CLDN7 (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

CLDN7 (Human) Recombinant Protein (P01) Catalog # : H00001366-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human CLDN7 full-length ORF ( NP_001298.2, 1 a.a. - 211 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYK protein) GLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAM FVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIV Antibody Production TDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYR APRSYPKSNSSKEYV Protein Array Host: Wheat Germ (in vitro) Theoretical MW 48.8 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Publication Reference 1. Trypsin-2 Enhances Carcinoma Invasion by Processing Tight Junctions and Activating ProMT1-MMP. Vilen ST, Suojanen J, Salas F, Risteli J, Ylipalosaari M, Itkonen O, Koistinen H, Baumann M, Stenman UH, Sorsa T, Salo T, Nyberg P.Cancer Invest. 2012 Aug 21. Page 1 of 2 2016/5/20 Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 1366 GeneBank NM_001307.3 Accession#: Protein NP_001298.2 Accession#: Gene Name: CLDN7 Gene Alias: CEPTRL2,CPETRL2,Hs.84359,claudin-1 Gene claudin 7 Description: Omim ID: 609131 Gene Ontology: Hyperlink Gene Summary: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM Other Clostridium perfringens enterotoxin receptor-like 2,claudin 9 Designations: Gene Pathway Cell adhesion molecules (CAMs) Leukocyte transendothelial migration Tight junction 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/20.

Copy Link

Recommended publications

Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
[Show full text]
The Role of GRHL2 and Epigenetic Remodeling in Epithelialâ€“Mesenchymal Plasticity in Ovarian Cancer Cells
ARTICLE https://doi.org/10.1038/s42003-019-0506-3 OPEN The role of GRHL2 and epigenetic remodeling in epithelial–mesenchymal plasticity in ovarian cancer cells Vin Yee Chung 1, Tuan Zea Tan 1, Jieru Ye1, Rui-Lan Huang2, Hung-Cheng Lai2, Dennis Kappei 1,3, 1234567890():,; Heike Wollmann4, Ernesto Guccione4 & Ruby Yun-Ju Huang1,5 Cancer cells exhibit phenotypic plasticity during epithelial–mesenchymal transition (EMT) and mesenchymal–epithelial transition (MET) involving intermediate states. To study genome-wide epigenetic remodeling associated with EMT plasticity, we integrate the ana- lyses of DNA methylation, ChIP-sequencing of five histone marks (H3K4me1, H3K4me3, H3K27Ac, H3K27me3 and H3K9me3) and transcriptome profiling performed on ovarian cancer cells with different epithelial/mesenchymal states and on a knockdown model of EMT suppressor Grainyhead-like 2 (GRHL2). We have identified differentially methylated CpG sites associated with EMT, found at promoters of epithelial genes and GRHL2 binding sites. GRHL2 knockdown results in CpG methylation gain and nucleosomal remodeling (reduction in permissive marks H3K4me3 and H3K27ac; elevated repressive mark H3K27me3), resembling the changes observed across progressive EMT states. Epigenetic-modifying agents such as 5-azacitidine, GSK126 and mocetinostat further reveal cell state-dependent plasticity upon GRHL2 overexpression. Overall, we demonstrate that epithelial genes are subject to epigenetic control during intermediate phases of EMT/MET involving GRHL2. 1 Cancer Science Institute of Singapore, National University of Singapore, Singapore 117599, Singapore. 2 Department of Obstetrics and Gynecology, Shuang Ho Hospital, Taipei Medical University, 11031 Taipei, Taiwan. 3 Department of Biochemistry, Yong Loo Lin School of Medicine, National University of Singapore, Singapore 117596, Singapore.
[Show full text]
Chromosome Instability Drives Phenotypic Switching to Metastasis
Chromosome instability drives phenotypic switching to metastasis ChongFeng Gaoa,1, Yanli Sua, Julie Koemanb, Elizabeth Haaka, Karl Dykemab, Curt Essenberga, Eric Hudsonb, David Petilloc, Sok Kean Khood, and George F. Vande Woudea,1 aLaboratory of Molecular Oncology, Van Andel Research Institute, Grand Rapids, MI 49503; bCore Technologies and Services, Van Andel Research Institute, Grand Rapids, MI 49503; cLaboratory of Interdisciplinary Renal Oncology, Van Andel Research Institute, Grand Rapids, MI 49503; and dDepartment of Cell and Molecular Biology, Grand Valley State University, Grand Rapids, MI 49503 Contributed by George F. Vande Woude, November 3, 2016 (sent for review October 5, 2016; reviewed by Webster K. Cavenee and Peter K. Vogt) Chromosome instability (CIN) is the most striking feature of human successively isolating mesenchymal variants from clonal epithelial cancers. However, how CIN drives tumor progression to metastasis populations, and then isolating epithelial revertants of the mesen- remains elusive. Here we studied the role of chromosome content chymal variants. We have shown that generation of mesenchymal changes in generating the phenotypic dynamics that are required variants associated with loss of chromosome contents harbors genes for metastasis. We isolated epithelial and mesenchymal clones from encoding IJ protein, whereas generation of epithelial variants was human carcinoma cell lines and showed that the epithelial clones frequently caused by Zeb1 (zinc-finger E-box–binding homeobox 1) were able to generate mesenchymal variants, which had the haploinsufficiency through 10p loss. potential to further produce epithelial revertants autonomously. The successive acquisition of invasive mesenchymal and then Result and Discussion epithelial phenotypes recapitulated the steps in tumor progression OVCAR5 (OV5-P) cells growing in a Petri dish exhibited a het- to metastasis.
[Show full text]
Heterozygous Deletion of Chromosome 17P Renders Prostate Cancer Vulnerable to Inhibition of RNA Polymerase II
ARTICLE DOI: 10.1038/s41467-018-06811-z OPEN Heterozygous deletion of chromosome 17p renders prostate cancer vulnerable to inhibition of RNA polymerase II Yujing Li1,2,3, Yunhua Liu 2,3,4, Hanchen Xu1,2,3, Guanglong Jiang3, Kevin Van der Jeught 2,3, Yuanzhang Fang2,3, Zhuolong Zhou3, Lu Zhang2,3, Michael Frieden3, Lifei Wang3, Zhenhua Luo5, Milan Radovich4,6, Bryan P. Schneider7, Yibin Deng8, Yunlong Liu3, Kun Huang7, Bin He9, Jin Wang 10, Xiaoming He 11,12, Xinna Zhang3,4, Guang Ji 1 & Xiongbin Lu2,3,4 1234567890():,; Heterozygous deletion of chromosome 17p (17p) is one of the most frequent genomic events in human cancers. Beyond the tumor suppressor TP53, the POLR2A gene encoding the cat- alytic subunit of RNA polymerase II (RNAP2) is also included in a ~20-megabase deletion region of 17p in 63% of metastatic castration-resistant prostate cancer (CRPC). Using a focused CRISPR-Cas9 screen, we discovered that heterozygous loss of 17p confers a selective dependence of CRPC cells on the ubiquitin E3 ligase Ring-Box 1 (RBX1). RBX1 activates POLR2A by the K63-linked ubiquitination and thus elevates the RNAP2-mediated mRNA synthesis. Combined inhibition of RNAP2 and RBX1 profoundly suppress the growth of CRPC in a synergistic manner, which potentiates the therapeutic effectivity of the RNAP2 inhibitor, α-amanitin-based antibody drug conjugate (ADC). Given the limited therapeutic options for CRPC, our ﬁndings identify RBX1 as a potentially therapeutic target for treating human CRPC harboring heterozygous deletion of 17p. 1 Institute of Digestive Diseases, Longhua Hospital, Shanghai University of Traditional Chinese Medicine, 200032 Shanghai, China.
[Show full text]
Met Synergizes with P53 Loss to Induce Mammary Tumors That Possess
Met synergizes with p53 loss to induce mammary PNAS PLUS tumors that possess features of claudin-low breast cancer Jennifer F. Knighta,1, Robert Lesurfa,b,1, Hong Zhaoa, Dushanthi Pinnaduwagec, Ryan R. Davisd, Sadiq M. I. Saleha,b, Dongmei Zuoa, Monica A. Naujokasa, Naila Chughtaia, Jason I. Herschkowitze, Aleix Pratf,g, Anna Marie Mulliganh,i, William J. Mullera,b, Robert D. Cardiffd, Jeff P. Greggd, Irene L. Andrulisc,h,i,j, Michael T. Halletta, and Morag Parka,b,k,2 aGoodman Cancer Research Centre, McGill University, Montreal, QC, Canada H3A 1A3; bDepartment of Biochemistry, McGill University, Montreal, QC, Canada H2W 1S6; cSamuel Lunenfeld Research Institute, Mount Sinai Hospital, Toronto, ON, Canada M5G 1X5; dCenter for Comparative Medicine, University of California, Davis, CA 95616; eDepartment of Molecular and Cellular Biology, Baylor College of Medicine, Houston, TX 77030; fLineberger Comprehensive Cancer Center, University of North Carolina, Chapel Hill, NC 27514; gVall d’Hebron Institute of Oncology, 08035 Barcelona, Spain; hDepartment of Laboratory Medicine, St. Michael’s Hospital, Toronto, ON, Canada M5B 1W8; iDepartment of Laboratory Medicine and Pathobiology, University of Toronto, Toronto, ON, Canada M5S 1A1; jDepartment of Molecular Genetics, University of Toronto, Toronto, ON, Canada M5S 1A8; and kDepartment of Oncology, McGill University, Montreal, QC, Canada H2W 1S6 Edited by Tak W. Mak, The Campbell Family Institute for Breast Cancer Research, Ontario Cancer Institute at Princess Margaret Hospital, University Health Network, Toronto, ON, Canada, and approved February 13, 2013 (received for review June 18, 2012) Triple-negative breast cancer (TNBC) accounts for ∼20% of cases Claudin-low tumors were originally distinguished from other and contributes to basal and claudin-low molecular subclasses of subtypes on the basis of gene expression proﬁling (3) and have the disease.
[Show full text]
A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression
Supplementary Materials A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression Table S1. Statistically significant DEGs (Adj. p-value < 0.01) derived from meta-analysis for samples irradiated with high doses of HZE particles, collected 6-24 h post-IR not common with any other meta- analysis group. This meta-analysis group consists of 3 DEG lists obtained from DGEA, using a total of 11 control and 11 irradiated samples [Data Series: E-MTAB-5761 and E-MTAB-5754]. Ensembl ID Gene Symbol Gene Description Up-Regulated Genes ↑ (2425) ENSG00000000938 FGR FGR proto-oncogene, Src family tyrosine kinase ENSG00000001036 FUCA2 alpha-L-fucosidase 2 ENSG00000001084 GCLC glutamate-cysteine ligase catalytic subunit ENSG00000001631 KRIT1 KRIT1 ankyrin repeat containing ENSG00000002079 MYH16 myosin heavy chain 16 pseudogene ENSG00000002587 HS3ST1 heparan sulfate-glucosamine 3-sulfotransferase 1 ENSG00000003056 M6PR mannose-6-phosphate receptor, cation dependent ENSG00000004059 ARF5 ADP ribosylation factor 5 ENSG00000004777 ARHGAP33 Rho GTPase activating protein 33 ENSG00000004799 PDK4 pyruvate dehydrogenase kinase 4 ENSG00000004848 ARX aristaless related homeobox ENSG00000005022 SLC25A5 solute carrier family 25 member 5 ENSG00000005108 THSD7A thrombospondin type 1 domain containing 7A ENSG00000005194 CIAPIN1 cytokine induced apoptosis inhibitor 1 ENSG00000005381 MPO myeloperoxidase ENSG00000005486 RHBDD2 rhomboid domain containing 2 ENSG00000005884 ITGA3 integrin subunit alpha 3 ENSG00000006016 CRLF1 cytokine receptor like
[Show full text]
Table S1. 103 Ferroptosis-Related Genes Retrieved from the Genecards
Table S1. 103 ferroptosis-related genes retrieved from the GeneCards. Gene Symbol Description Category GPX4 Glutathione Peroxidase 4 Protein Coding AIFM2 Apoptosis Inducing Factor Mitochondria Associated 2 Protein Coding TP53 Tumor Protein P53 Protein Coding ACSL4 Acyl-CoA Synthetase Long Chain Family Member 4 Protein Coding SLC7A11 Solute Carrier Family 7 Member 11 Protein Coding VDAC2 Voltage Dependent Anion Channel 2 Protein Coding VDAC3 Voltage Dependent Anion Channel 3 Protein Coding ATG5 Autophagy Related 5 Protein Coding ATG7 Autophagy Related 7 Protein Coding NCOA4 Nuclear Receptor Coactivator 4 Protein Coding HMOX1 Heme Oxygenase 1 Protein Coding SLC3A2 Solute Carrier Family 3 Member 2 Protein Coding ALOX15 Arachidonate 15-Lipoxygenase Protein Coding BECN1 Beclin 1 Protein Coding PRKAA1 Protein Kinase AMP-Activated Catalytic Subunit Alpha 1 Protein Coding SAT1 Spermidine/Spermine N1-Acetyltransferase 1 Protein Coding NF2 Neurofibromin 2 Protein Coding YAP1 Yes1 Associated Transcriptional Regulator Protein Coding FTH1 Ferritin Heavy Chain 1 Protein Coding TF Transferrin Protein Coding TFRC Transferrin Receptor Protein Coding FTL Ferritin Light Chain Protein Coding CYBB Cytochrome B-245 Beta Chain Protein Coding GSS Glutathione Synthetase Protein Coding CP Ceruloplasmin Protein Coding PRNP Prion Protein Protein Coding SLC11A2 Solute Carrier Family 11 Member 2 Protein Coding SLC40A1 Solute Carrier Family 40 Member 1 Protein Coding STEAP3 STEAP3 Metalloreductase Protein Coding ACSL1 Acyl-CoA Synthetase Long Chain Family Member 1 Protein
[Show full text]
Novel and Highly Recurrent Chromosomal Alterations in Se´Zary Syndrome
Research Article Novel and Highly Recurrent Chromosomal Alterations in Se´zary Syndrome Maarten H. Vermeer,1 Remco van Doorn,1 Remco Dijkman,1 Xin Mao,3 Sean Whittaker,3 Pieter C. van Voorst Vader,4 Marie-Jeanne P. Gerritsen,5 Marie-Louise Geerts,6 Sylke Gellrich,7 Ola So¨derberg,8 Karl-Johan Leuchowius,8 Ulf Landegren,8 Jacoba J. Out-Luiting,1 Jeroen Knijnenburg,2 Marije IJszenga,2 Karoly Szuhai,2 Rein Willemze,1 and Cornelis P. Tensen1 Departments of 1Dermatology and 2Molecular Cell Biology, Leiden University Medical Center, Leiden, the Netherlands; 3Department of Dermatology, St Thomas’ Hospital, King’s College, London, United Kingdom; 4Department of Dermatology, University Medical Center Groningen, Groningen, the Netherlands; 5Department of Dermatology, Radboud University Nijmegen Medical Center, Nijmegen, the Netherlands; 6Department of Dermatology, Gent University Hospital, Gent, Belgium; 7Department of Dermatology, Charite, Berlin, Germany; and 8Department of Genetics and Pathology, Rudbeck Laboratory, University of Uppsala, Uppsala, Sweden Abstract Introduction This study was designed to identify highly recurrent genetic Se´zary syndrome (Sz) is an aggressive type of cutaneous T-cell alterations typical of Se´zary syndrome (Sz), an aggressive lymphoma/leukemia of skin-homing, CD4+ memory T cells and is cutaneous T-cell lymphoma/leukemia, possibly revealing characterized by erythroderma, generalized lymphadenopathy, and pathogenetic mechanisms and novel therapeutic targets. the presence of neoplastic T cells (Se´zary cells) in the skin, lymph High-resolution array-based comparative genomic hybridiza- nodes, and peripheral blood (1). Sz has a poor prognosis, with a tion was done on malignant T cells from 20 patients. disease-specific 5-year survival of f24% (1).
[Show full text]
Convergent and Divergent Cellular Responses by Erbb4 Isoforms in Mammary Epithelial Cells
Published OnlineFirst May 14, 2014; DOI: 10.1158/1541-7786.MCR-13-0637 Molecular Cancer Genomics Research Convergent and Divergent Cellular Responses by ErbB4 Isoforms in Mammary Epithelial Cells Vikram B. Wali, Jonathan W. Haskins, Maureen Gilmore-Hebert, James T. Platt, Zongzhi Liu, and David F. Stern Abstract Associations of ErbB4 (ERBB4/HER4), the fourth member of the EGFR family, with cancer are variable, possibly as a result of structural diversity of this receptor. There are multiple structural isoforms of ERBB4 arising by alternative mRNA splicing, and a subset undergo proteolysis that releases membrane-anchored and soluble isoforms that associate with transcription factors and coregulators to modulate transcription. To compare the differential and common signaling activities of full-length (FL) and soluble intracellular isoforms of ERBB4, four JM-a isoforms (FL and soluble intracellular domain (ICD) CYT-1 and CYT-2) were expressed in isogenic MCF10A cells and their biologic activities were analyzed. Both FL and ICD CYT-2 promoted cell proliferation and invasion, and CYT-1 suppressed cell growth. Transcriptional profiling revealed several new and underexplored ERBB4-regulated transcripts, including: proteases/protease inhibitors (MMP3 and SERPINE2), the YAP/Hippo pathway (CTGF, CYR61, and SPARC), the mevalonate/cholesterol pathway (HMGCR, HMGCS1, LDLR, and DHCR7), and cytokines (IL8, CCL20, and CXCL1). Many of these transcripts were subsequently validated in a luminal breast cancer cell line that normally expresses ERBB4. Furthermore, ChIP-seq experiments identified ADAP1, APOE, SPARC, STMN1, and MXD1 as novel molecular targets of ERBB4. These findings clarify the diverse biologic activities of ERBB4 isoforms, and reveal new and divergent functions.
[Show full text]
Gene Expression Profiling Separates Chromophobe Renal Cell Carcinoma from Oncocytoma and Identifies Vesicular Transport and Cell
Human Cancer Biology Gene Expression Profiling Separates Chromophobe Renal Cell Carcinoma from Oncocytoma and Identifies Vesicular Transport andCellJunctionProteinsasDifferentiallyExpressedGenes Stephen Rohan,1Jiangling J. Tu,1Jean Kao,1Piali Mukherjee,2 Fabien Campagne,2 Xi K. Zhou,3 Elizabeth Hyjek,1Miguel A. Alonso,4 and Yao-Tseng Chen1 Abstract Purpose:To compare gene expression profiles of chromophobe renal cell carcinoma (RCC) and benign oncocytoma, aiming at identifying differentially expressed genes. Experimental Design: Nine cases each of chromophobe RCC and oncocytoma were analyzed by oligonucleotide microarray. Candidate genes that showed consistent differential expression were validated by reverse transcription-PCR using 25 fresh-frozen and 15 formalin-fixed, paraffin-embedded tumor samples. Immunohistochemical analysis was also done for two selected gene products, claudin 8 and MAL2. Results: Unsupervised hierarchical clustering separated the chromophobe RCC and oncocy- toma into two distinct groups. By a combination of data analysis approaches, we identified 11 candidate genes showing consistent differential expression between chromophobe RCC and oncocytoma. Five of these genes, AP1M2, MAL2, PROM2, PRSS8,andFLJ20171,wereshown to effectively separate these two tumor groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues. Immunohistochemical analysis revealed selective expression of MAL2 and claudin 8 in distal renal tubules, with MAL2 antibody showing differential expression between chromophobe RCC and oncocytoma. Functional analyses suggest that genes encoding tight junction proteins and vesicular membrane trafficking proteins, normally expressed in distal nephrons, are retained in chromophobe RCC and lost or consistently down-regulated in oncocytoma, indicating that these two tumor types, believed to be both derived from distal tubules, are likely distinctive in their histogenesis.
[Show full text]
Identification and Mechanistic Investigation of Recurrent Functional Genomic and Transcriptional Alterations in Advanced Prostat
Identification and Mechanistic Investigation of Recurrent Functional Genomic and Transcriptional Alterations in Advanced Prostate Cancer Thomas A. White A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2013 Reading Committee: Peter S. Nelson, Chair Janet L. Stanford Raymond J. Monnat Jay A. Shendure Program Authorized to Offer Degree: Molecular and Cellular Biology ©Copyright 2013 Thomas A. White University of Washington Abstract Identification and Mechanistic Investigation of Recurrent Functional Genomic and Transcriptional Alterations in Advanced Prostate Cancer Thomas A. White Chair of the Supervisory Committee: Peter S. Nelson, MD Novel functionally altered transcripts may be recurrent in prostate cancer (PCa) and may underlie lethal and advanced disease and the neuroendocrine small cell carcinoma (SCC) phenotype. We conducted an RNASeq survey of the LuCaP series of 24 PCa xenograft tumors from 19 men, and validated observations on metastatic tumors and PCa cell lines. Key findings include discovery and validation of 40 novel fusion transcripts including one recurrent chimera, many SCC-specific and castration resistance (CR) -specific novel splice isoforms, new observations on SCC-specific and TMPRSS2-ERG specific differential expression, the allele-specific expression of certain recurrent non- synonymous somatic single nucleotide variants (nsSNVs) previously discovered via exome sequencing of the same tumors, rgw ubiquitous A-to-I RNA editing of base excision repair (BER) gene NEIL1 as well as CDK13, a kinase involved in RNA splicing, and the SCC expression of a previously unannotated long noncoding RNA (lncRNA) at Chr6p22.2. Mechanistic investigation of the novel lncRNA indicates expression is regulated by derepression by master neuroendocrine regulator RE1-silencing transcription factor (REST), and may regulate some genes of axonogenesis and angiogenesis.
[Show full text]
Claudin11 Promoter Hypermethylation Is Frequent in Malignant Melanoma of the Skin, but Uncommon in Nevus Cell Nevi
Cancers 2015, 7, 1233-1243; doi:10.3390/cancers7030834 cancersOPEN ACCESS ISSN 2072-6694 www.mdpi.com/journal/cancers Article Claudin11 Promoter Hypermethylation Is Frequent in Malignant Melanoma of the Skin, but Uncommon in Nevus Cell Nevi Sara K. Walesch 1, Antje M. Richter 1, Peter Helmbold 2 and Reinhard H. Dammann 1;* 1 Institute for Genetics, Justus-Liebig-University Giessen, Giessen D-35392, Germany; E-Mails: [email protected] (S.K.W.); [email protected] (A.M.R.) 2 Department of Dermatology, University of Heidelberg, Heidelberg D-69120, Germany; E-Mail: [email protected] * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +49-641-99-35462; Fax: +49-641-993-5469. Academic Editor: Chyi-Chia Richard Lee Received: 6 May 2015 / Accepted: 1 July 2015 / Published: 7 July 2015 Abstract: Epigenetic inactivation of tumor-related genes is an important characteristic in the pathology of human cancers, including melanomagenesis. We analyzed the epigenetic inactivation of Claudin 11 (CLDN11) in malignant melanoma (MM) of the skin, including six melanoma cell lines, 39 primary melanoma, 41 metastases of MM and 52 nevus cell nevi (NCN). CLDN11 promoter hypermethylation was found in 19 out of 39 (49%) of the primary MM and in 21 out of 41 (51%) of the MM metastases, but only in eight out of 52 (15%) of NCN (p = 0.001 and p = 0.0003, respectively). Moreover, a signiﬁcant increase in the methylation level of CLDN11 from primary melanomas to MM metastases was revealed (p = 0.003).
[Show full text]