg] yfxf kfP/ /]s8{ sfd ug{ yfn]F / d, lgd{nf North u/]/ NofPsf lyof}F, clxn] slt ;lhnf] Carolina d } Environmental Protection Agency (EPA) 5 . ;g\ !(() sf] s'/f xf], 1&68 af6 k|;fl/t sf ] EPA Project cGtu{t sfd ub}{ cfPsf] 5' / xfn x'g] FM df OlG8og k|f]u|fdnfO{ cg'/f]w u/]/ gf/fo0f Senior Environmental Specialist sf] position df /x]/ uf]kfnsf] æltd|f] h:tf] d'6' d]/f] klgÆ ahfpg sfd ul//x]sf] 5' . nufPsf lyof}F, clxn] t ;lDemFbf klg cgf}7f] h:tf] @= clxn] ;Dd s'g s'g /fHox¿df a;f]af; ul/ nfU5 . ;g\ !(($ df xf]nf h:tf] nfU5, Raleigh df cfpg'ePsf] xf] < OlG8og :6f]/x¿ / /]:6'/]G6 v'n]sf], cfh x]g'{;\ t slt xfdLx¿n] clxn];Dd North Carolina / Alabama df 5g\ . Toltv]n cfkm\gf]kg w]/} ld; x'GYof], clxn] t ;a} a;f]af; u/]sf 5f}F . lrh 5 oxfF . clxn] cfpg]x¿nfO{ t s]lx cK7\of/f] g} #= oxfFx¿ z'?df cfpFbf s:tf] cj:yf lyof] < slt 5}g . ufx|f–cK7\of/f cj:yfx¿ kf/ ug'{eof] < 5f]6s/Ldf ^= cGTodf, nfdf] ;dosf] a;fO{ kZrft\ ;+ufn]sf ;+3if{, j0f{g ul/lbg' x'GYof] ls < pknAwL Pj+ cg'ejx¿sf af/]df s]xL elglbg' x 'GYof] ls < xfdLx¿n] vf;} ufx|f–cK7\of/f cj:yfx¿ kf/ hLjgdf cfkm}F Pp6f ;+3if{ xf] . ubf{v]/L h] s'/f klg ug'{k/]g . ;a}n] ef]Ug'kg]{ cfwf/e"t ;d:ofx¿ dfq ;Dej x'Fbf] /x]5 . d]/f -gf/fo0f_ ;fyLx¿ g]kfndf x'g\ . b'j}hgfn] drive gu?Gh]nsf] cj:yf, k'/fgf] uf8L cjsfz lng l7Ss k/]sf] a]nfdf d oxfF cWoog rnfpFbf ef]Ug'k/]sf cK7\of/fx¿, vfg]s'/fx¿ km/s ub}{ lyPF, sfd vf]hL/x]sf] lyPF . d}n] -lgd{nf_ oxfF x'Fbfsf] cj:yf clg 3/df xfdL rf/}hgf ljBfyL{ ePsf] cfP/ cWoog hf/L /fv]F, xfdL b'j}hgf clg b'j} x'Fbf ;a} s'/f ldnfpg'kg]{ cj:yf, oL cj:yfx¿ kf/ 5f]/Lx¿ ljBfyL{ eP/ klg cfkm\gf] cfkm\gf] nIodf ub} lxFl8of] clg la:tf/} afgL kb}{ uof] . k'Ug ;Sof}F . To;}n] ubf { h] klg ;Dej 5 . $= Toltv]/ g]kfnLx¿ sltsf] lyP < g]kfnLx¿ ;sf/fTds ;f]r / O{Zj/k|ltsf] cf:yfn] hLjg e]6\bf s:tf] cg'e"lt x'GYof] < xfd|f ;+:s[ltx¿, rf8kj{x¿ ;xh x'Fbf] /x]5 . h:tf];'s} cK7\of/fdf klg xfdLn] s;/L dgfOGYof] < oL af/]df hfgsf/L ul/lbg' x 'GYof] ls < eujfgnfO{ ;fFem–laxfg alQ afNg 5f8]gf}F . cK7\of/f Toltv]/ g]kfnLx¿ Psbd} sd lyP, cf}Fnfd} uGg ;do kl/l:yltx¿ x6]/ ;fdgf u¥of}F . Ps–csf{nfO{ ;lsg] . Ps–csf{nfO{ e]6\bf v';Lsf] l;dfgf g} xf};nf k|bfg ub}{, ;d:ofx¿ ;dfwfg ub}{ ;fy ;fy x'Fb}gYof] . ;Fu;Fu} e]nf eP/ bz}F, ltxf/, gofF jif{ cl3 a9\of}F, 5f]/Lx¿n] klg plQs} ;fy lbP, ToxL dgfpg] ul/GYof] . DxM k"hf dgfpg xfdL l8=;Ldf ;+3if{sf] ;fdgf u/]/ xf]nf pgLx¿ klg clxn] slt /fd dfnfsf/Ho"sf] 3/ hfg] uYof}{F, ;g\ @)!@ dha't 5g\, cfkm\gf] If]qdf /fd|f] ub}{ cl3 a9]sf b]lv eg] dgf]h k|wfgsf] cu|;/tfdf ot} ug{ yfn]sf 5g\ . pd]/ eg]sf] ; +Vof /x]5, dnfO{ -gf/fo0f_ nfO{ tanf 5f}F . dlGb/ hfg gkfpFbf dg lvGg x'GYof] . u+ufw/ ahfpg] OR5f lyof] Tof] OR5f d}n] ^) jif{sf] pd]/df zdf{Ho"sf] ;g\ !(&^ df cfkm\gf] 3/d} dlGb/ :yfkgf cfP/ k"/f u/]F . To;}n] cfkm\gf OR5fx¿ k"/f ug]{ sf]l;; ug'{ePsf] /x]5, dfG5]x¿ hfg] ub{y] . xfnsf] :yfgdf ug'{k5{, sf]l;; /fv ltdL hf/L, xf/ dfly lht x'G5 ef/L . 27 d}n] s]xL n]Vg} ;lsg pdf zdf{ d s]xL n]Vg vf]H5' clg lemgf] 8f]/Lsf] tfnd]n s] xf]nf< slxn] zAb h'b}{g dg l;/L+u eof], zAb x/fP/ uof] zAb e]6\bf cy{ a'l‰bg d}n] s]xL n]Vg} ;lsg slxn] ;Gbe{ g} ldNb}g w]/} h;f] cf}lrTo g} b]lVbg tLhdf s]xL n]v'FsL < snd g} gp7fpFb} xf]nLdf sljtf n]v"F ls eGy]F km'Ng gkfpFb} s'lNrPsf lgd{nfx?n] luHofP ;ft} /+unfO{ sfuhdf kf]v"F ls eGyF] cfkm\g} afa'n] a]r]sf ;ld{nfx?n] lg lwSsf/] aGb afs;sf ljwjfsf] l;pFbf] ;Dem]F d}n] s]xL n]Vg} ;lsg snd Tolx /f]sL lbPF d}n] s]xL n]Vg} ;lsgF bz}F cfof] Tof] klg gn]v]/} uof] nIdL k"hfdf klg s]xL n]Vg] g;f]r]sf] xf]Og k/b]zL 5f]/f] cfpnf elg dxfÍfnsf eofgs u/LaLn] s'/]/ a:g] cfdfx? ;Dem]F k6s k6s em:Sofof] a;]{gL cfu"d cfpg] afrf ug]{ b'w] afns e"OFdf /fvL sfvdf t]l;{g] 5f]/fx? lg ;Dem]F s6\of}/fn] lh:Sofof] o;kfnf d}n] sxL] n]Vg} ;lsg zAbx? ;a} z"Go eP cy{x? ;a} t'lxP/ uP ltxf/sf] t s'/} gu/f} d}n] s]xL n]Vg} ;lsgF cfFugdf cf]OnfPsf] ;okqLn] u'gf;f] u¥of] dnhn g} ge]6]sf] ;/:jtL k"hf cfpFbf dvdnLn] lg b'v];f] kf]Vof] jL0ff / k':ts wf/0f ug]{ hgo'4sf] gfddf l/lQPsf] ;/:jtL bv] ]F eg]/ n]v'FsL eGy] hgljlxg a:tL g} /f]of] d}n] t sfFwdf emf]nf /fvL t'Og r9]/ snd oxLF yftL /fv]F :s"n hfg] nfnf kf] b]v]F zAb oxLF ;fFrL /fv]F e/] 3/ kms{bf yfs]sf xft d}n] s]xL n]Vg} ;lsg .

;f]r cRo"t zdf{ cfkm'n] cfkm}nfO{ glrGbf b'Mv slt em]Ng] xf]nf xft ltdLn] lbFbf cfqmf]z xft nDsL cfpF5 Gof}/L df/L k5'tfpFbf ?g slt kg]{ xf]nf 5' 6f9f cfkm' nlDsFbf ;a guLr e}lbG5 åGå, 3[0ff TofuL cfkm"n] cfkm}nfO{ lrlglbG5 ;f]r ltd|f] /fd|f] x'Fbf cfTdLotf Tolx e}lbG5 d':s'/fO Ps af]nL ToxL ltd|f] /fh x'G5 . s'gf s'gfdf ;a ltd|} cfkm\g} cfkm\g} e}lbG5 wtL{ 6]ls cfsfz x]/L TolxF ltdL /dfpg] u/ jt{dfg xf] ltd|f] e"t u};Sof] eljio sxfF sxfF dgsf cGwsf/ TofuL k|sfz ltdL kfpg] u/ lt/:sf/ TofuL lbFbf ltd|f klxrfg hxfF hxfF cfsfz ltd|f] 3/ xf]Og wtL{ g} af; xf] cfkm"n] cfkm}nfO{ glrGbf b'Mv slt emNg] xf]nf hfG5f} hxfF /dfpg] u/ Tolx ltd|f] cfFug xf] Gof}/L df/L k5'tfpFbf ?g slt kg]{ xf]nf .

Sangalo 2019 28 Issue 19, Year 19 cflbslj efg'eSt cfrfo{ uhn

;ljtf lai6 gGbnfn ;'j]bL OdfGbfl/tfsf] laNnf ;w}F, gf/LnfO{ g} le/fp5g\ oxfF, 6'Kkfdf r9fpFb} km]b 9fNb}, ljqmd ;Dat\ !*&!, @( ut] dlxgf lyof] c;f/sf] gf/LnfO{ g} lu/fpF5g\ oxfF .. ;f]lx lbg o; w/fdf hGd x'g uof] efg'eQm cfrfo{sf] ufpF lyof] r'FbL /D3f Pjd\ lhNnf lyof] tgx'Fsf] cfkm\gf v';L ;f/f l/TofO{, tTsflng b'u{d lhNnf eO{sg klg rrf{ rNof] k|l;l4sf] . c?s} nflu afFlR5g\ gf/L, >Ls[i0f cfrfo{sf gftL tyf wgGhosf 5f]/f egL kljqtfls wlg gf/LnfO{, kl/ro lbGy] cfkm\gf] ;a}nfO{ oxL jfSo egL egL ckljq eGb} lk/fpF5g\ oxfF .. s'n 3/fgdf x's{Fb} lzIff klg lg/Gt/ kfpFb} uof . hGd}b]lv x]lklG5g\ gf/L, lzIff k|bfg ug]{ d'Vo u'? >L s[i0fnfO{ dfGbf eof . n}lª\us e]befjsf] rk]6fdf k/L Pslbg 3fF; sf6\b} u/]sf] 3fF;L;Fu crfgs e]6 x'g uof] cGofo lsg gf/LnfO{ dfq}, ;f] e]6 pgsf nflu clj:d/0fLo If0f aGg k'Uof] k'?ifn] lg af6f] la/fpF5g\ oxfF .. ;fdflhs sfo{ u/]/ dfq OHht, gfd sdfO{G5 egL k|]/0ff kfP 3fF;Laf6 b[9 ;+sNk lnP dgn] klg . km"n h:tL sf]dn gf/LnfO{, cfWofTd /fdfo0fnfO{ g]kfnLdf cg'jfb ul/sg la6'nfpg] ltg} k'?if x'G5g\, bf]if nfpb} gf/LnfO{ g} g]kfnL efiffnfO{ hglha|f]df NofO{ yfn] tf/f em}F rlDsg ;dfhsf] s73/fdf l5/fpF5g\ oxfF .. efg'eStLo /fdfo0fsf] kf7 g]kfne/L u'lGhof] kmn:j?k pgnfO{ cflbsljsf] pkflw k|bfg ul/of ] . ;dfhsf] gh/df a]Zof sxlnlG5g\ /f0ffsfnLg ;dfhdf ;flxTo ;[hgf s7Lg lyof] lagf k'?if gf/L dfq}, 3/L3/L y'gfdf kg]{ / 5'6\g] qmd klg hf/L /Xof] rl/qtfsf] d"No slxn];Dd cfkm\gf] b[9 ;+sNkaf6 cfkm"nfO{ k5L gx6fOsg gf/LnfO{ dfq} lt/fpF5g\ oxfF .. g]kfnL efiffsf] pTyfgdf nfu] lbg /ft gegL sg . efg'eStLo /fdfo0fnfO{ dxfsfJodf ulgof] k|Zgf]Q/, eQmdfnf cflb sfJo elg lrlgof] km's6/ sljtfdf klg ;fdflhs k|ltlaDa b]vfO{ zfzs ju{nfO{ afWo kf¥of] abNg b[li6sf]0f / x]/fO{ . s] b]z ljb]z ;a}lt/ plQs} Kof/f 5f} ltdL k|To]s g]kfnL dgsf] 9's9'sL ag]sf 5f} ltdL xfd|f] klxrfg / uf}/jsf] xf} d'Vo ltdL cfwf/ /xg]5f} o; nf]sdf ;w}F ha;Dd /xg]5g\ lbjfs/ .

29 kl/jt{g

uLtf a:g]t Sofn]08/n] sfFr'nL km]/] ;Fu} k|hftGq km]¥of}F, nf]stGq Nofof}F d / d]/f] bf}Ft/L k':tf nf]stGq ;f6\of}F, u0ftGq Nofof}F cfkm\gf] cfwf ztfAbLof}F Pskl5 csf]{ cfPsf] of] kl/jt{gsf] cfFwLn] hGdlbg dgfpFb} 5 . Pskl5 csf]{ cfPsf] of] tGqx?sf] af9Ln] of] sf];]9'+ufsf] w/ftn 6]Sb} d]/f] b]z g]kfnaf6 l/klAns g]kfn eP5 gf]:6flNhs eP/ ljZj dfglrqdf d}n] ;fg} b]lv ;'Gb} ufpFb} cfPsf] d]/f] b]z vf]Hb}5' /fli6«o uLtx? 8]6 PS:kfo/ eP5g\ ljb]zL e"lddf a;]/ rf}w c~rn krxQ/ lhNnf d]/f] hGde"ld ;DemFb}5' k|b]zx?df ljno eP5g\ t/ olQsf jif{x?df rf/ j0f{ 5lQ; hftsf] km"naf/Ldf afUdtLdf w]/} kfgL auL ;s]5 hfltotfsf] SofS6; pld|P5 /fhtGqdf x's]{sf] d]/f] k':tf ;+l3otfsf] gfddf cem} kl/jt{gsf nflu kl/jt{g u¥of}F em08f km]g]{ k|of; x'Fb}5 /] x8\tfn u¥of}F, cg;g a:of}F ufO{ sf6\g] ax; rNb}5 /] 6fo/ afNof}F, 9'+ufd'9f u¥of}F 6fpsf]df xft /fv]/ uf]nL vfof}F, ;lxb eof}F d]/f] k':tf ;f]Rb}5 /fhtGq kmfNof}F, k|hftGq Nofof}F s] xfdLn] rfx]sf] kl/jt{g olx lyof] <

Sangalo 2019 30 Issue 19, Year 19 NCNC Life Members 1 Devendra Man Amatya & Azal Amatya  .LVDQ8SDGK\D\D 3DP8SDGK\D\D 2 Shambhu Acharya  %DWX6KDUPD 3XMD6KDUPD  1DUD\DQ'HR $QQDSXUQD'HR  %LQD\D0DQDQGKDU 3LQNX0DQDQGKDU  6KDQWL5DMODZDW  %DOD.ULVKQD/DPGDUL %XGGKL.XPDUL/DPGDUL  ,VKZDU'HYNRWD .DPDOD'HYNRWD  6KUHHNDQW$GKLNDUL 6KDQWL$GKLNDUL  6DPDQWKD7KDSD 5DVKPL7KDSD  .XPXG'HYNRWD -DQXND'HYNRWD  -D\D5DM-RVKL 6XQGDUD-RVKL  7KDNXU3DQW 0XQD3DQW  3HWH$QGUHZV +DQQDK$QGUHZV  0DGKDY%KDWWDUDL 0LUD%KDWWDUDL  0DUN7XVWLQ 0DUFLD$QJHO  6KLVKLU.KDQDO 5LWD.KDQDO  /\QQ.QDXII  0RKD%KDWWD 6KRYD%KDWWD 11 Rama Dworkin  5LWHVK3RXG\DO 0XQD3RXG\DO 12 Narayan Rajbhandari & Nirmala Rajbhandari  7KDNXU.DUNHH 'XUJD.DUNHH  %LEKRU5LPDO 3UDQLWD5LPDO 

  .%$%'$.,%#$.!'(.*'$.).    

    &". -.!')%$(.

. #((%'. '. ' *$.' .).). !')$.).()+!.%.%!%'..%!. . &!. -.'. .

$$*!. !%%. '+
.&%&!.%$).!%%.)(.-'. "')%$.%. *(
"%.*'$.).'.()+".   7 ,,2)7!,!/*7!!1',%77! 7 7

  7 !)!/1',$7 1&7 &,275,1'7',7 !.)'7 6/701))717,1!/,1'-,)7!01'3*7 -**-/1'-,7 4'1&77
777 7 &.1!/7

!.)'71&0&)7"+'*57../! '1',%7)-,%71'+!7 !-.*!7)',',%72.71-71/57!.*'7#- 7171&!7 3-)2,1!!/7 520&+7&/+7 ,1!/,1'-,)7!01'3)7

',%!/77&()74--',%71&!7 /-4 7 2/',%7 &'/ 7!.)757/ !7 77-2171-701/17 0&',7 !*!/1'-,07 THE

TO MORTGAGE

WE LIVE HERE. WE SERVE HERE. OUR HEARTS ARE HERE. Al Dada and his team have helped many families create lasting roots in the Raleigh community. Now part of the Cornerstone family, they’re proud to help even more homebuyers!

EXPERIENCE THE CORNERSTONE DIFFERENCE • Established lender with more than 30 years of service • In-house, local processing and underwriting • More mortgage programs to meet your needs • Clear communication and amazing service at each step

SOAR HOME WITH LOANFLY® Our free, all-in-one app makes homebuying faster and easier!

AL DADA Mortgage Planning Specialist / NMLS 71411 Direct: 919.522.0849 [email protected]

WWW.ALDADATEAM.COM

5121 Kingdom Way, Suite 300 / Raleigh, North Carolina 27607 / Branch NMLS 1535071 Not a commitment to lend. Borrower must meet qualification criteria. Equal Housing Opportunity. :HDUHKHUHWRPDNHEX\LQJRU VHHOLQJUHVLGHQWLDOUHDOHVWDWH SURFHVVDVVPRRWKDVSRVVLEOH:H ZLOOZDON\RXWKURXJKWKHDQG H[SODLQVWHSE\VWHSSURFHVVIURP YLHZLQJWRFORVLQJ

Anuj Jai Ahlawat Broker

Welcome to the Neighborhood I would like to introduce my self to you all. I am broker working for prestige realty located in Apex NC.We at prestige Realty believe in honesty, integrity and believe in treated our clients with out-most respect and answer all questions that they might have. Give me a call and see what and how we can help you. We work in Triangle area and will do everything to save you money and help you get the best deal. We look forward to speaking with you. Prestige Realty

www.prestigerealtync.com

7HDP)HHLVUHTXLUHGWRMRLQDQGFRYHUV

WKHIROORZLQJ

7HDPDQGSOD\HU5HJLVWUDWLRQ

&ULFNHW(TXLSPHQW

6QDFNV:DWHUIRU7RYHUJDPHV Abdo guard is not provided*

Aman bhattarai Co-Founder (919-271-4740)

Welcome to the Apex Cricket Club Apex Cricket Club (ACC), an amateur cricket club located in the apex area of North Carolina. We are a part of the Triangle Cricket League (TCL) .Our primary mission is to actively Apex Cricket participate in and promote cricket at a recreational level with Club a competitive spirit, maintain the love, joy and spirit of the game on and off the field. We are actively looking for All rounder p layers to come and join. If you are interested please contact A man. Hamare haath, aapke saath. [email protected] CARY 301 PINNERWEALDWAY, Ste101 919-650-1323 RAVI REDDY © 2015AllstateInsurance Co. dre Protect yoProtect tr Preserve yo Preserve a ditions. ditions. a Allstate, themore you save. Callmetoday. retirement. Andthemore youprotect with life andbusiness.Icanalsohelpwithyour I offer qualitycoverage for yourhome,auto, I candoalotmore thanjustprotect yourcar. Help protect the goodlife you’ve made. ms. SM

u r u r

190385 
 

 
# #
  ##  #
#  
#" !#