Parathyroid Hormone - Drugbank

Total Page:16

File Type:pdf, Size:1020Kb

Load more

6/20/2018 Parathyroid hormone - DrugBank Parathyroid hormone Targets (2) Biointeractions (2) IDENTIFICATION Name Parathyroid hormone Accession Number DB05829 Type Biotech Groups Approved, Investigational Biologic Classification Protein Based Therapies Hormones Description Parathyroid hormone (PTH) is a single-chain polypeptide composed of 84 amino acids. As Preotact, it contains recombinant human parathyroid hormone which is identical to the full- length native 84-amino acid polypeptide. It is produced as a fusion protein. Post-translational processing involves the cleavage of the OmpA leader sequence, leaving the mature protein as a single-chain 84 amino-acids polypeptide (9.4 kDa) whose sequence is identical to that of the full- length native endogenous human PTH. It has no disulfide bonds and no glycosylation sites. Preotact is used in the treatment of osteoporosis in postmenopausal women at high risk of osteoporotic fractures. Preotact is marketed in Europe by Nycomed. Preos is a registered trade mark owned by NPS Pharmaceuticals, Inc. The name Preos and the New Drug Application is pending approval by the U.S. Food and Drug Administration (FDA). Protein structure https://www.drugbank.ca/drugs/DB05829 1/11 6/20/2018 Parathyroid hormone - DrugBank Protein chemical formula C408H674N126O126S2 Protein average weight 9420.0 Da Sequences >Parathyroid hormone SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLV ESHEKSLGEADKADVNVLTKAKSQ Download FASTA Format Synonyms hPTH hPTH(1-84) Parathormone Parathormone (human recombinant) Parathyrin Parathyroid hormone parathyroid hormone (1-84) human recombinant parathyroid hormone (rDNA) Preotact PTH PTH(1-84) rhPTH rhPTH(1-84) rPTH rPTH(1-84) External IDs ALX-111 / ALX1-11 / NPSP-558 / NPSP558 Prescription Products Search MARKETING MARKETING NAME ↑↓ DOSAGE ↑↓ STRENGTH ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ NATPARA Injection 25 ug/ 08mL Subcutaneous Shire Nps 2015-01-23 Not applicable https://www.drugbank.ca/drugs/DB05829 2/11 6/20/2018 Parathyroid hormone - DrugBank NATPARA Injection, 25 ug/.08mL Subcutaneous Shire Nps 2015 01 23 Not applicable (parathyroid powder, Pharmaceuticals, hormone) lyophilized, Inc. for solution NATPARA Injection, 75 ug/.08mL Subcutaneous Shire Nps 2015-01-23 Not applicable (parathyroid powder, Pharmaceuticals, hormone) lyophilized, Inc. for solution NATPARA Injection, 50 ug/.08mL Subcutaneous Shire Nps 2015-01-23 Not applicable (parathyroid powder, Pharmaceuticals, hormone) lyophilized, Inc. for solution NATPARA Injection, 100 ug/.08mL Subcutaneous Shire Nps 2015-01-23 Not applicable (parathyroid powder, Pharmaceuticals, hormone) lyophilized, Inc. for solution Showing 1 to 4 of 4 entries ‹ › Unapproved/Other Products Search MARKETING MARKETING NAME ↑↓ INGREDIENTS DOSAGE ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ Preotact Parathyroid Injection, Subcutaneous Nps Pharma 2006-04-24 2014-07-11 hormone (100 powder, for Holdings µg) solution Limited Showing 1 to 1 of 1 entries ‹ › International/Other Brands Preos (NPS Pharmaceuticals, Inc.) Categories Amino Acids, Peptides, and Proteins Calcium Homeostasis Hormones Hormones, Hormone Substitutes, and Hormone Antagonists Parathyroid Hormone Parathyroid Hormones and Analogues Peptide Hormones Peptides Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins https://www.drugbank.ca/drugs/DB05829 3/11 6/20/2018 Parathyroid hormone - DrugBank UNII N19A0T0E5J CAS number 9002-64-6 PHARMACOLOGY Indication For use/treatment in osteoporosis. Associated Conditions Hypocalcemia Parathyroid deficiency Pharmacodynamics Parathyroid hormone is responsible for the fine regulation of serum calcium concentration on a minute-to-minute basis. This is achieved by the acute effects of the hormone on calcium resorption in bone and calcium reabsorption in the kidney. The phosphate mobilized from bone is excreted into the urine by means of the hormone's influence on renal phosphate handling. Parathyroid hormone also stimulates calcium absorption in the intestine, this being mediated indirectly by 1,25-dihydroxyvitamin D. Thus, a hypocalcemic stimulus of parathyroid hormone secretion results in an increased influx of calcium from three sources (bone, kidney, and intestine), resulting in a normalization of the serum calcium concentration without change in the serum phosphate concentration. Mechanism of action The biological actions of rhPTH are mediated through binding to at least two distinct high- affinity cell-surface receptors specific for the N-terminal and C-terminal regions of the molecule, both of which are required for normal bone metabolism. The N-terminal portion of the molecule is primarily responsible for the bone building effects of parathyroid hormone. The C-terminal portion of the molecule has antiresorptive activity and is necessary for normal regulation of N- terminal fragment activity. U Parathyroid hormone/parathyroid hormone-related peptide receptor activator Human A Parathyroid hormone 2 receptor activator Human Absorption The absolute bioavailability of 100 micrograms of Preotact aer subcutaneous administration in the abdomen is 55%. https://www.drugbank.ca/drugs/DB05829 4/11 6/20/2018 Parathyroid hormone - DrugBank Volume of distribution The volume of distribution at steady-state following intravenous administration is approximately 5.4 liters. Intersubject variability is about 40%. Protein binding Not Available Metabolism PTH is metabolised in the liver and to a lesser extent in the kidney. Parathyroid hormone is efficiently removed from the blood by a receptor-mediated process in the liver and is broken down into smaller peptide fragments. The fragments derived from the amino- terminus are further degraded within the cell while the fragments derived from the carboxy- terminus are released back into the blood and cleared by the kidney. These carboxy-terminal fragments are thought to play a role in the regulation of PTH activity. Under normal physiological conditions full-length PTH constitutes only 5-30% of the circulating forms of the molecule, while 70-95% is present as carboxy-terminal fragments. Following administration of Preotact, carboxy- terminal fragments make up about 60-90% of the circulating forms of the molecule. Intersubject variability in systemic clearance is about 15%. Route of elimination Not excreted from the body in its intact form. Circulating carboxy-terminal fragments are filtered by the kidney, but are subsequently broken down into even smaller fragments during tubular reuptake. Half life The mean half-life is approximately 1.5 hours. Clearance PTH is rapidly cleared from plasma, primarily by Kupffer cells in the liver. To a lesser extent, PTH is cleared by filtration and reabsorption by the kidney. Toxicity Not Available Affected organisms Humans and other mammals Pathways Not Available Pharmacogenomic Effects/ADRs Not Available https://www.drugbank.ca/drugs/DB05829 5/11 6/20/2018 Parathyroid hormone - DrugBank INTERACTIONS Drug Interactions Search DRUG ↑↓ INTERACTION ↑↓ DRUG GROUP ↑↓ Acetyldigitoxin The risk or severity of adverse effects can be increased when Parathyroid Approved hormone is combined with Acetyldigitoxin. Acetyldigoxin The risk or severity of adverse effects can be increased when Parathyroid Experimental hormone is combined with Acetyldigoxin. Alendronic acid The therapeutic efficacy of Parathyroid hormone can be decreased when Approved used in combination with Alendronic acid. Cymarin The risk or severity of adverse effects can be increased when Parathyroid Experimental hormone is combined with Cymarin. Deslanoside The risk or severity of adverse effects can be increased when Parathyroid Approved hormone is combined with Deslanoside. Digitoxin The risk or severity of adverse effects can be increased when Parathyroid Approved, hormone is combined with Digitoxin. Investigational Digoxin The risk or severity of adverse effects can be increased when Parathyroid Approved hormone is combined with Digoxin. Digoxin Immune The risk or severity of adverse effects can be increased when Parathyroid Approved Fab (Ovine) hormone is combined with Digoxin Immune Fab (Ovine). Gitoformate The risk or severity of adverse effects can be increased when Parathyroid Experimental hormone is combined with Gitoformate. Lanatoside C The risk or severity of adverse effects can be increased when Parathyroid Experimental hormone is combined with Lanatoside C. Showing 1 to 10 of 15 entries ‹ › Food Interactions Not Available REFERENCES Synthesis Reference Robert L. Colescott, Geoffrey W. Tregear, "Synthesis of peptides with parathyroid hormone activity." U.S. Patent US4105602, issued May, 1977. US4105602 General References 1. Sosa Henriquez M, Diez Perez A: [Parathyroid hormone in the treatment of osteoporosis]. An Med Interna. 2007 Feb;24(2):87-97. [PubMed:17590097] External Links https://www.drugbank.ca/drugs/DB05829 6/11 6/20/2018 Parathyroid hormone - DrugBank UniProt P01270 KEGG Compound C16051 PubChem Substance 347910255 Wikipedia Preotact ATC Codes H05AA03 — Parathyroid hormone H05AA — Parathyroid hormones and analogues H05A — PARATHYROID HORMONES AND ANALOGUES H05 — CALCIUM HOMEOSTASIS H — SYSTEMIC HORMONAL PREPARATIONS, EXCL. SEX HORMONES AND INSULINS CLINICAL TRIALS Clinical Trials Search PHASE ↑↓ STATUS ↑↓ PURPOSE ↑↓ CONDITIONS ↑↓ COUNT ↑↓ 0 Completed Not Available Bone destruction / Bone Diseases, Endocrine / 1 Hyperparathyroidism 1 Completed Treatment Postmenopausal Osteoporosis (PMO) 1 1 Completed Treatment Bone destruction 1 1 Completed Treatment Parathyroid deficiency 1 1 Recruiting Treatment
Recommended publications
  • Digitoxin-Induced Cytotoxicity in Cancer Cells Is Mediated Through Distinct Kinase and Interferon Signaling Networks

    Digitoxin-Induced Cytotoxicity in Cancer Cells Is Mediated Through Distinct Kinase and Interferon Signaling Networks

    Published OnlineFirst August 22, 2011; DOI: 10.1158/1535-7163.MCT-11-0421 Molecular Cancer Therapeutic Discovery Therapeutics Digitoxin-Induced Cytotoxicity in Cancer Cells Is Mediated through Distinct Kinase and Interferon Signaling Networks Ioannis Prassas1,2, George S. Karagiannis1,2, Ihor Batruch4, Apostolos Dimitromanolakis1,2, Alessandro Datti2,3,5, and Eleftherios P. Diamandis1,2,4 Abstract Cardiac glycosides (e.g., digoxin, digitoxin) constitute a diverse family of plant-derived sodium pump inhibitors that have been in clinical use for the treatment of heart-related diseases (congestive heart failure, atrial arrhythmia) for many years. Recently though, accumulating in vitro and in vivo evidence highlight potential anticancer properties of these compounds. Despite the fact that members of this family have advanced to clinical trial testing in cancer therapeutics, their cytotoxic mechanism is not yet elucidated. In this study, we investigated the cytotoxic properties of cardiac glycosides against a panel of pancreatic cancer cell lines, explored their apoptotic mechanism, and characterized the kinetics of cell death induced by these drugs. Furthermore, we deployed a high-throughput kinome screening approach and identified several kinases of the Na-K-ATPase-mediated signal transduction circuitry (epidermal growth factor receptor, Src, pkC, and mitogen-activated protein kinases) as important mediators downstream of cardiac glycoside cytotoxic action. To further extend our knowledge on their mode of action, we used mass-spectrometry–based quantitative proteomics (stable isotope labeling of amino acids in cell culture) coupled with bioinformatics to capture large-scale protein perturbations induced by a physiological dose of digitoxin in BxPC-3 pancreatic cancer cells and identified members of the interferon family as key regulators of the main protein/protein interactions downstream of digitoxin action.
  • (12) Patent Application Publication (10) Pub. No.: US 2006/0110428A1 De Juan Et Al

    (12) Patent Application Publication (10) Pub. No.: US 2006/0110428A1 De Juan Et Al

    US 200601 10428A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2006/0110428A1 de Juan et al. (43) Pub. Date: May 25, 2006 (54) METHODS AND DEVICES FOR THE Publication Classification TREATMENT OF OCULAR CONDITIONS (51) Int. Cl. (76) Inventors: Eugene de Juan, LaCanada, CA (US); A6F 2/00 (2006.01) Signe E. Varner, Los Angeles, CA (52) U.S. Cl. .............................................................. 424/427 (US); Laurie R. Lawin, New Brighton, MN (US) (57) ABSTRACT Correspondence Address: Featured is a method for instilling one or more bioactive SCOTT PRIBNOW agents into ocular tissue within an eye of a patient for the Kagan Binder, PLLC treatment of an ocular condition, the method comprising Suite 200 concurrently using at least two of the following bioactive 221 Main Street North agent delivery methods (A)-(C): Stillwater, MN 55082 (US) (A) implanting a Sustained release delivery device com (21) Appl. No.: 11/175,850 prising one or more bioactive agents in a posterior region of the eye so that it delivers the one or more (22) Filed: Jul. 5, 2005 bioactive agents into the vitreous humor of the eye; (B) instilling (e.g., injecting or implanting) one or more Related U.S. Application Data bioactive agents Subretinally; and (60) Provisional application No. 60/585,236, filed on Jul. (C) instilling (e.g., injecting or delivering by ocular ion 2, 2004. Provisional application No. 60/669,701, filed tophoresis) one or more bioactive agents into the Vit on Apr. 8, 2005. reous humor of the eye. Patent Application Publication May 25, 2006 Sheet 1 of 22 US 2006/0110428A1 R 2 2 C.6 Fig.
  • )&F1y3x PHARMACEUTICAL APPENDIX to THE

    )&F1y3x PHARMACEUTICAL APPENDIX to THE

    )&f1y3X PHARMACEUTICAL APPENDIX TO THE HARMONIZED TARIFF SCHEDULE )&f1y3X PHARMACEUTICAL APPENDIX TO THE TARIFF SCHEDULE 3 Table 1. This table enumerates products described by International Non-proprietary Names (INN) which shall be entered free of duty under general note 13 to the tariff schedule. The Chemical Abstracts Service (CAS) registry numbers also set forth in this table are included to assist in the identification of the products concerned. For purposes of the tariff schedule, any references to a product enumerated in this table includes such product by whatever name known. Product CAS No. Product CAS No. ABAMECTIN 65195-55-3 ACTODIGIN 36983-69-4 ABANOQUIL 90402-40-7 ADAFENOXATE 82168-26-1 ABCIXIMAB 143653-53-6 ADAMEXINE 54785-02-3 ABECARNIL 111841-85-1 ADAPALENE 106685-40-9 ABITESARTAN 137882-98-5 ADAPROLOL 101479-70-3 ABLUKAST 96566-25-5 ADATANSERIN 127266-56-2 ABUNIDAZOLE 91017-58-2 ADEFOVIR 106941-25-7 ACADESINE 2627-69-2 ADELMIDROL 1675-66-7 ACAMPROSATE 77337-76-9 ADEMETIONINE 17176-17-9 ACAPRAZINE 55485-20-6 ADENOSINE PHOSPHATE 61-19-8 ACARBOSE 56180-94-0 ADIBENDAN 100510-33-6 ACEBROCHOL 514-50-1 ADICILLIN 525-94-0 ACEBURIC ACID 26976-72-7 ADIMOLOL 78459-19-5 ACEBUTOLOL 37517-30-9 ADINAZOLAM 37115-32-5 ACECAINIDE 32795-44-1 ADIPHENINE 64-95-9 ACECARBROMAL 77-66-7 ADIPIODONE 606-17-7 ACECLIDINE 827-61-2 ADITEREN 56066-19-4 ACECLOFENAC 89796-99-6 ADITOPRIM 56066-63-8 ACEDAPSONE 77-46-3 ADOSOPINE 88124-26-9 ACEDIASULFONE SODIUM 127-60-6 ADOZELESIN 110314-48-2 ACEDOBEN 556-08-1 ADRAFINIL 63547-13-7 ACEFLURANOL 80595-73-9 ADRENALONE
  • Combination of Pretreatments with Acetic Acid and Sodium Methoxide for Efficient Digoxin Preparation from Digitalis Glycosides in Digitalis Lanata Leaves

    Combination of Pretreatments with Acetic Acid and Sodium Methoxide for Efficient Digoxin Preparation from Digitalis Glycosides in Digitalis Lanata Leaves

    Pharmacology & Pharmacy, 2016, 7, 200-207 Published Online May 2016 in SciRes. http://www.scirp.org/journal/pp http://dx.doi.org/10.4236/pp.2016.75026 Combination of Pretreatments with Acetic Acid and Sodium Methoxide for Efficient Digoxin Preparation from Digitalis Glycosides in Digitalis lanata Leaves Yasuhiko Higashi*, Yukari Ikeda, Youichi Fujii Department of Analytical Chemistry, Faculty of Pharmaceutical Sciences, Hokuriku University, Kanazawa, Japan Received 21 April 2016; accepted 28 May 2016; published 31 May 2016 Copyright © 2016 by authors and Scientific Research Publishing Inc. This work is licensed under the Creative Commons Attribution International License (CC BY). http://creativecommons.org/licenses/by/4.0/ Abstract We previously developed an HPLC method for determination of lanatoside C, digoxin and α-acetyl- digoxin in digitalis glycosides isolated from Digitalis lanata leaves. Here, we present an improved HPLC-UV method to determine those compounds and deslanoside. We used the improved method to examine the effects of various pretreatments on the amounts of the four compounds isolated from the leaves, with the aim of maximizing the yield of digoxin. Leaves were extracted with 50% methanol, followed by clean-up on a Sep-Pak C18 cartridge prior to HPLC analysis. The amounts of lanatoside C, digoxin and α-acetyldigoxin per 100 mg of the leaves without pretreatment were 115.6, 7.45 and 23.8 μg, respectively (deslanoside was not detected). Pretreatment with acetic ac- id, which activated deglucosylation mediated by digilanidase present in the leaves, increased the amounts of digoxin and α-acetyldigoxin, while lanatoside C and deslanoside were not detected. Pretreatment with sodium methoxide, which hydrolyzed lanatoside C to deslanoside, increased the yields of deslanoside and digoxin, while lanatoside C and α-acetyldigoxin were not detected.
  • Partial Agreement in the Social and Public Health Field

    Partial Agreement in the Social and Public Health Field

    COUNCIL OF EUROPE COMMITTEE OF MINISTERS (PARTIAL AGREEMENT IN THE SOCIAL AND PUBLIC HEALTH FIELD) RESOLUTION AP (88) 2 ON THE CLASSIFICATION OF MEDICINES WHICH ARE OBTAINABLE ONLY ON MEDICAL PRESCRIPTION (Adopted by the Committee of Ministers on 22 September 1988 at the 419th meeting of the Ministers' Deputies, and superseding Resolution AP (82) 2) AND APPENDIX I Alphabetical list of medicines adopted by the Public Health Committee (Partial Agreement) updated to 1 July 1988 APPENDIX II Pharmaco-therapeutic classification of medicines appearing in the alphabetical list in Appendix I updated to 1 July 1988 RESOLUTION AP (88) 2 ON THE CLASSIFICATION OF MEDICINES WHICH ARE OBTAINABLE ONLY ON MEDICAL PRESCRIPTION (superseding Resolution AP (82) 2) (Adopted by the Committee of Ministers on 22 September 1988 at the 419th meeting of the Ministers' Deputies) The Representatives on the Committee of Ministers of Belgium, France, the Federal Republic of Germany, Italy, Luxembourg, the Netherlands and the United Kingdom of Great Britain and Northern Ireland, these states being parties to the Partial Agreement in the social and public health field, and the Representatives of Austria, Denmark, Ireland, Spain and Switzerland, states which have participated in the public health activities carried out within the above-mentioned Partial Agreement since 1 October 1974, 2 April 1968, 23 September 1969, 21 April 1988 and 5 May 1964, respectively, Considering that the aim of the Council of Europe is to achieve greater unity between its members and that this
  • Ehealth DSI [Ehdsi V2.2.2-OR] Ehealth DSI – Master Value Set

    Ehealth DSI [Ehdsi V2.2.2-OR] Ehealth DSI – Master Value Set

    MTC eHealth DSI [eHDSI v2.2.2-OR] eHealth DSI – Master Value Set Catalogue Responsible : eHDSI Solution Provider PublishDate : Wed Nov 08 16:16:10 CET 2017 © eHealth DSI eHDSI Solution Provider v2.2.2-OR Wed Nov 08 16:16:10 CET 2017 Page 1 of 490 MTC Table of Contents epSOSActiveIngredient 4 epSOSAdministrativeGender 148 epSOSAdverseEventType 149 epSOSAllergenNoDrugs 150 epSOSBloodGroup 155 epSOSBloodPressure 156 epSOSCodeNoMedication 157 epSOSCodeProb 158 epSOSConfidentiality 159 epSOSCountry 160 epSOSDisplayLabel 167 epSOSDocumentCode 170 epSOSDoseForm 171 epSOSHealthcareProfessionalRoles 184 epSOSIllnessesandDisorders 186 epSOSLanguage 448 epSOSMedicalDevices 458 epSOSNullFavor 461 epSOSPackage 462 © eHealth DSI eHDSI Solution Provider v2.2.2-OR Wed Nov 08 16:16:10 CET 2017 Page 2 of 490 MTC epSOSPersonalRelationship 464 epSOSPregnancyInformation 466 epSOSProcedures 467 epSOSReactionAllergy 470 epSOSResolutionOutcome 472 epSOSRoleClass 473 epSOSRouteofAdministration 474 epSOSSections 477 epSOSSeverity 478 epSOSSocialHistory 479 epSOSStatusCode 480 epSOSSubstitutionCode 481 epSOSTelecomAddress 482 epSOSTimingEvent 483 epSOSUnits 484 epSOSUnknownInformation 487 epSOSVaccine 488 © eHealth DSI eHDSI Solution Provider v2.2.2-OR Wed Nov 08 16:16:10 CET 2017 Page 3 of 490 MTC epSOSActiveIngredient epSOSActiveIngredient Value Set ID 1.3.6.1.4.1.12559.11.10.1.3.1.42.24 TRANSLATIONS Code System ID Code System Version Concept Code Description (FSN) 2.16.840.1.113883.6.73 2017-01 A ALIMENTARY TRACT AND METABOLISM 2.16.840.1.113883.6.73 2017-01
  • Relative Selectivity of Plant Cardenolides for Na+/K+-Atpases from the Monarch Butterfly and Non-Resistant Insects

    Relative Selectivity of Plant Cardenolides for Na+/K+-Atpases from the Monarch Butterfly and Non-Resistant Insects

    fpls-09-01424 September 26, 2018 Time: 15:23 # 1 ORIGINAL RESEARCH published: 28 September 2018 doi: 10.3389/fpls.2018.01424 Relative Selectivity of Plant Cardenolides for NaC/KC-ATPases From the Monarch Butterfly and Non-resistant Insects Georg Petschenka1*, Colleen S. Fei2, Juan J. Araya3, Susanne Schröder4, Barbara N. Timmermann5 and Anurag A. Agrawal2 1 Institute for Insect Biotechnology, Justus-Liebig-Universität, Giessen, Germany, 2 Department of Ecology and Evolutionary Biology, Cornell University, Ithaca, NY, United States, 3 Centro de Investigaciones en Productos Naturales, Escuela de Química, Instituto de Investigaciones Farmacéuticas, Facultad de Farmacia, Universidad de Costa Rica, San Pedro, Costa Rica, 4 Institut für Medizinische Biochemie und Molekularbiologie, Universität Rostock, Rostock, Germany, 5 Department of Medicinal Chemistry, School of Pharmacy, University of Kansas, Lawrence, KS, United States A major prediction of coevolutionary theory is that plants may target particular herbivores with secondary compounds that are selectively defensive. The highly specialized Edited by: monarch butterfly (Danaus plexippus) copes well with cardiac glycosides (inhibitors Daniel Giddings Vassão, C C Max-Planck-Institut für chemische of animal Na /K -ATPases) from its milkweed host plants, but selective inhibition Ökologie, Germany of its NaC/KC-ATPase by different compounds has not been previously tested. Reviewed by: We applied 17 cardiac glycosides to the D. plexippus-NaC/KC-ATPase and to the Stephen Baillie Malcolm, C C Western Michigan University, more susceptible Na /K -ATPases of two non-adapted insects (Euploea core and United States Schistocerca gregaria). Structural features (e.g., sugar residues) predicted in vitro Supaart Sirikantaramas, inhibitory activity and comparison of insect NaC/KC-ATPases revealed that the monarch Chulalongkorn University, Thailand has evolved a highly resistant enzyme overall.
  • Pharmaceutical Appendix to the Tariff Schedule 2

    Pharmaceutical Appendix to the Tariff Schedule 2

    Harmonized Tariff Schedule of the United States (2007) (Rev. 2) Annotated for Statistical Reporting Purposes PHARMACEUTICAL APPENDIX TO THE HARMONIZED TARIFF SCHEDULE Harmonized Tariff Schedule of the United States (2007) (Rev. 2) Annotated for Statistical Reporting Purposes PHARMACEUTICAL APPENDIX TO THE TARIFF SCHEDULE 2 Table 1. This table enumerates products described by International Non-proprietary Names (INN) which shall be entered free of duty under general note 13 to the tariff schedule. The Chemical Abstracts Service (CAS) registry numbers also set forth in this table are included to assist in the identification of the products concerned. For purposes of the tariff schedule, any references to a product enumerated in this table includes such product by whatever name known. ABACAVIR 136470-78-5 ACIDUM LIDADRONICUM 63132-38-7 ABAFUNGIN 129639-79-8 ACIDUM SALCAPROZICUM 183990-46-7 ABAMECTIN 65195-55-3 ACIDUM SALCLOBUZICUM 387825-03-8 ABANOQUIL 90402-40-7 ACIFRAN 72420-38-3 ABAPERIDONUM 183849-43-6 ACIPIMOX 51037-30-0 ABARELIX 183552-38-7 ACITAZANOLAST 114607-46-4 ABATACEPTUM 332348-12-6 ACITEMATE 101197-99-3 ABCIXIMAB 143653-53-6 ACITRETIN 55079-83-9 ABECARNIL 111841-85-1 ACIVICIN 42228-92-2 ABETIMUSUM 167362-48-3 ACLANTATE 39633-62-0 ABIRATERONE 154229-19-3 ACLARUBICIN 57576-44-0 ABITESARTAN 137882-98-5 ACLATONIUM NAPADISILATE 55077-30-0 ABLUKAST 96566-25-5 ACODAZOLE 79152-85-5 ABRINEURINUM 178535-93-8 ACOLBIFENUM 182167-02-8 ABUNIDAZOLE 91017-58-2 ACONIAZIDE 13410-86-1 ACADESINE 2627-69-2 ACOTIAMIDUM 185106-16-5 ACAMPROSATE 77337-76-9
  • Lanatoside C Induces G2/M Cell Cycle Arrest and Suppresses Cancer Cell Growth by Attenuating MAPK, Wnt, JAK-STAT, and PI3K/AKT/Mtor Signaling Pathways

    Lanatoside C Induces G2/M Cell Cycle Arrest and Suppresses Cancer Cell Growth by Attenuating MAPK, Wnt, JAK-STAT, and PI3K/AKT/Mtor Signaling Pathways

    biomolecules Article Lanatoside C Induces G2/M Cell Cycle Arrest and Suppresses Cancer Cell Growth by Attenuating MAPK, Wnt, JAK-STAT, and PI3K/AKT/mTOR Signaling Pathways Dhanasekhar Reddy 1 , Ranjith Kumavath 1,* , Preetam Ghosh 2 and Debmalya Barh 3 1 Department of Genomic Science, School of Biological Sciences, Central University of Kerala, Tejaswini Hills, Periya (P.O) Kasaragod 671316, Kerala, India; [email protected] 2 Department of Computer Science, Virginia Commonwealth University, Richmond, VA 23284, USA; [email protected] 3 Centre for Genomics and Applied Gene Technology, Institute of Integrative Omics and Applied Biotechnology (IIOAB), Nonakuri, Purba Medinipur 721172, West Bengal, India; [email protected] * Correspondence: [email protected] or [email protected]; Tel.: +91-8547-648-620 Received: 21 October 2019; Accepted: 22 November 2019; Published: 27 November 2019 Abstract: Cardiac glycosides (CGs) are a diverse family of naturally derived compounds having a steroid and glycone moiety in their structures. CG molecules inhibit the α-subunit of ubiquitous transmembrane protein Na+/K+-ATPase and are clinically approved for the treatment of cardiovascular diseases. Recently, the CGs were found to exhibit selective cytotoxic effects against cancer cells, raising interest in their use as anti-cancer molecules. In this current study, we explored the underlying mechanism responsible for the anti-cancer activity of Lanatoside C against breast (MCF-7), lung (A549), and liver (HepG2) cancer cell lines. Using
  • Marrakesh Agreement Establishing the World Trade Organization

    Marrakesh Agreement Establishing the World Trade Organization

    No. 31874 Multilateral Marrakesh Agreement establishing the World Trade Organ ization (with final act, annexes and protocol). Concluded at Marrakesh on 15 April 1994 Authentic texts: English, French and Spanish. Registered by the Director-General of the World Trade Organization, acting on behalf of the Parties, on 1 June 1995. Multilat ral Accord de Marrakech instituant l©Organisation mondiale du commerce (avec acte final, annexes et protocole). Conclu Marrakech le 15 avril 1994 Textes authentiques : anglais, français et espagnol. Enregistré par le Directeur général de l'Organisation mondiale du com merce, agissant au nom des Parties, le 1er juin 1995. Vol. 1867, 1-31874 4_________United Nations — Treaty Series • Nations Unies — Recueil des Traités 1995 Table of contents Table des matières Indice [Volume 1867] FINAL ACT EMBODYING THE RESULTS OF THE URUGUAY ROUND OF MULTILATERAL TRADE NEGOTIATIONS ACTE FINAL REPRENANT LES RESULTATS DES NEGOCIATIONS COMMERCIALES MULTILATERALES DU CYCLE D©URUGUAY ACTA FINAL EN QUE SE INCORPOR N LOS RESULTADOS DE LA RONDA URUGUAY DE NEGOCIACIONES COMERCIALES MULTILATERALES SIGNATURES - SIGNATURES - FIRMAS MINISTERIAL DECISIONS, DECLARATIONS AND UNDERSTANDING DECISIONS, DECLARATIONS ET MEMORANDUM D©ACCORD MINISTERIELS DECISIONES, DECLARACIONES Y ENTEND MIENTO MINISTERIALES MARRAKESH AGREEMENT ESTABLISHING THE WORLD TRADE ORGANIZATION ACCORD DE MARRAKECH INSTITUANT L©ORGANISATION MONDIALE DU COMMERCE ACUERDO DE MARRAKECH POR EL QUE SE ESTABLECE LA ORGANIZACI N MUND1AL DEL COMERCIO ANNEX 1 ANNEXE 1 ANEXO 1 ANNEX
  • Eiichi Kimura, MD, Department of Internal Medicine, Nippon Medical

    Eiichi Kimura, MD, Department of Internal Medicine, Nippon Medical

    Effect of Metildigoxin (ƒÀ-Methyldigoxin) on Congestive Heart Failure as Evaluated by Multiclinical Double Blind Study Eiichi Kimura,* M.D. and Akira SAKUMA,** Ph.D. In Collaboration with Mitsuo Miyahara, M.D. (Sapporo Medi- cal School, Sapporo), Tomohiro Kanazawa, M.D. (Akita Uni- versity School of Medicine, Akita), Masato Hayashi, M.D. (Hiraga General Hospital, Akita), Hirokazu Niitani, M.D. (Showa Uni- versity School of Medicine, Tokyo), Yoshitsugu Nohara, M.D. (Tokyo Medical College, Tokyo), Satoru Murao, M.D. (Faculty of Medicine, University of Tokyo, Tokyo), Kiyoshi Seki, M.D. (Toho University School of Medicine, Tokyo), Michita Kishimoto, M.D. (National Medical Center Hospital, Tokyo), Tsuneaki Sugi- moto, M.D. (Faculty of Medicine, Kanazawa University, Kana- zawa), Masao Takayasu, M.D. (National Kyoto Hospital, Kyoto), Hiroshi Saimyoji, M.D. (Faculty of Medicine, Kyoto University, Kyoto), Yasuharu Nimura, M.D. (Medical School, Osaka Uni- versity, Osaka), Tatsuya Tomomatsu, M.D. (Kobe University, School of Medicine, Kobe), and Junichi Mise, M.D. (Yamaguchi University, School of Medicine, Ube). SUMMARY The efficacy on congestive heart failure of metildigoxin (ƒÀ-methyl- digoxin, MD), a derivative of digoxin (DX), which had a good absorp- tion rate from digestive tract, was examined in a double blind study using a group comparison method. After achieving digitalization with oral MD or intravenous deslanoside in the non-blind manner, mainte- nance treatment was initiated and the effects of orally administered MD and DX were compared. MD was administered in 44 cases , DX in 42. The usefulness of the drug was evaluated after 2 weeks , taking into account the condition of the patient and the ease of administration .
  • Cardenolide Biosynthesis in Foxglove1

    Cardenolide Biosynthesis in Foxglove1

    Review 491 Cardenolide Biosynthesis in Foxglove1 W. Kreis2,k A. Hensel2, and U. Stuhlemmer2 1 Dedicated to Prof. Dr. Dieter He@ on the occasion of his 65th birthday 2 Friedrich-Alexander-Universität Erlangen, Institut für Botanik und Pharmazeutische Biologie, Erlangen, Germany Received: January 28, 1998; Accepted: March 28, 1998 Abstract: The article reviews the state of knowledge on the genuine cardiac glycosides present in Digitalis species have a biosynthesis of cardenolides in the genus Digitalis. It sum- terminal glucose: these cardenolides have been termed marizes studies with labelled and unlabelled precursors leading primary glycosides. After harvest or during the controlled to the formulation of the putative cardenolide pathway. Alter- fermentation of dried Digitalis leaves most of the primary native pathways of cardenolide biosynthesis are discussed as glycosides are hydrolyzed to yield the so-called secondary well. Special emphasis is laid on enzymes involved in either glycosides. Digitalis cardenolides are valuable drugs in the pregnane metabolism or the modification of cardenolides. medication of patients suffering from cardiac insufficiency. In About 20 enzymes which are probably involved in cardenolide therapy genuine glycosides, such as the lanatosides, are used formation have been described "downstream" of cholesterol, as well as compounds obtained after enzymatic hydrolysis including various reductases, oxido-reductases, glycosyl trans- and chemical saponification, for example digitoxin (31) and ferases and glycosidases as well as acyl transferases, acyl es- digoxin, or chemical modification of digoxin, such as metildig- terases and P450 enzymes. Evidence is accumulating that car- oxin. Digitalis lanata Ehrh. and D.purpurea L are the major denolides are not assembled on one straight conveyor belt but sources of the cardiac glycosides most frequently employed in instead are formed via a complex multidimensional metabolic medicine.