DOCSLIB.ORG

José Luis Villanueva-Cañas

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
José Luis Villanueva-Cañas Insights into mammalian adaptive evolution through genomics data José Luis Villanueva-Cañas TESI DOCTORAL UPF / 2015 DIRECTORA DE LA TESI Dra. Maria del Mar Albà Soler Evolutionary Genomics Group Research Programme on Biomedical Informatics (GRIB) FIMIM (Fundació Hospital del Mar Medical Research Institute) Universitat Pompeu Fabra DEPARTMENT OF EXPERIMENTAL AND HEALTH SCIENCES AUG III A mis abuelos V All men by nature desire to know. Aristotle Try to learn something about everything and everything about something. Thomas Huxley Acknowledgements Uno no llega hasta aquí solo. En realidad nunca nadie llega a ningún lado sin la ayuda y soporte de los demás. Estas líneas que siguen son mi muestra de agradecimiento para todas aquellas personas que aportaron su granito de arena en el desarrollo de este trabajo. A tu Mar, per proporcionar-me l’oportunitat de fer una mica de ciència. També per donar-me la llibertat per a cometre errors, tan necessaris per aprendre. Però sobretot per la teva integritat, com a científica i com a ciutadana. A en Patrick Aloy, Javier de la Cruz i Lourdes Fañanas per mostrar- me el mapa i ajudar-me a triar camins. Als membres del grup d’EG i en especial als doctorands (molts ja doctors): Steve, Alice, Macarena, Núria, Will (thanks also for the oxford comma) i en Jorge. A l’Alfons i Miguel, aka “the IT Crowd”, ja que sense la seva expertesa i diligència en qüestions binaries res d’això hagués estat possible. Anne, thanks for providing me with the great opportunity to make a short internship in your group. Sheena, thanks for being an VII awesome collaborator and introducing me into the lemur world. Also to all the people of the Yoder lab that took good care of me while I was overseas, especially to Erin, Peter and Jason. To Emma and all her irish crowd (Nicole, David, Stephen, Zixia, Una, Graham and George (albeit adopted)), for giving me a human (or a bat) perspective of science and showing me what ‘the craic’ was. To Jens and Salla, for letting me explore their area52. To Sergio and his wonderful wife Marcia, for treating me like a family during my dublinese adventure. To all my MSc classmates, especially to Magda and Yorgos, whom I now call friends. Gràcies a en David, Albert, Pau, Maria, Inés, Armand, Iván i Cinta per compartir les penes i les alegries de la professió. També per les paelles. A tots els meus companys de despatx, passats i presents, que van compartir el dia a dia amb mi, fent la rutina més agradable: Max, Adriano, Salva, Núria, Sergi, Pau, Héctor, Babita, Juan Luis, Juan Ramón, Michael, Eneritz, Nico, Imma, Emma, Abel, Amadís… i tots els que la memòria no em retorna ara mateix. A un trozo de madera, que unas manos artesanas convirtieron en arco, y contribuyó, en gran medida, a despejar mi mente en días tristes o turbios, allá por los bosques de Dosrius. A todos y cada uno de mis compañeros de armas de l’Associació Catalana d’Esgrima Antiga (ACEA), en especial a los instructores Oriol y Diego, que han tenido la paciencia de enseñarme la poca esgrima que sé. A Israel y David por los viajes, las risas y alguna que otra locura. VIII A mis viejos amigos, en especial a Aaron, Marga, Cristina, Elena, Ruth, Borja y Jaume. A Sara, por un gran año y por el futuro. A mis abuelos y abuela, que no llegaron a ver este día. A mi iaia Carmen, que resiste el envite del tiempo. Todos ellos miembros de una dura y noble generación que lo dieron todo, sin pedir nada a cambio. A mi familia y muy especialmente a mis padres (papá y mamá o J. Antonio y María Jesús), mi hermano Javier y mi tía Ana. Por su apoyo, siempre incondicional en cualquier proyecto (o locura) que yo haya decidido emprender. A todo aquel que se atreva a leer más allá de estos agradecimientos. IX Abstract Although the genome sequencing revolution is still in its infancy, we must acknowledge it as the major driver of biology since the beginning of the 21st century. The availability of a large collection of complete mammalian genomes due to high-throughput sequencing technologies allows us to begin the exploration of how the evolutionary diversification of gene content reflects the ecological adaptations of different taxa. Novelty arises in evolution through the transformation or combination of existing systems and, as shown recently, also from scratch. This thesis is centered around these different mechanisms of evolutionary innovation. It includes a common methodological part in which we propose a simple method to optimize multiple alignments and examine its effect in positive selection analyses, the exploration of the origin and evolution of mammalian-specific genes, and the study of gene regulation in mammalian adaptations (e.g. hibernation) using high-throughput technologies. XI Resum Tot i que la denominada era de la genòmica es troba encara a la seva infància, ha estat un dels principals impulsors de la biologia des del començament del segle 21. L’accés a una creixent col·lecció de genomes complets de mamífers, gràcies a les tècniques de seqüenciació massiva, ens permet explorar com la diversificació evolutiva dels gens es tradueix en les diferents adaptacions ecològiques dels diferents tàxons. La innovació apareix a l’evolució a través de la transformació o la combinació de sistemes preexistents, fins i tot, nous gens poden aparèixer a partir de regions prèviament no codificants, com s’ha demostrat recentment. Aquesta tesi s’articula al voltant d’aquests mecanismes d’innovació evolutiva. Inclou una part metodològica comuna on es proposa un mètode simple per optimitzar alineaments múltiples i avaluar-ne l’efecte en anàlisis de selecció positiva, l’exploració de l’origen i evolució de gens específics de mamífers i l’estudi de la regulació gènica en una adaptació pròpia dels mamífers (hibernació) mitjançant tècniques de seqüenciació massiva. XIII “A curious aspect of the theory of evolution is that everybody thinks he understands it.” Jacques Monod Preface - Prolegomena I was, and still am, overwhelmed by the diversity and complexity of the life that surrounds us. My fascination began very early, like every other child, asking questions about everything I could lay my eyes on. I was moved by a power-source that only kids have intact: true curiosity. Mine became mature when I first heard about Darwin’s (and Wallace) theory of evolution. Evolution planted in my head the seed of diversity, of change. I was amazed of how they were able to put together many different pieces of facts and converted them into new knowledge. One that would revolutionize humanity and would have a profound effect in the way we think and perceive the world. After several years scratching the surface of evolution and genomics, and while trying to deliver a small contribution to science, I made a precious discovery: A personal one. I committed plenty of mistakes in my daily work and spent countless hours fixing subtleties, but most importantly, I was able to learn from those mistakes (and solved some problems along the way). I found out that the only possible path to true knowledge is through humility and hard work. XV Everything you know (or you think you know) can change when new evidence appears or a new way to look at it comes into play; that is indeed the beauty of science. To me science is a vision of the world. A true human endeavor, which guides the irrational creature we all have inside through the path of knowledge. José Luis Villanueva-Cañas Barcelona, August 2015 XVI Table of Contents Acknowledgements ........................................................................................... VII Abstract .............................................................................................................. XI Resum .............................................................................................................. XIII Preface - Prolegomena ..................................................................................... XV Table of Contents ........................................................................................... XVII 1. Mammals ..................................................................................................... 1 1.1. Distribution ............................................................................................. 3 1.2. Origin ...................................................................................................... 5 Extant groups ..................................................................................................... 8 1.3. Characteristics and Adaptations ......................................................... 16 2. Genomics ................................................................................................... 25 2.1. Sequence Alignments ........................................................................... 30 3. Molecular Innovation ............................................................................... 32 3.1. Sequence change and positive selection .............................................. 34 3.2. Shifts in gene expression regulation.................................................... 39 3.2.1. Hibernation ........................................................................................... 41 3.3. Origin of New Genes ............................................................................ 47 3.3.1. TRGs and de Novo Genes .................................................................... 50 History and Nomenclature ............................................................................... 50 How do orphan
Load more

Recommended publications
  • Proteomic Profiling of Liver from Elaphe Taeniura, a Common Snake in Eastern and Southeastern Asia
    Genetics and Molecular Biology, 36, 3, 438-447 (2013) Copyright © 2013, Sociedade Brasileira de Genética. Printed in Brazil www.sbg.org.br Research Article Proteomic profiling of liver from Elaphe taeniura, a common snake in eastern and southeastern Asia Liang Chen1, Hengchuan Xia3, Yiting Wang2, Keping Chen3, Lvgao Qin3, Bin Wang3, Qin Yao3, Jun Li4, Yuanqing He3 and Ermi Zhao1,5 1Key Laboratory of Bio-resources and Eco-environment, College of Life Sciences, Sichuan University, Chengdu, Sichuan Province, China. 2College of Athletic Sports, Yangzhou University, Yangzhou, Jiangsu Province, China. 3Institute of Life Sciences, Jiangsu University, Zhenjiang, Jiangsu Province, China. 4Center for Physics and Chemistry, Jiangsu University, Zhenjiang, Jiangsu Province, China. 5Chengdu Institute of Biology, the Chinese Academy of Sciences, Chengdu, Sichuan Province, China. Abstract Snake liver has been implicated in the adaptation of snakes to a variety of habitats. However, to date, there has been no systematic analysis of snake liver proteins. In this study, we undertook a proteomic analysis of liver from the colubrid snake Elaphe taeniura using a combination of two-dimensional electrophoresis (2-DE) and matrix-assisted laser desorption/ionization time of flightmass spectrometry (MALDI-TOF MS). We also constructed a local protein sequence database based on transcriptome sequencing to facilitate protein identification. Of the 268 protein spots revealed by 2-DE 109 gave positive MS signals, 84 of which were identified by searching the NCBInr, Swiss-Prot and local databases. The other 25 protein spots could not be identified, possibly because their transcripts were not be stable enough to be detected by transcriptome sequencing. GO analysis showed that most proteins may be involved in binding, catalysis, cellular processes and metabolic processes.
    [Show full text]
  • Cellular and Molecular Signatures in the Disease Tissue of Early
    Cellular and Molecular Signatures in the Disease Tissue of Early Rheumatoid Arthritis Stratify Clinical Response to csDMARD-Therapy and Predict Radiographic Progression Frances Humby1,* Myles Lewis1,* Nandhini Ramamoorthi2, Jason Hackney3, Michael Barnes1, Michele Bombardieri1, Francesca Setiadi2, Stephen Kelly1, Fabiola Bene1, Maria di Cicco1, Sudeh Riahi1, Vidalba Rocher-Ros1, Nora Ng1, Ilias Lazorou1, Rebecca E. Hands1, Desiree van der Heijde4, Robert Landewé5, Annette van der Helm-van Mil4, Alberto Cauli6, Iain B. McInnes7, Christopher D. Buckley8, Ernest Choy9, Peter Taylor10, Michael J. Townsend2 & Costantino Pitzalis1 1Centre for Experimental Medicine and Rheumatology, William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, Queen Mary University of London, Charterhouse Square, London EC1M 6BQ, UK. Departments of 2Biomarker Discovery OMNI, 3Bioinformatics and Computational Biology, Genentech Research and Early Development, South San Francisco, California 94080 USA 4Department of Rheumatology, Leiden University Medical Center, The Netherlands 5Department of Clinical Immunology & Rheumatology, Amsterdam Rheumatology & Immunology Center, Amsterdam, The Netherlands 6Rheumatology Unit, Department of Medical Sciences, Policlinico of the University of Cagliari, Cagliari, Italy 7Institute of Infection, Immunity and Inflammation, University of Glasgow, Glasgow G12 8TA, UK 8Rheumatology Research Group, Institute of Inflammation and Ageing (IIA), University of Birmingham, Birmingham B15 2WB, UK 9Institute of
    [Show full text]
  • Human C11orf86 (NM 001136485) Cdna/ORF Clone
    Human C11orf86 (NM_001136485) cDNA/ORF clone Catalog Number: 738726-1 General Information Plasmid Resuspension protocol Gene Name: 1.Centrifuge at 5,000×g for 5 min. 2.Carefully open the tube and add 20 μl of sterile chromosome 11 open reading frame 86 water to dissolve the DNA. 3.Close the tube and incubate for 10 minutes at Official Symbol: C11orf86 room temperature. 4.Briefly vortex the tube and then do a quick spin Organism: Homo sapiens to concentrate the liquid at the bottom. Speed is RefSeq: NM_001136485 less than 5000×g. 5.Store the plasmid at -20 ℃. Description The plasmid is ready for: Sequence Description: Restriction enzyme digestion; PCR amplification; Identical with the Gene Bank Ref. ID sequence. E. coli transformation; DNA sequencing Vector: pOTENT-1 E.coli strains for transformation (recommended but not limited): Note: using kanamycin at 25~30 ug/ml, higher concentration may lead to no bacteria Most commercially available competent cells are clones. appropriate for the plasmid, e.g. TOP10, DH5α and TOP10F´. Restriction Sites: Vector Information Shipping carrier: ORFs cloned in this vector will be expressed in mammalian cells as a tagged protein with the C- Each tube contains approximately 5 μg - 10 μg of terminal FLAG-6 His tags. lyophilized plasmid. Such clones are the best for detection and purification of the transgene using anti-FLAG or Storage: anti-His antibodies. The lyophilized plasmid can be stored at ambient Physical Map of pOTENT-1: temperature for three months. Quality control: The plasmid is confirmed by full-length sequencing with primers in the sequencing primer list.
    [Show full text]
  • CSE642 Final Version
    Eindhoven University of Technology MASTER Dimensionality reduction of gene expression data Arts, S. Award date: 2018 Link to publication Disclaimer This document contains a student thesis (bachelor's or master's), as authored by a student at Eindhoven University of Technology. Student theses are made available in the TU/e repository upon obtaining the required degree. The grade received is not published on the document as presented in the repository. The required complexity or quality of research of student theses may vary by program, and the required minimum study period may vary in duration. General rights Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain Eindhoven University of Technology MASTER THESIS Dimensionality Reduction of Gene Expression Data Author: S. (Sako) Arts Daily Supervisor: dr. V. (Vlado) Menkovski Graduation Committee: dr. V. (Vlado) Menkovski dr. D.C. (Decebal) Mocanu dr. N. (Nikolay) Yakovets May 16, 2018 v1.0 Abstract The focus of this thesis is dimensionality reduction of gene expression data. I propose and test a framework that deploys linear prediction algorithms resulting in a reduced set of selected genes relevant to a specified case. Abstract In cancer research there is a large need to automate parts of the process of diagnosis, this is mainly to reduce cost, make it faster and more accurate.
    [Show full text]
  • Age-Related Variations in Gene Expression Patterns of Renal Cell Carcinoma – Biological and Translational Implications
    Age-Related Variations in Gene Expression Patterns of Renal Cell Carcinoma – Biological and Translational Implications Lara Feulner, M.D. Master of Science Department of Human Genetics McGill University Montreal, Quebec August 2018 A thesis submitted to McGill University in partial fulfillment of the requirements of the degree of Master of Science © Lara Feulner 2018 i DEDICATION This thesis is dedicated to my parents and brother, for their unfailing support throughout my life. Thank you so much. I’d also like to thank my colleagues from Yasser’s lab for making it a pleasant place to work the last two years. ii ABSTRACT Renal cell carcinoma (RCC) is known to occur across a wide age spectrum traversing age-related organismal changes, however little is known as to how the aging process may affect the course of RCC and the repertoire of genes involved. I therefore examined associations between patient age and the gene expression profiles in RCC tumors and normal kidney tissues. Datasets from The Cancer Genome Atlas (TCGA, n=436) and the International Cancer Genome Consortium (ICGC) Cancer Genomics of the Kidney (CAGEKID, n=89) were analyzed for pathways and cellular processes that are affected by aging in RCC. My analysis revealed different age dependent gene expression spectra in RCC tumors and normal kidney tissues. These findings were significant and reproducible in both datasets examined (p < 2.2 × 10-16). Age-upregulated genes, that is genes that show higher expression in older patients, in normal cells were significantly enriched (FDR<0.05) for pathways associated with immune response, collagen formation and semaphorin signaling, whereas age-upregulated genes in tumors were enriched for metabolism and oxidation pathways.
    [Show full text]
  • Looking for Missing Proteins in the Proteome Of
    Looking for Missing Proteins in the Proteome of Human Spermatozoa: An Update Yves Vandenbrouck, Lydie Lane, Christine Carapito, Paula Duek, Karine Rondel, Christophe Bruley, Charlotte Macron, Anne Gonzalez de Peredo, Yohann Coute, Karima Chaoui, et al. To cite this version: Yves Vandenbrouck, Lydie Lane, Christine Carapito, Paula Duek, Karine Rondel, et al.. Looking for Missing Proteins in the Proteome of Human Spermatozoa: An Update. Journal of Proteome Research, American Chemical Society, 2016, 15 (11), pp.3998-4019. 10.1021/acs.jproteome.6b00400. hal-02191502 HAL Id: hal-02191502 https://hal.archives-ouvertes.fr/hal-02191502 Submitted on 19 Mar 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Journal of Proteome Research 1 2 3 Looking for missing proteins in the proteome of human spermatozoa: an 4 update 5 6 Yves Vandenbrouck1,2,3,#,§, Lydie Lane4,5,#, Christine Carapito6, Paula Duek5, Karine Rondel7, 7 Christophe Bruley1,2,3, Charlotte Macron6, Anne Gonzalez de Peredo8, Yohann Couté1,2,3, 8 Karima Chaoui8, Emmanuelle Com7, Alain Gateau5, AnneMarie Hesse1,2,3, Marlene 9 Marcellin8, Loren Méar7, Emmanuelle MoutonBarbosa8, Thibault Robin9, Odile Burlet- 10 Schiltz8, Sarah Cianferani6, Myriam Ferro1,2,3, Thomas Fréour10,11, Cecilia Lindskog12,Jérôme 11 1,2,3 7,§ 12 Garin , Charles Pineau .
    [Show full text]
  • Arnau Soler2019.Pdf
    This thesis has been submitted in fulfilment of the requirements for a postgraduate degree (e.g. PhD, MPhil, DClinPsychol) at the University of Edinburgh. Please note the following terms and conditions of use: This work is protected by copyright and other intellectual property rights, which are retained by the thesis author, unless otherwise stated. A copy can be downloaded for personal non-commercial research or study, without prior permission or charge. This thesis cannot be reproduced or quoted extensively from without first obtaining permission in writing from the author. The content must not be changed in any way or sold commercially in any format or medium without the formal permission of the author. When referring to this work, full bibliographic details including the author, title, awarding institution and date of the thesis must be given. Genetic responses to environmental stress underlying major depressive disorder Aleix Arnau Soler Doctor of Philosophy The University of Edinburgh 2019 Declaration I hereby declare that this thesis has been composed by myself and that the work presented within has not been submitted for any other degree or professional qualification. I confirm that the work submitted is my own, except where work which has formed part of jointly-authored publications has been included. My contribution and those of the other authors to this work are indicated below. I confirm that appropriate credit has been given within this thesis where reference has been made to the work of others. I composed this thesis under guidance of Dr. Pippa Thomson. Chapter 2 has been published in PLOS ONE and is attached in the Appendix A, chapter 4 and chapter 5 are published in Translational Psychiatry and are attached in the Appendix C and D, and I expect to submit chapter 6 as a manuscript for publication.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-C11orf86 Product Datasheet
    Anti-C11orf86 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C11orf86 Product Number HPA039348 Gene Description chromosome 11 open reading frame 86 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLE RGTEGPDATAQE Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:50 - 1:200 - Retrieval method: HIER pH6 Characterization Data Available at atlasantibodies.com/products/HPA039348 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Supplementary File 1
    Supplementary Materials Figure S1. RNA sequencing quality control report. The upper panel showed per base sequence quality of (a) miRNA from 786-O and ACHN, and (b) RNA from 786-O and ACHN; the lower panel showed the per sequence quality scores of (c) miRNA from 786-O and ACHN, and (d) RNA from 786-O and ACHN. The quality score from 15 to 99 bp fell into the green background, indicating good quality calls. The majority read > 35 indicated good sequencing quality. Table S1. The list of miRNA with significant changes (ACHN vs 786-O) #miRNA Fold Change #miRNA Fold Change #miRNA Fold Change hsa-let-7a-2-3p -490.00 hsa-miR-192-5p 21.37 hsa-miR-323a-3p 135.76 hsa-let-7c-3p -10.30 hsa-miR-194-3p 31.18 hsa-miR-323b-3p 53.75 hsa-miR-100-3p -26.39 hsa-miR-194-5p 21.87 hsa-miR-326 -16.46 hsa-miR-100-5p -63.93 hsa-miR-195-5p 8.31 hsa-miR-329-3p 101.81 hsa-miR-105-5p -288.00 hsa-miR-196a-3p 5.28 hsa-miR-329-5p 436 hsa-miR-1185-1-3p 32.08 hsa-miR-199b-5p -9.75 hsa-miR-335-3p 73.67 hsa-miR-1185-2-3p 37.22 hsa-miR-203a-3p 222.25 hsa-miR-335-5p 71.58 hsa-miR-1185-5p 91.13 hsa-miR-205-5p -5.12 hsa-miR-337-3p 1696 hsa-miR-1197 7.38 hsa-miR-20b-5p 5.28 hsa-miR-337-5p 12141 hsa-miR-125b-1-3p -301.58 hsa-miR-211-5p 118 hsa-miR-34b-3p 1110.62 hsa-miR-125b-2-3p 5.91 hsa-miR-215-5p 18.88 hsa-miR-34b-5p 796.38 hsa-miR-1262 16.28 hsa-miR-218-5p 14.37 hsa-miR-34c-3p 10751 hsa-miR-1266-5p 6.62 hsa-miR-224-5p 118 hsa-miR-34c-5p 836.81 hsa-miR-127-3p 1723.39 hsa-miR-2277-3p 6.65 hsa-miR-3614-5p 141 hsa-miR-127-5p 4334.00 hsa-miR-2682-3p 6.63 hsa-miR-3617-5p -140 hsa-miR-1271-5p
    [Show full text]
  • Original Article Assessment for Prognostic Value of Differentially Expressed Genes in Immune Microenvironment of Clear Cell Renal Cell Carcinoma
    Am J Transl Res 2020;12(9):5416-5432 www.ajtr.org /ISSN:1943-8141/AJTR0112847 Original Article Assessment for prognostic value of differentially expressed genes in immune microenvironment of clear cell renal cell carcinoma Xiaoxue Yin1,2*, Xingming Zhang3,4*, Zhenhua Liu3,4*, Guangxi Sun3,4, Xudong Zhu3,4, Haoran Zhang3,4, Sha Zhu3,4, Jinge Zhao3,4, Junru Chen3,4, Pengfei Shen3,4, Jia Wang3,4, Ni Chen1,2, Qiao Zhou1,2, Hao Zeng3,4 1Department of Pathology, 2Institute of Pathology, 3Department of Urology, 4Institute of Urology, West China Hospital, Sichuan University, Chengdu 610041, P. R. China. *Co-first authors. Received April 19, 2020; Accepted August 1, 2020; Epub September 15, 2020; Published September 30, 2020 Abstract: Tumor-infiltrating immune cells have been recognized to be associated with prognosis and response to immunotherapy; however, genes related to immune microenvironment of clear cell renal cell carcinoma (ccRCC) remains unclear. To better understand the effects of genes involved in immune and stromal cells on prognosis, we used Cancer Genome Atlas Kidney Renal Clear Cell Carcinoma (TCGA-KIRC), DAVID database and ESTMATE algorithm, and divided the patients into low and high groups according to immune (median: 1038.45) and stromal scores (median: 667.945), respectively. We found the immune scores were significantly correlated with clinico- pathological parameters and overall survival (OS). Based on immune scores, 890 DEGs were significantly associ- ated with OS among the 1433 up-regulated genes. Based on top 10 DEGs (IL10RA, FCER1G, SASH3, TIGIT, RHOH, IL12RB1, AIF1, LPXN, LAPTM5 and SP140), cases with number of up-regulated genes ≥ 5 were associated poor OS (P = 0.002).
    [Show full text]
  • The Contribution of Technological Advancements in Breast Cancer from Next Generation Sequencing to Mass-Spectrophotometer
    Acta Scientific MEDICAL SCIENCES (ISSN: 2582-0931) Volume 5 Issue 3 March 2021 Review Article Review: The Contribution of Technological Advancements in Breast Cancer from Next Generation Sequencing to Mass-Spectrophotometer Zakaria Eltahir1* and Abdul Samad Firoz1,2 Received: January 27, 2021 1Department of Medical Laboratory Technology, College of Applied Medical Published: February 26, 2021 Sciences, Taibah University, Medina, Saudi Arabia © All rights are reserved by Zakaria Eltahir 2Center for Genetics and Inherited Diseases, Faculty of Medicine, Tabiah University, and Abdul Samad Firoz. Medina, Saudi Arabia *Corresponding Author: Zakaria Eltahir, Department of Medical Laboratory Technology, College of Applied Medical Sciences, Taibah University, Medina, Saudi Arabia. Abstract Breast Cancer has been recognized as a global health problem and a complex disease entity. When considering all cancer types, breast cancer is becoming the most frequent type of cancer affecting women of all ages and across the whole world. Era before next generation sequencing, diagnostic approaches employing genetic analysis were focused on individual factors and were unable to illustrate the comprehensive network of biological complexity encountering this aggressive disease. The introduction of next gen- eration sequencing has facilitated the acquisition of high resolution whole genome, exome and transcriptome sequencing data. This previously unattainable data enabled health professionals to gain a global view of breast cancer genomes and the full spectrum of its involvement. With the utilization of Next Generation Sequencing data from large number of breast cancer patients, it is expected that the exact signaling pathways, leading to the oncogenic transformation of breast tissue, become more understood. Next Generation Sequencing promises to revolutionize breast cancer research, therapy and diagnosis.
    [Show full text]
  • Candidate Chromosome 1 Disease Susceptibility Genes for Sjogren's Syndrome Xerostomia Are Narrowed by Novel NOD.B10 Congenic Mice P
    Donald and Barbara Zucker School of Medicine Journal Articles Academic Works 2014 Candidate chromosome 1 disease susceptibility genes for Sjogren's syndrome xerostomia are narrowed by novel NOD.B10 congenic mice P. K. A. Mongini Zucker School of Medicine at Hofstra/Northwell J. M. Kramer Northwell Health T. Ishikawa H. Herschman D. Esposito Follow this and additional works at: https://academicworks.medicine.hofstra.edu/articles Part of the Medical Molecular Biology Commons Recommended Citation Mongini P, Kramer J, Ishikawa T, Herschman H, Esposito D. Candidate chromosome 1 disease susceptibility genes for Sjogren's syndrome xerostomia are narrowed by novel NOD.B10 congenic mice. 2014 Jan 01; 153(1):Article 2861 [ p.]. Available from: https://academicworks.medicine.hofstra.edu/articles/2861. Free full text article. This Article is brought to you for free and open access by Donald and Barbara Zucker School of Medicine Academic Works. It has been accepted for inclusion in Journal Articles by an authorized administrator of Donald and Barbara Zucker School of Medicine Academic Works. For more information, please contact [email protected]. NIH Public Access Author Manuscript Clin Immunol. Author manuscript; available in PMC 2015 July 01. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: Clin Immunol. 2014 July ; 153(1): 79–90. doi:10.1016/j.clim.2014.03.012. Candidate chromosome 1 disease susceptibility genes for Sjogren’s syndrome xerostomia are narrowed by novel NOD.B10 congenic mice Patricia K. A. Monginia and Jill M. Kramera,1 Tomo-o Ishikawab,2 and Harvey Herschmanb Donna Espositoc aThe Feinstein Institute for Medical Research North Shore-Long Island Jewish Health System 350 Community Drive Manhasset, NY 11030 bDavid Geffen School of Medicine at UCLA 341 Boyer Hall (MBI) 611 Charles E.
    [Show full text]