Protective Genomic Loci on Mouse Chromosomes 3 and 19 Control the Incidence and Severity of Autoimmune Arthritis
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
TNF‑Α‑Mediated Epithelial‑To‑Mesenchymal Transition Regulates Expression of Immune Checkpoint Molecules in Hepatocellular Carcinoma
MOLECULAR MEDICINE REPORTS 21: 1849-1860, 2020 TNF‑α‑mediated epithelial‑to‑mesenchymal transition regulates expression of immune checkpoint molecules in hepatocellular carcinoma RITU SHRESTHA1,2, KIM R. BRIDLE1,2, DARRELL H.G. CRAWFORD1,2 and APARNA JAYACHANDRAN1,2 1University of Queensland, Faculty of Medicine and 2Liver Cancer Unit, Gallipoli Medical Research Institute, Greenslopes Private Hospital, Brisbane, QLD 4120, Australia Received June 12, 2019; Accepted January 31, 2020 DOI: 10.3892/mmr.2020.10991 Abstract. Hepatocellular carcinoma (HCC) is the ligand (PD‑L)1, PD‑L2, CD73 and B7‑H3. In contrast, reversal fastest growing cause of cancer-related deaths globally. of EMT suppressed the expression of PD‑L1, PD‑L2, CD73 Epithelial-to-mesenchymal transition (EMT) is a cellular and B7‑H3. In addition, high expression of TNF-α and PD‑L1 process that confers HCC tumor cells with the ability to evade in 422 patients with HCC was associated with poor overall the immune system. Immune escape in most tumors, including survival. The coordinate expression of TNF-α with PD‑L2 in HCC, is controlled by immune checkpoint molecules. The aim this patient cohort was associated with increased HCC recur- of the present study was to investigate the association between rence. In conclusion, the present study demonstrated a close EMT and immune checkpoint in HCC, and identify novel ther- association between immune modulator expression and EMT apeutic targets for HCC. An in vitro model of reversible EMT induction/reversal driven by TNF-α. was utilized based on cytokine tumor necrosis factor (TNF)-α treatment of HCC cell lines Hep3B and PLC/PRF/5. -
PARSANA-DISSERTATION-2020.Pdf
DECIPHERING TRANSCRIPTIONAL PATTERNS OF GENE REGULATION: A COMPUTATIONAL APPROACH by Princy Parsana A dissertation submitted to The Johns Hopkins University in conformity with the requirements for the degree of Doctor of Philosophy Baltimore, Maryland July, 2020 © 2020 Princy Parsana All rights reserved Abstract With rapid advancements in sequencing technology, we now have the ability to sequence the entire human genome, and to quantify expression of tens of thousands of genes from hundreds of individuals. This provides an extraordinary opportunity to learn phenotype relevant genomic patterns that can improve our understanding of molecular and cellular processes underlying a trait. The high dimensional nature of genomic data presents a range of computational and statistical challenges. This dissertation presents a compilation of projects that were driven by the motivation to efficiently capture gene regulatory patterns in the human transcriptome, while addressing statistical and computational challenges that accompany this data. We attempt to address two major difficulties in this domain: a) artifacts and noise in transcriptomic data, andb) limited statistical power. First, we present our work on investigating the effect of artifactual variation in gene expression data and its impact on trans-eQTL discovery. Here we performed an in-depth analysis of diverse pre-recorded covariates and latent confounders to understand their contribution to heterogeneity in gene expression measurements. Next, we discovered 673 trans-eQTLs across 16 human tissues using v6 data from the Genotype Tissue Expression (GTEx) project. Finally, we characterized two trait-associated trans-eQTLs; one in Skeletal Muscle and another in Thyroid. Second, we present a principal component based residualization method to correct gene expression measurements prior to reconstruction of co-expression networks. -
Laboratory Mouse Models for the Human Genome-Wide Associations
Laboratory Mouse Models for the Human Genome-Wide Associations The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Kitsios, Georgios D., Navdeep Tangri, Peter J. Castaldi, and John P. A. Ioannidis. 2010. Laboratory mouse models for the human genome-wide associations. PLoS ONE 5(11): e13782. Published Version doi:10.1371/journal.pone.0013782 Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:8592157 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA Laboratory Mouse Models for the Human Genome-Wide Associations Georgios D. Kitsios1,4, Navdeep Tangri1,6, Peter J. Castaldi1,2,4,5, John P. A. Ioannidis1,2,3,4,5,7,8* 1 Institute for Clinical Research and Health Policy Studies, Tufts Medical Center, Boston, Massachusetts, United States of America, 2 Tufts University School of Medicine, Boston, Massachusetts, United States of America, 3 Department of Hygiene and Epidemiology, University of Ioannina School of Medicine and Biomedical Research Institute, Foundation for Research and Technology-Hellas, Ioannina, Greece, 4 Tufts Clinical and Translational Science Institute, Tufts Medical Center, Boston, Massachusetts, United States of America, 5 Department of Medicine, Center for Genetic Epidemiology and Modeling, Tufts Medical Center, Tufts University -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Anti-VAV3 (Aa 567-578) Polyclonal Antibody (DPABH-12442) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-VAV3 (aa 567-578) polyclonal antibody (DPABH-12442) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitement by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Immunogen Synthetic peptide: CSGEQGTLKLPEK, corresponding to internal sequence amino acids 567-578 of Human VAV3 Isotype IgG Source/Host Goat Species Reactivity Human Purification Immunogen affinity purified Conjugate Unconjugated Applications WB, IHC-P Format Liquid Size 50 μg Buffer pH: 7.40; Constituents: 0.5% BSA, Tris buffered saline Preservative 0.02% Sodium Azide Storage Store at 4°C or at -20°C for long term storage. GENE INFORMATION Gene Name VAV3 vav 3 guanine nucleotide exchange factor [ Homo sapiens ] Official Symbol VAV3 Synonyms VAV3; vav 3 guanine nucleotide exchange factor; vav 3 oncogene; guanine nucleotide exchange factor VAV3; VAV-3; FLJ40431; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Entrez Gene ID 10451 Protein Refseq NP_001073343 UniProt ID Q9UKW4 Chromosome Location 1p13.3 Pathway B cell receptor signaling pathway; Cell death signalling via NRAGE, NRIF and NADE; Chemokine signaling pathway; Coregulation of Androgen receptor activity; EGFR1 Signaling Pathway; Function GTPase activator activity; Rac guanyl-nucleotide exchange factor activity; SH3/SH2 adaptor activity; epidermal growth factor receptor binding; guanyl-nucleotide exchange factor activity; metal ion binding; protein binding 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved. -
HS2ST1 Maxpab Mouse Polyclonal Antibody (B01)
HS2ST1 MaxPab mouse polyclonal antibody (B01) Catalog # : H00009653-B01 規格 : [ 50 uL ] List All Specification Application Image Product Mouse polyclonal antibody raised against a full-length human HS2ST1 Western Blot (Tissue lysate) Description: protein. Immunogen: HS2ST1 (AAH25990.1, 1 a.a. ~ 229 a.a) full-length human protein. Sequence: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR EIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKY enlarge HVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKF GVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDEC Western Blot (Transfected VAEGGSDCAPEKLWLQIPFFCGHSSECW lysate) Host: Mouse Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: enlarge Storage Buffer: No additive Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use. Datasheet: Download Applications Western Blot (Tissue lysate) HS2ST1 MaxPab polyclonal antibody. Western Blot analysis of HS2ST1 expression in human liver. Protocol Download Western Blot (Transfected lysate) Page 1 of 3 2016/5/22 Western Blot analysis of HS2ST1 expression in transfected 293T cell line (H00009653- T01) by HS2ST1 MaxPab polyclonal antibody. Lane 1: HS2ST1 transfected lysate(25.19 KDa). Lane 2: Non-transfected lysate. Protocol Download Gene Information Entrez GeneID: 9653 GeneBank BC025990.1 Accession#: Protein AAH25990.1 Accession#: Gene Name: HS2ST1 Gene Alias: FLJ11317,KIAA0448,MGC131986,dJ604K5.2 Gene heparan sulfate 2-O-sulfotransferase 1 Description: Omim ID: 604844 Gene Ontology: Hyperlink Gene Summary: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. -
Palmitic Acid Effects on Hypothalamic Neurons
bioRxiv preprint doi: https://doi.org/10.1101/2021.08.03.454666; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Running title: Oleic and palmitic acid effects on hypothalamic neurons Concentration-dependent change in hypothalamic neuronal transcriptome by the dietary fatty acids: oleic and palmitic acids Fabiola Pacheco Valencia1^, Amanda F. Marino1^, Christos Noutsos1, Kinning Poon1* 1Department of Biological Sciences, SUNY Old Westbury, Old Westbury NY, United States ^Authors contributed equally to this work *Corresponding Author: Kinning Poon 223 Store Hill Rd Old Westbury, NY 11568, USA 1-516-876-2735 [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2021.08.03.454666; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract Prenatal high-fat diet exposure increases hypothalamic neurogenesis events in embryos and programs offspring to be obesity-prone. The molecular mechanism involved in these dietary effects of neurogenesis are unknown. This study investigated the effects of oleic and palmitic acids, which are abundant in a high-fat diet, on the hypothalamic neuronal transcriptome and how these changes impact neurogenesis events. The results show differential effects of low and high concentrations of oleic or palmitic acid treatment on differential gene transcription. -
Metastatic Adrenocortical Carcinoma Displays Higher Mutation Rate and Tumor Heterogeneity Than Primary Tumors
ARTICLE DOI: 10.1038/s41467-018-06366-z OPEN Metastatic adrenocortical carcinoma displays higher mutation rate and tumor heterogeneity than primary tumors Sudheer Kumar Gara1, Justin Lack2, Lisa Zhang1, Emerson Harris1, Margaret Cam2 & Electron Kebebew1,3 Adrenocortical cancer (ACC) is a rare cancer with poor prognosis and high mortality due to metastatic disease. All reported genetic alterations have been in primary ACC, and it is 1234567890():,; unknown if there is molecular heterogeneity in ACC. Here, we report the genetic changes associated with metastatic ACC compared to primary ACCs and tumor heterogeneity. We performed whole-exome sequencing of 33 metastatic tumors. The overall mutation rate (per megabase) in metastatic tumors was 2.8-fold higher than primary ACC tumor samples. We found tumor heterogeneity among different metastatic sites in ACC and discovered recurrent mutations in several novel genes. We observed 37–57% overlap in genes that are mutated among different metastatic sites within the same patient. We also identified new therapeutic targets in recurrent and metastatic ACC not previously described in primary ACCs. 1 Endocrine Oncology Branch, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892, USA. 2 Center for Cancer Research, Collaborative Bioinformatics Resource, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892, USA. 3 Department of Surgery and Stanford Cancer Institute, Stanford University, Stanford, CA 94305, USA. Correspondence and requests for materials should be addressed to E.K. (email: [email protected]) NATURE COMMUNICATIONS | (2018) 9:4172 | DOI: 10.1038/s41467-018-06366-z | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/s41467-018-06366-z drenocortical carcinoma (ACC) is a rare malignancy with types including primary ACC from the TCGA to understand our A0.7–2 cases per million per year1,2. -
The Transition from Primary Colorectal Cancer to Isolated Peritoneal Malignancy
medRxiv preprint doi: https://doi.org/10.1101/2020.02.24.20027318; this version posted February 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. It is made available under a CC-BY 4.0 International license . The transition from primary colorectal cancer to isolated peritoneal malignancy is associated with a hypermutant, hypermethylated state Sally Hallam1, Joanne Stockton1, Claire Bryer1, Celina Whalley1, Valerie Pestinger1, Haney Youssef1, Andrew D Beggs1 1 = Surgical Research Laboratory, Institute of Cancer & Genomic Science, University of Birmingham, B15 2TT. Correspondence to: Andrew Beggs, [email protected] KEYWORDS: Colorectal cancer, peritoneal metastasis ABBREVIATIONS: Colorectal cancer (CRC), Colorectal peritoneal metastasis (CPM), Cytoreductive surgery and heated intraperitoneal chemotherapy (CRS & HIPEC), Disease free survival (DFS), Differentially methylated regions (DMR), Overall survival (OS), TableFormalin fixed paraffin embedded (FFPE), Hepatocellular carcinoma (HCC) ARTICLE CATEGORY: Research article NOTE: This preprint reports new research that has not been certified by peer review and should not be used to guide clinical practice. 1 medRxiv preprint doi: https://doi.org/10.1101/2020.02.24.20027318; this version posted February 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. It is made available under a CC-BY 4.0 International license . NOVELTY AND IMPACT: Colorectal peritoneal metastasis (CPM) are associated with limited and variable survival despite patient selection using known prognostic factors and optimal currently available treatments. -
The Two Tort Dit U Nonton Un Mountin
THETWO TORT DIT USU 20180010132A1NONTONUN MOUNTIN ( 19) United States (12 ) Patent Application Publication ( 10) Pub . No. : US 2018 / 0010132 A1 MAVRAKIS et al. ( 43 ) Pub . Date : Jan . 11 , 2018 ( 54 ) INHIBITION OF PRMT5 TO TREAT Publication Classification MTAP - DEFICIENCY- RELATED DISEASES (51 ) Int . CI. C12N 15 / 113 ( 2010 .01 ) (71 ) Applicant : NOVARTIS AG , Basel (CH ) A61K 45 / 06 ( 2006 . 01) ( 72 ) Inventors : Konstantinos John MAVRAKIS , A61K 31 / 7088 (2006 . 01 ) Boston , MA (US ) ; Earl Robert COZK 16 / 40 ( 2006 .01 ) MCDONALD , III , Wayland , MA (US ) ; A61K 39 /395 ( 2006 . 01 ) Frank Peter STEGMEIER , Acton , GOIN 33 /574 (2006 . 01 ) A61K 39 / 00 ( 2006 .01 ) MA (US ) (52 ) U . S . CI. CPC . .. C12N 15 / 1137 ( 2013 .01 ) ; A61K 39 /3955 ( 73 ) Assignee : Novartis AG , Basel (CH ) ( 2013 .01 ) ; A61K 45 / 06 ( 2013 .01 ) ; GOIN 33 /574 ( 2013. 01 ) ; C12Y 201/ 01 (2013 .01 ) ; ( 21 ) Appl. No. : 15 /510 , 542 A61K 31 /7088 (2013 .01 ) ; CO7K 16 / 40 ( 2013 .01 ) ; A61K 2039 /505 (2013 . 01 ) ; C12N ( 22 ) PCT Filed : Sep . 9 , 2015 2310 / 14 (2013 . 01 ) ; C12N 2320 / 31 ( 2013 .01 ) ; ( 86 ) PCT No .: PCT/ IB2015 /056902 CO7K 2317/ 76 ( 2013 .01 ) $ 371 (c ) ( 1 ) , (57 ) ABSTRACT ( 2 ) Date : Mar. 10 , 2017 The invention provides novel personalized therapies , kits , transmittable forms of information and methods for use in treating patients having cancer , wherein the cancer is Related U . S . Application Data MTAP - deficient and / or MTA -accumulating and thus ame (60 ) Provisional application No . 62/ 131 ,437 , filed on Mar . nable to therapeutic treatment with a PRMT5 inhibitor. Kits , 11 , 2015 , provisional application No . -
Genome-Wide DNA Methylation Analysis Reveals Molecular Subtypes of Pancreatic Cancer
www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 17), pp: 28990-29012 Research Paper Genome-wide DNA methylation analysis reveals molecular subtypes of pancreatic cancer Nitish Kumar Mishra1 and Chittibabu Guda1,2,3,4 1Department of Genetics, Cell Biology and Anatomy, University of Nebraska Medical Center, Omaha, NE, 68198, USA 2Bioinformatics and Systems Biology Core, University of Nebraska Medical Center, Omaha, NE, 68198, USA 3Department of Biochemistry and Molecular Biology, University of Nebraska Medical Center, Omaha, NE, 68198, USA 4Fred and Pamela Buffet Cancer Center, University of Nebraska Medical Center, Omaha, NE, 68198, USA Correspondence to: Chittibabu Guda, email: [email protected] Keywords: TCGA, pancreatic cancer, differential methylation, integrative analysis, molecular subtypes Received: October 20, 2016 Accepted: February 12, 2017 Published: March 07, 2017 Copyright: Mishra et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC-BY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Pancreatic cancer (PC) is the fourth leading cause of cancer deaths in the United States with a five-year patient survival rate of only 6%. Early detection and treatment of this disease is hampered due to lack of reliable diagnostic and prognostic markers. Recent studies have shown that dynamic changes in the global DNA methylation and gene expression patterns play key roles in the PC development; hence, provide valuable insights for better understanding the initiation and progression of PC. In the current study, we used DNA methylation, gene expression, copy number, mutational and clinical data from pancreatic patients. -
Chromosome Abnormalities in Two Patients with Features of Autosomal Dominant Robinow Syndrome
ß 2007 Wiley-Liss, Inc. American Journal of Medical Genetics Part A 143A:1790–1795 (2007) Research Letter Chromosome Abnormalities in Two Patients With Features of Autosomal Dominant Robinow Syndrome Juliana F. Mazzeu,1 Ana Cristina Krepischi-Santos,1 Carla Rosenberg,1 Karoly Szuhai,2 Jeroen Knijnenburg,2 Janneke M.M. Weiss,3 Irina Kerkis,1 Zan Mustacchi,4 Guilherme Colin,5 Roˆmulo Mombach,6 Rita de Ca´ssia M. Pavanello,1 Paulo A. Otto,1 and Angela M. Vianna-Morgante1* 1Centro de Estudos do Genoma Humano, Departamento de Gene´tica e Biologia Evolutiva, Instituto de Biocieˆncias, Universidade de Sa˜o Paulo, Sa˜o Paulo, Brazil 2Department of Molecular Cell Biology, Leiden University Medical Center, Leiden, The Netherlands 3Department of Clinical Genetics, Leiden University Medical Center, Leiden, The Netherlands 4Hospital Infantil Darcy Vargas, Sa˜o Paulo, Brazil 5Departamento de Gene´tica Me´dica, Univille, Joinville, Brazil 6Centrinho Prefeito Luiz Gomes, Secretaria Municipal de Sau´de, Joinville, Brazil Received 13 April 2006; Accepted 13 December 2006 How to cite this article: Mazzeu JF, Krepischi-Santos AC, Rosenberg C, Szuhai K, Knijnenburg J, Weiss JMM, Kerkis I, Mustacchi Z, Colin G, Mombach R, Pavanello RM, Otto PA, Vianna-Morgante AM. 2007. Chromosome abnormalities in two patients with features of autosomal dominant Robinow syndrome. Am J Med Genet Part A 143A:1790–1795. To the Editor: Patient 1 Robinow syndrome [OMIM 180700] is characteriz- At age 3 4/12 years the girl was diagnosed as ed by fetal facies, mesomelic dwarfism, and hypo- affected by DRS (Fig. 1A). Detailed clinical examina- plastic genitalia.