DOCSLIB.ORG

KEEP up 2007 Bay - Dosage Profile: 8-24-8-0-2; DI: 6.00; CD: +0.86

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
KEEP up 2007 Bay - Dosage Profile: 8-24-8-0-2; DI: 6.00; CD: +0.86 KEEP UP 2007 Bay - Dosage Profile: 8-24-8-0-2; DI: 6.00; CD: +0.86 Raise a Native RACE AND (STAKES) RECORD Mr. Prospector Gold Digger Age Starts 1st 2nd 3rd Earnings Fappiano Dr. Fager 2 n uraced Killaloe Grand Splendor 3 1 0 0 1 4 , 7 0 $0 Unbridled Wild Risk 4 4 1 1 2 2 , 2 1 40 *Le Fabuleux Anguar 5 6 ( 14) 0 1 6 61,713 Gana Facil In Reality 6 7 ( 12) 0 0 8 6 ,922 Charedi Magic Unbridled’s Song (1993) 81 7(2) 1 4 3 0$0,545 Grey Sovereign Fortino II Ranavalo III Caro (IRE) At 4, WON a maiden special weight race at Gulfstream Park Chamossaire Chambord (1 mi., by 3 1/4 lengths, defeating Rumbling, Guns and Life Hill Trolley Song Olympia Religion, Shotgun Shine, etc.). Lucky Mel *Royal Mink At 5, WON River City H.-G3 at Churchill Downs (1 1/8 Lucky Spell Prince Blessed mi., turf, defeating Boisterous, Skyring, Swift Warrior, Incantation Magic Spell Keep Up etc.), an allowance race at Keeneland (1 mi., turf, equal Nearctic Northern Dancer top weight of 121 lbs., defeating Trend, Tiz Sardonic Natalma Vice Regent *Menetrier Joe, Cyber Secret, etc.), an allowance race at Arlington Victoria Regina Victoriana (1 mi., equal top weight of 122 lbs., defeating Duke of Deputy Minister Bunty Lawless Del Rey, Al Musaddad, Adena’s Chance, etc.), an Bunty’s Flight Broomflight Mint Copy allowance race at Churchill Downs (1 mi., turf, defeat- Jabneh Shakney ing Noble’s Promise, San Antone, Night Party, etc.). Grass Shack Keeper Hill (1995) Northern Dancer At 6, WON Swoon’s Son S. at Arlington (1 1/16 mi., turf, Lyphard Goofed defeating Corporate Jungle, Workin for Hops, Francois, Lypheor (GB) Sing Sing etc.), an allowance race at Keeneland (1 1/8 mi., turf, Klaizia (FR) Klainia Fineza defeating Utley, General Logan, Tahoe Lake (BRZ), etc.). Bold Ruler What a Pleasure Grey Flight Jedina IN THE STUD Dr. Fager Killaloe KEEP UP entered stud in 2014. Grand Splendor STATISTICAL SUMMARY Hoist Your Glass (2017 c., Hennessy). Winner at 3, 2020, AGNES SONIC. 4 wins, 2 to 4, in Japan, Oro Cup-LR, 2nd 4 crops i f eLtime Lifetime 2yo $11,188. NHK Mile Cup-G1, Keio Hai Nisai S.-G2, etc. Foals of racing age 0 4 4 0 Magnificent Muraco (2016 c., Private Account). Winner at 3, OCTAVE. 4 wins at 2 and 3, $1,660,934, Coaching Club Starters (/Fls) 0 (375%) 1 6(40%) $8,147. American Oaks-G1, Mother Goose S.-G1, etc. Winners (/Str) 1 4 (47%) 5(31%) Total Starts 4 93 4 7 Happy Ghost (2016 c., Champali). Winner at 4, 2020 in LIAM’S MAP. 6 wins in 8 starts at 3 and 4, $1,358,940, Total Wins (/Starts) 6 3(10%) 5(11%) Malaysia. Breeders’ Cup Dirt Mile-G1-ntr, etc. Sire. Total Earnings 7$36,029 $131,230 Keepupthemessage (2015 f., Orientate). Placed at 4, $11,197. Avg. Earnings (/Str) 2$4,534 $8,202 Safe Keeping (2015 f., French Deputy). Placed at 4, $10,170. FEMALE LINE Avg. Earnings (/Start) $ 2,109 $2,792 Emilys Keeper (2015 f., Smart Strike). Placed at 3, $7,380. 1st dam Stakes Wnrs (/Str) 0 ( 0%) 0(0%) More Moola (2015 f., Perfect Soul (IRE)). Placed at 3. KEEPER HILL, by Deputy Minister. 4 wins, $1,661,281, Stakes Horses (/Str) ( 130%) 2(13%) Hell Toupee (2015 c., Hat Trick (JPN)). Placed in 2 starts at 2. Kentucky Oaks-G1, Three Chimneys Spinster S.-G1, Avg. Earnings Index .056 .063 Keeper Ridge (2015 f., Confide). Placed at 3. Las Virgenes S.-G1, etc. Dam of 4 winners, incl.-- Comparable Index 1 .44 Gran Lucifer (2015 c., Pleasant Tap). Placed at 2 in Mexico. KEEP UP. Subject stallion. 2020 Statistics Broodmare Sire Starters 1 5 Ultraman (2016 c., Johar). Placed to 4, 2020 in Panama. Winners (/Str) ( 3 53%) DEPUTY MINISTER, 1979. Leading broodmare sire. Sire Total Starts 6 6 MALE LINE of 535 dams of 4072 foals, 3193 rnrs (78%), 2369 Total Wins (/Starts) ( 171%) KEEP UP is by UNBRIDLED'S SONG, stakes winner of wnrs (58%), 596 2yo wnrs (15%), 1.63 AEI, 1.37 Total Earnings $ 79,733 $1,311,800, Breeders’ Cup Juvenile-G1, etc. Leading CI, 284 stakes winners. Avg. Earnings (/Str) 5$,316 sire, sire of 122 stakes winners, including-- 2nd dam Avg. Earnings (/Start) $ 1,208 ARROGATE. 6 wins in 10 starts to 4, $11,422,600, in N.A., Fineza, by Lypheor (GB). 4 wins to 4, $128,239, 3rd Cape Stakes Wnrs (/Str) 0 ( 0%) champion 3-year-old colt, Pegasus World Cup Invi- May County S. Half-sister to CLABBER GIRL KEEP UP HAS SIRED tational S.-G1-ntr, etc., set ntr; winner in 1 start at 4 in ($1,006,261), FAMOUSLY FREE, Mount She- U.A.E., Emirates Airline Dubai World Cup-G1. ba, Lola Montes. Dam of 10 winners, incl.-- In a Fog (2015 c., dam by Seattle Sleet). 6 wins, 2 to 5, WILL TAKE CHARGE. 7 wins to 4, $3,924,648, champion KEEPER HILL (f. by Deputy Minister). Stakes winner, 2020, $152,070, 2nd Governor’s S.-R, Snack S.-R. 3-year-old colt, Travers S.-G1, Clark H.-G1, etc. Sire. above. Ucantkeepup (2015 f., Pride of Burkaan). 3 wins at 2 and FOREVER UNBRIDLED. 8 wins, 2 to 5, $3,186,880, in GOLDEN GEAR (c. by Gulch). 12 wins, 2 to 5, $634,- 3, placed at 5, 2020, $134,617, 2nd John W. Galbreath N.A., champion older dirt female, Longines Breeders’ 009, Commonwealth Breeders' Cup S.-G2, etc. Memorial S.-R. Cup Distaff-G1, Personal Ensign S.-G1, etc. Chasm (f. by Gulch). Winner at 2 and 3, $96,669, 3rd Terrible Story (2015 f., Valiant Nature). 5 wins, 2 to 4, MIDSHIPMAN. 4 wins at 2 and 3 $1,508,600, in N.A., Cicada S.-G3. Dam of Green Freedom (f. by Not $33,898, 3rd Clasico Eduardo Cautino Insua S.-G3. champion 2-year-old colt, Breeders' Cup Juvenile-G1, Bourbon, $149,169, 2nd OLG Muskoka S.-R, Passport (2015 c., Mt. Livermore). Winner at 3, placed at 5, Del Mar Futurity-G1, etc.; winner at 4 in U.A.E. Sire. Fanfreluche S.-R, etc.), Hiatus (g. by Maria's Mon, 2020, $97,733. EMBUR'S SONG. 6 wins, $612,210, champion older mare 3 wins, $91,860, 3rd Super Bowl Party Starter H.). Yeahiknow (2015 c., Brahms). 5 wins to 5, 2020, $72,555. in Canada, Hendrie S.-G3, Ontario Matron S.-G3, etc. Mancha Negra. Winner at 4, $33,318. Dam of Black Stumberg (2015 f., Valiant Nature). 4 wins to 4, $54,270. LA VERITA. 11 wins, 2 to 5 in Japan, Empress Hat-L, etc. Spot (g. by Honour and Glory, 8 wins, $181,589). Blueskeeper (2015 c., Danzig Connection). 3 wins, $37,682. UNRIVALED BELLE. 6 wins at 3 and 4, $1,854,706, Golden West. Placed, $20,760. Dam of Shining Sea (f. Westernopportunity (2015 c., Gone West). Winner, $31,355. Breeders’ Cup Ladies’ Classic-G1, La Troienne S.-G2, by Stormy Atlantic, $184,340, 3rd Am Capable S.-R). Seeyainthetestbarn (2015 c., Champali). 2 wins, $26,942. Rampart S.-G3, Real Prize S., 2nd Beldame S.-G1, etc. Autumn Leaf. Unplaced in 1 start. Granddam of Remission (2017 f., Diesis (GB)). 2 wins at 3, 2020, $17,- UNBRIDLED ELAINE. 6 wins, $1,770,740, Breeders’ Cup Forever Spring (c. by Brother Derek, 3rd Japon- 330. Distaff-G1, Monmouth Breeders’ Cup Oaks-G2, etc. L), Patriot Miss (f. by Quiet American, $47,550). Sergeant Granado (2015 c., Bernstein). Winner at 2, $12,229. 2021 FEE: $2,000 – LIVE FOAL Payable when foal stands and nurses EUREKA THOROUGHBRED FARM 6476 U.S. Highway 290 E. • Fredericksburg, Texas 78624 Inquiries to Bill Tracy Phone: (830) 688-1709 • Email: [email protected] • Website: www.eurekathoroughbreds.com Accredited Texas Stallion • Nominated to the Texas Stallion Stakes Series 60 AMERICAN RACEHORSE • 2021 STALLION REGISTER.
Load more

Recommended publications
  • FIELD COMMISSION Ch, 2005
    FIELD COMMISSION ch, 2005 Dosage (3-3-6-0-0); DI: 3.00; CD: 0.75 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Vice Regent, 1967 Northern Dancer, by Nearctic Age Starts 1st 2nd 3rd Earned 5s, wnr, $6,215 Deputy Minister, 1979 673 f, 103 BTW, 2.90 AEI Victoria Regina, by Menetrier 2 0 0 0 0 — 22s, BTW, $696,964 3 11 4 2 3 $218,869 1,142 f, 90 BTW, 2.52 AEI Mint Copy, 1970 Bunty's Flight, by Bunty Lawless 76s, wnr, $53,945 4 8 2(2) 3(3) 1(1) $560,309 Service Stripe, dkb/br, 1991 22s, BTW, $130,043 7 f, 7 r, 4 w, 1 BTW Shakney, by Jabneh 5 9 1 2(2) 1(1) $208,088 392 f, 19 BTW, 1.15 AEI 6 0 0 0 0 — Blushing Groom, 1974 Red God, by Nasrullah 6.75 AWD 10s, BTW, $407,153 7 2 1(1) 0 0 $43,000 Wedding Picture, 1981 512 f, 93 BTW, 3.95 AEI Runaway Bride, by Wild Risk Totals 30 8(3) 7(5) 5(2) $1,030,266 14s, BTW, $152,997 11 f, 10 r, 9 w, 4 BTW Strike a Pose, 1971 Iron Ruler, by Never Bend Won At 3 37s, wnr, $53,048 An allowance race at WO ($65,120, 7f, AW in 1:23.37, 9 f, 8 r, 6 w, 2 BTW Take a Stand, by Amerigo dftg. Great Blue, Primeric Prince, Champion Bull, Broad Brush, 1983 Ack Ack, by Battle Joined Changeing Lover, Icetate, Igottogojoe).
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • FEATURE PRESENTATION • G1 Kentucky Derby the 2009 Renewal of the GI Kentucky Oaks Saw Record 20 1/4-Length Margin of Victory, but It Was the Opposite
    SATURDAY, MAY 1, 2010 For information about TDN, call 732-747-8060. BEST TO BE LUCKY AND GOOD FEATURE PRESENTATION • G1 Kentucky Derby The 2009 renewal of the GI Kentucky Oaks saw record 20 1/4-length margin of victory, but it was the opposite end of the spectrum on yester- day=s sunsplashed afternoon, with pink-silked Blind Luck (Pol- lard=s Vision) winning by a whisker over a valiant Evening Sarah K Andrew photo Jewel (Northern Afleet). AI knew she was going to kick in for me and show me NO SUN TO SHINE ON THE OLD KENTUCKY HOME that run,@ said winning rider Rafael Bejarano. AThe There=s some wild weather in store for Louisville, and stretch here is very long, but she kept trying hard until Friday=s sunshine will be a distant memory by the time the end and never stopped. She=s amazing.@ Cont. p2-3 they start singing AMy Old Kentucky Home.@ Rain will be moving into the area overnight, RACHEL OUTRIVALED IN LA TROIENNE and is scheduled to become very Horse of the Year Rachel Alexandra (Medaglia d=Oro) heavy by first post. National turned for home with the lead over Weather Service officials ad- Unrivaled Belle (Unbridled=s Song) in dressed the media Friday after- the GII La Troienne S. at Churchill noon. AWe expect a period of showers and thunderstorms to de- yesterday, and fans were treated to velop in the local area by around a battle royal. Unrivaled Belle went 10 a.m., and for it to last about stride-for-stride with the champ three or four hours,@ said Joe down the stretch and finally got her Ammerman of the NWS.
    [Show full text]
  • ETBAUER 1996 Bay - Dosage Profile: 5-1-10-1-3; DI: 1.22; CD: +0.20
    ETBAUER 1996 Bay - Dosage Profile: 5-1-10-1-3; DI: 1.22; CD: +0.20 RACE AND (STAKES) RECORD Nearctic Northern Dancer Natalma Age Starts 1st 2nd 3rd Earnings Vice Regent *Menetrier 2 2020 $15,120 Victoria Regina Victoriana 353(1) 00 123,800 Deputy Minister Bunty Lawless 7 3(1) 20 $138,920 Bunty’s Flight Broomflight Mint Copy Jabneh At 3, WON Rebel S.-G3 at Oaklawn Park (1 1/16 mi., de- Shakney Grass Shack Silver Deputy (1985) feating Desert Demon, Kutsa, Fantastic Finish, etc.), an Native Dancer Raise a Native allowance race at Oaklawn Park (1 mi., defeating Okie I Raise You Mr. Prospector Nashua B, Hot Money, Who’srunnintheshow, etc.), a maiden Gold Digger Sequence special weight race at Oaklawn Park (1 1/16 mi., by 6 Silver Valley Bald Eagle 1/2 lengths, defeating Daddy Struck Gold, Camino Road At Sea Hard-a-Lee Seven Valleys Cielo, Try n’ Guess, etc.). Seven Corners Proud Pied Ancient History Etbauer IN THE STUD Northern Dancer Nijinsky II ETBAUER entered stud in 2000. Flaming Page Green Dancer *Val de Loir *Green Valley II STATISTICAL SUMMARY Sly Pola Greinton (GB) Derring-Do (Through October 14, 2009) High Top Camenae 7 crops Lifetime Lifetime 2yo Crystal Queen (GB) Saint Crespin III Foals of racing age 61 61 Crystal Drop *Chandelier Starters (/Fls) 46(75%) 14(23%) Insurprise (1989) Tenerani Winners (/Str) 39(85%) 4(29%) *Ribot Romanella Tom Rolfe Total Starts 695 25 Roman Pocahontas Total Wins (/Starts) 111(16%) 4(16%) How Setting Trick Total Earnings $1,506,634 $91,493 Sword Dancer Damascus Avg.
    [Show full text]
  • Trainers Steve Asmussen Thomas Albertrani
    TRAINERS TRAINERS THOMAS ALBERTRANI Bernardini: Jockey Club Gold Cup (2006); Scott and Eric Mark Travers (2006); Jim Dandy (2006); Preakness (2006); Withers (2006) 2015 RECORD Brilliant Speed: Saranac (2011); Blue Grass 1,499 252 252 217 $10,768,759 (2011) Buffum: Bold Ruler (2012) NATIONAL/ECLIPSE CHAMPIONS Criticism: Long Island (2008-09); Sheepshead Curlin: Horse of the Year (2007-08), Top Older Bay (2009) Male (2008), Top 3-Year-Old Male (2007) Empire Dreams: Empire Classic (2015); Kodiak Kowboy: Top Male Sprinter (2009) Birthdate - March 21, 1958 Commentator (2015); NYSS Great White Way My Miss Aurelia: Top 2-Year-Old Filly (2011) Birthplace - Brooklyn, NY (2013) Rachel Alexandra: Horse of the Year (2009), Residence - Garden City, NY Flashing: Nassau County (2009) Top 3-Year-Old Filly (2009) Family - Wife Fonda, daughters Teal and Noelle Gozzip Girl: American Oaks (2009); Sands Untapable: Top 3-Year-Old Filly (2014) Point (2009) 2015 RECORD Love Cove: Ticonderoga (2008) NEW YORK TRAINING TITLES 338 36 41 52 $3,253,692 Miss Frost: Riskaverse (2014) * 2010 Aqueduct spring, 12 victories Oratory: Peter Pan (2005) NATIONAL/ECLIPSE CHAMPION Raw Silk: Sands Point (2008) CAREER HIGHLIGHTS Bernardini: Top 3-Year-Old Male (2006) Ready for Rye: Quick Call (2015); Allied Forces * Campaigned 3-Year-Old Filly Champion (2015) Untapable in 2014, which included four Grade CAREER HIGHLIGHTS Romansh: Excelsior H. (2014); Discovery H. 1 wins: the Kentucky Oaks, the Mother Goose, * Trained Bernardini, who won the Preakness, (2013); Curlin (2013) the
    [Show full text]
  • IMPEACHMENT:Layout 1 11/26/13 7:57 AM Page 1
    IMPEACHMENT:Layout 1 11/26/13 7:57 AM Page 1 IMPEACHMENT Deputy Minister—Misconduct, by Criminal Type Third in the GI Kentucky Derby, GI Preakness Stakes and the GII Arkansas Derby A first out MSW winner and the only son of Horse of the Year and 2-year-old champion DEPUTY MINISTER to win at two, and the only stallion standing in California to run 1st, 2nd, or 3rd in the Kentucky Derby. His progeny to race are led by stakes winner, graded stakes-placed SCOOTER GIRL and ALWAYS ROYAL. He produced Maiden Special Weight Track Record Setter Nook and Granny at Hollywood Park. Half-brother to stakes winner Graded stakes-placed CAT CHARMER. Impeccable Conformation and Stunning Pedigree 2014 FEE: $2,000-LIVE FOAL (Free breeding to stakes-placed & stakes-producing mares) Property of Vincent Harris Standing at FRUITFUL ACRES FARM Inquiries to Mike Tippett or Vincent Harris, Blue Diamond Horseshoe, LLC in conjunction with Fruitful Acres Farm 44705 US Hwy 371, Aguanga, CA 92536 Phone (951) 219-1916/Cell (909) 518-0018 Fax (951) 681-8567 E-Mail [email protected] Website www.bluediamondhorseshoe.com 86 California Thoroughbred 2014 Stallion Directory www.ctba.com ImpeachmentCs405501ORIGJockeyClubPageSent11-8-2013-No ChangeLoretta11-26-2013-159pm :Layout 1 12/4/13 8:43 AM Page1 IMPEACHMENT 1997 Bay - Height 16.2 - Dosage Profile: 4-0-8-2-0; DI: 1.33; CD: +0.43 Nearco RACE AND (STAKES) RECORD Nearctic *Lady Angela Age Starts 1st 2nd 3rd Earnings Northern Dancer Native Dancer 2 1 1 0 0 $10,500 636 foals, 147 SWs Natalma Almahmoud 3 10 0 1(1) 3(3) 339,950 Vice Regent Fair Copy 11 1 1(1) 3(3) $350,450 673 foals, 105 SWs *Menetrier La Melodie Victoria Regina Windfields At 2, WON a maiden special weight race at Calder Race 3 foals, 1 SWs Victoriana Iribelle Deputy Minister (1979) Course (7 fur., defeating Firefighter Rob, Skip a Grade, Ladder 1141 foals, 90 SWs Total Anilation, etc.).
    [Show full text]
  • 2019 Mid-Atlantic Stallion Directory Pedigree Page Explanations
    2019 Mid-Atlantic Stallion Directory Pedigree page explanations ncluded in this section are pedigrees and In Male Lines and Stud Records, progeny have their points split between the two apti- pertinent data on 65 Thoroughbred stal- are arranged in order by champions, Grade 1 tudes. In the end, the total points in each col- Ilions standing at stud in the Mid-Atlantic winners then stakes winners by earnings. umn produce the Dosage Profile, a series of region. NOTICE: The eligibility status of stal- five numbers which reflect the relative pro- Statistics are accurate at least through lions nominated to national or state breed- portions of each of the five aptitudes in this Nov. 4, 2018. Statistics, as furnished by The ers’ programs (Breeders’ Cup, Maryland order: Brilliant-Intermediate-Classic-Solid- Jockey Club Information Systems, Blood- Million, etc.) is dependent on the nomina- Professional. stock Research Inc., Equibase and/or Daily tors’ compliance with conditions, rules and Racing Form, include results from North regulations of those programs. Mid-Atlantic “The ratio of points in the speed wing 1 America, England, Ireland, France, Italy and Thoroughbred cannot assume responsibility (Brilliant points + Intermediate points + ⁄2 Japan. Foreign statistics for countries other for nominators’ compliance with these regu- the Classic points) to points in the stamina 1 than England, Ireland, France, Italy and Ja- lations. Mare owners are advised to confirm wing ( ⁄2 the Classic points + Solid points + pan are included when available. eligibility with the stallion owners. Professional points) is the Dosage Index. (Dividing the stamina points into the speed The Mid-Atlantic Thoroughbred has ad- DOSAGE opted the following criteria for stakes quali- points.) This number is directly proportional Dosage is explained as follows by Dr.
    [Show full text]
  • Pedigree Insights
    Andrew Caulfield, October 17, 2006–Teofilo (Ire) P EDIGREE INSIGHTS The enormity of the task ahead of Teofilo mustn=t be under-estimated, as only two colts have managed to BY ANDREW CAULFIELD win even two legs of the Triple Crown since Nijinsky (Reference Point added the St Leger to his Derby DARLEY DEWHURST S.-G1, ,250,000, Newmarket, success in 1987, while Nashwan took the 2000 10-14, 2yo, c/f, 7fT, 1:26.12, gd/sf. Guineas and Derby two years later). The Triple Crown 1--TEOFILO (IRE), 127, c, 2, by Galileo (Ire) remains an exciting possibility, though, and Teofilo=s 1st Dam: Speirbhean (Ire) (SW-Ire), by Danehill record suggests that he could develop into that 2nd Dam: Saviour, by Majestic Light one-in-a-million colt blessed with the necessary 3rd Dam: Victoria Queen, by Victoria Park brilliance, versatility and toughness. Like Nijinsky, his O-Mrs J Bolger; B/T-J Bolger; J-K Manning; ,141,950. juvenile record stands at five wins from five starts and Lifetime Record: G1SW-Ire, 5-5-0-0, ,349,515. both colts gained their fifth success in the G1 Dewhurst S. However, the signs are that Jim Bolger, who also Click for the Racing Post chart or the free brisnet.com bred Teofilo, isn=t looking too far ahead, as he is now catalogue-style pedigree. considering sending his star colt to France for the Criterium International on October 29. If American racing thinks it has been hard done by, Nijinsky was a member of the second crop by with only three Triple Crown winners since Citation in Northern Dancer, a winner of the first two legs of the 1948 and none since Affirmed in 1978, spare a thought Triple Crown, whereas Teofilo comes from the second for the British fans.
    [Show full text]
  • Breeders' Cup Flash Notes
    Breeders’ Cup World Championships $2 Million Longines Breeders’ Cup Distaff (Grade I) Three–Year–Olds & Up Fillies & Mares 1 1/8 Miles Friday, October 31 Thursday, October 30, 2014 Contact Notes Team (626) 254-1352 Belle Gallantey – Michael Dubb, Gary Aisquith and Bethlehem Stables’ Breeders’ Cup Distaff contender Belle Gallantey continues to work under the supervision of trainer Rudy Rodriguez from Santa Anita’s Barn 68. Since arriving Sunday from their New York base, the two have been inseparable as the daughter of After Market has executed her final preparations. On Thursday morning, the highly strung mare schooled in the paddock and galloped 1½m at 6:30 am on the main track. “So far so good,” said Rodriguez. “She’s doing very well and I just try to keep her calm and feeling good.” Claimed last December in her 36th start, the tall Kentucky-bred mare has shown marked improvement under Rodriguez – her sixth trainer. After three consecutive victories in allowance races to begin the year she contested four consecutive Grade I races on the East Coast – winning the Beldame and Delaware Handicap. “We have just had to keep an eye on the little issues she’s had,” Rodriguez said. “We just try to keep her happy. I think making them happy is really important with all of my horses – that’s what we always try to do and it usually works well for us.” Accordingly, a victory in the Distaff could have championship implications. Division leader Close Hatches – who has three Grade I wins this year – is also in the race.
    [Show full text]
  • MIDSHIPMAN Ch, 2006
    MIDSHIPMAN 1 Dosage (7-8-15-0-2); DI: 2.37; CD: 0.56 ch, 2006 height 16.0 ⁄2 See gray pages—Polynesian RACE AND (BLACK TYPE) RECORD Fappiano, 1977 Mr. Prospector, by Raise a Native Age Starts 1st 2nd 3rd Earned 17s, BTW, $370,213 Unbridled, 1987 410 f, 47 BTW, 4.43 AEI Killaloe, by Dr. Fager 2 4 3(2) 1(1) 0 $1,380,200 24s, BTW, $4,489,475 3 2 1 0 1(1) $128,400 566 f, 48 BTW, 2.65 AEI Gana Facil, 1981 Le Fabuleux, by Wild Risk 4 in UAE 2 1 0 0 $76,000 Unbridled's Song, gr/ro, 1993 19s, wnr, $85,100 7 f, 6 r, 5 w, 2 BTW Charedi, by In Reality Totals 8 5(2) 1(1) 1(1) $1,584,600 12s, BTW, $1,311,800 1,651 f, 118 BTW, 2.13 AEI Caro, 1967 Fortino II, by Grey Sovereign At 2 in North America 7.19 AWD 19s, BTW, $373,040 Champion 2yo colt Trolley Song, 1983 599 f, 77 BTW, 3.37 AEI Chambord, by Chamossaire Won Bessemer Trust Breeders’ Cup Juvenile (G1A, 7s, wnr, $25,914 12 f, 9 r, 5 w, 1 BTW Lucky Spell, 1971 Lucky Mel, by Olympia 8.5f), Del Mar Futurity (G1A, 7f), 2nd Norfolk S (G1A, 69s, BTW, $253,655 8.5f), 3rd Breeders’ Cup Dirt Mile (G1A, 8f). 14 f, 12 r, 8 w, 3 BTW Incantation, by Prince Blessed SIRE LINE Seattle Slew, 1974 Bold Reasoning, by Boldnesian MIDSHIPMAN is by UNBRIDLED’S SONG, black-type 17s, BTW, $1,208,726 stakes winner of 5 races, $1,311,800, Breeders’ Cup Avenue of Flags, 1988 1,050 f, 111 BTW, 3.69 AEI My Charmer, by Poker 3s, wnr, $53,550 Juvenile (G1), Florida Derby (G1), Wood Memorial S 492 f, 21 BTW, 1.38 AEI Beautiful Glass, 1979 Pass the Glass, by Buckpasser (G2), Olympic H, 2nd Fountain of Youth S (G2), Peter Fleet Lady, dkb/br, 1994 7s, BTW, $147,570 Pan S (G2), Hutcheson S (G2).
    [Show full text]
  • Epiphaneia Breaks Through Dullahan Dies Suddenly
    MONDAY, OCTOBER 21, 2013 732-747-8060 $ TDN Home Page Click Here EPIPHANEIA BREAKS THROUGH FTKOCT BEGINS THREE-DAY STAND On paper, this year=s G1 Kikuka Sho at Kyoto Spurred by a reduction in supply and a healthy appeared relatively weak, lacking a previous Group 1 increase in demand, the 2013 yearling sales season has winner and following on the heels of a pair of stellar turned out strong numbers renewals dominated by Japanese Triple Crown winner so far, and Fasig-Tipton Orfevre (Jpn) (Stay Gold {Jpn}) in 2011, and four-time hopes the momentum Group 1 winner Gold Ship (Jpn) (Stay Gold {Jpn}) last continues heading into year. However, by the race=s end, Epiphaneia (Jpn) today=s October Fall Yearling (Symboli Kris S.) gave the Kyoto faithful something to Sale in Kentucky. The three- cheer about as he effortlessly ran away with the day sale begins this morning country=s third and final colts= Classic. The Carrot Farm and runs through silkbearer, who kicked off his career with three straight Wednesday, with sessions victories last year and won his prep for this in the starting daily at 10:00 a.m. G2 Kobe Shimbun Hai Sept. 22, could be considered A total of 1,134 horses, unlucky not to have won a Group 1 prior to yesterday. Boyd Browning, Jr. including four added horses, In fact, he came up just a length short of sweeping the L. Marquardt have been catalogued. Triple Crown, having finished second, beaten a half- AWe=re certainly in the length, in both the G1 Japanese 2000 Guineas and the midst of a recovery and have supply and demand G1 Japanese Derby.
    [Show full text]
  • 2020 Criteria Book
    ONTARIO THOROUGHBRED IMPROVEMENT PROGRAM 2020 program criteria April 2020 | Version 1.0 Ontario Racing (OR) is the Program Administrator for the PROGRAM HIGHLIGHTS Ontario Thoroughbred Improvement Program, a component of Ontario’s Horse Improvement Program. The Thoroughbred Improvement Program is a component of the Ontario Horse Improvement Program, which offers incentives for the breeding and ownership of Ontario Racing is a horse racing industry association, which was established Thoroughbred racehorses in Ontario. For 2020, nearly $16.7 million will be available to assume many of the functions of the Ontario Horse Racing division of the in awards and purses through the following: former Ontario Racing Commission. The organization is responsible for directing breed improvement programs, setting an annual program of races and purses, ■ Breeders Awards ■ Canadian Bred Stakes attracting new horse owners, building a fan base and connecting the industry with ■ Ontario Bred Purse Bonus ■ Ontario Sires Stakes government and the general public. ■ Ontario Bred Restricted ■ Fort Erie Program Ontario Racing serves as the voice of the horse racing industry and work closely Stakes Racing ■ Sales Stakes Program with the Ontario Lottery and Gaming Corporation (OLG) towards the integration of ■ Stallion Awards ■ Mare Purchase Program horse racing into OLG’s gaming strategy. Information and all required Program application forms are available for viewing WHO RECEIVES BENEFITS FROM THE PROGRAM? and download at www.ontarioracing.com. ■ Breeders and Owners of REGISTERED ONTARIO BREDS and ONTARIO RACING ONTARIO SIRED progeny Thoroughbred Improvement Program ■ Owners of ONTARIO SIRES 555 Rexdale Boulevard, PO Box 156 Toronto, ON M9W 5L2 HOW TO PARTICIPATE - STALLION OWNERS Telephone: 416-675-3993 ex 2633 | Fax: 416-213-2104 Stallion Owners must register their stallion by January 15th each year (or post Email: [email protected] marked by January 15th) in order for the horse to be recognized as an ONTARIO SIRE.
    [Show full text]