DOCSLIB.ORG

Cob Alg Cont 9.Pdf

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Cob Alg Cont 9.Pdf Acta Botánica Malacitana, 9: 27 - 40 Málaga, 1984 CATALOGO DE LAS ALGAS CONTINENTALES ESPAÑOLAS. II. CRASPEDOPHYCEAE, CRYPTOPHYCEAE, CHRYSOPHYCEAE, DINOPHYCEAE, EUGLENOPHYCEAE, HAPTOPHYCEAE, PHAEOPHYCEAE, RHODOPHYCEAE, XANTHOPHYCEAE M. ALVAREZ COBELAS a Ramón Margalef López RESUMEN: En este trabajo se mencionan las algas de agua dulce encontradas en España hasta julio de 1981 pertenecientes alas siguientes grupos (entre paréntesis, el número de táxones encontrados): Craspedophyceae (3), Cryptophyceae (20), Chrysophyceae (87), Dinophyceae (69), Euglenophyceae (116), Haptophyceae (9), Phaeophyceae (1), Rhodophyceae (20), Xanthophyceae (106). SUMMARY: A catalogue of Spanish freshwater algae belonging to the Classes listed below and found up to July 1981 is given. The Classes are the following (taza in brackets): Craspedo- phyceae (3), Cryptophyceae (20), Chrysophyceae (87), Dinophyceae (69), Euglenophyceae (116), Haptophyceae (9), Phaeophyceae (1), Rhodophyceae (20), Xanthophyceae (106). INTRODUCC ION El presente trabajo pretende continuar el listado de las algas de agua dulce citadas o descritas a partir de material espariol en un intento de animar al estudio de las mismas. Ya se han publicado la bibliografía sobre la que se basa (Alvarez Cobelas, 1981) y la parte dedicada a las Diatomeas (Alvarez Cobelas & Estévez, 1982). Queremos insistir en el hecho de que estos estudios se han lle- vado a cabo sobre material escrito y no sobre herbarios, casi inexis- tentes, y que sólo abarcan las publicaciones encontradas hasta julio de 1981; más adelante se confeccionarán suplementos con las incorpo- raciones posteriores a dicha fecha. Los grupos de algas incluidos en este trabajo se han ordenado en Clases y Familias siguiendo las obras de Bourrelly (1968 y 1970) y Silva (1980). Para la revisión se han consultado, además del ING (1979), las publicaciones siguientes: Cryptophyceae: Anton & Duthie (1981), Hüber-Pestalozzi (1950) y Ja- vorniciq (1976). 27 M. ALVAREZ COBELAS Chrysophyceae: Bourrelly (1951 y 1957), Ettl (1965), Fiatte & Joyon (1965), Harris & Bradley (1960), Hilliard (1966), HUber-Pestalozzi(1941) Silva (1960). Dinophyceae: Christen (1961), HUber-Pestalozzi (1950). Euglenophyceae: Balech (1944), Godgics (1953), HUber-Pestalozzi(1954), Pringsheim (1952 y 1956). Rhodophyceae: Belcher & Swale (1960), Hamel (1925), Israelson (1942), Kylin (1956), Ott (1973), Povoa dos Reis (1958-1973), Skuja (1938), de Toni (1900). Xanthophyceae: Ettl (1978), Hibberd & Leedale (1971), Kovácik (1975), Pascher (1939), Rieth (1980), Venkataraman (1962). CATALOGO CRASPEDOPHYCEAE Chadefaud ex P.C. Silva CRASPEDOPHYCALES CODOSIGACEAE SALPINGOECACEAE Monosiga varians Skuja Salpingoeca freguentissima (Zach.) Lemm. PHALANSTERIACEAE Phalansterium consociatum (Frey.) Cienk. Fritsch CRYPTOMONADALES CRYPTOMONADACEAE Rhodomonas lacustris Pascher et Ruttner Cryptomonas compressa Pascher var. nannoplanctonica (Skw.) Javornicki Cryptomonas curvata [hr. Rhodomonas lens Pascher et Ruttner Cryptomonas erosa Ehr. CYCHOMONADACEAR var. reflexa Marsson Cyathomonas truncata (Fres.) Fisch Cryptomonas gracilis Skuja HENISELMIDACEAE Cryptomonas lucens Skuja Planonephros parvula (Pascher) Christensen Cryptomonas marssonii Skuja KATABLEPHARIDACEAE Cryptomonas ovata [hr. Katablepharis ovalis Skuja Cryptomonas phaseolus Skuja PLEUROMASTIGACEAE Cryptomonas reflexa Skuja Pleuromastix bacillifera Scherffel Chilomonas paramecium [hr. Chroomonas acuta UtermUhl Chroomonas nordstedtii Hansgirg DUDOSAS PARA ESPAÑA: Chroomonas baltica (1), Chroomonas coerulea (Geitler) Skuja (I), Chroo- monas dispersa (1), Chroomonas nordstedtii Hansgirg fm. minor Nygaard (1), Chroomonas rosen- bergae Hüber-Pestalozzi (1), Chroomonas salina (1). SINONIMIAS: Cryptomonas pusilla Bachmann = Rhodomonas lacustris Pascher et Ruttner. Chroomo- nas minuta Skuja = Rhodomonas lacustris Pander et Ruttner. Rhodomonas minuta Skuja = Rhod e- monas lacustris Pascher et Ruttner. Rhodomonas minuta var. nannoplanctonica Skuja = Rhodomo- nas lacustris var. nannoplanctonica (Skw.) Javornicki. 28 Algas continentales espaRolas CHRYSOPHYCEAE Fritsch CHRYSOTHALLALES CHRYSOTHALLACEAE Phaeoplaca thallosa Chodat CHROMUL INALES CHROMULINACEAE Chrysopyxis adscendens Wislouch Chromulina dalecarlica Skuja Chrysopyxis bipes Stein Chromulina elegans Dofl. Chrysopyxis stenostoma Lauterborn Chromulina mikroplankton Pascher Kephyrion cupuliforme Conrad Chromulina minima Dofl. Kephyrion doliolum Conrad Chromulina ovalis Klebs Kephyrion hemisphaericum (Lack.) Conrad Chromulina parvula Conrad Kephyrion moniliferum (G.Schmid) Bourr. Chromulina rosanoffi (Wor.) BUtschli Kephyrion ovum Pascher Chromulina sphaerica Bachmann Kephyrion rubri—claustri Conrad Chromulina vestita Schiller Kephyrion sitta Pascher CHRYSOMOEBACEAE Kephyrion spirale (Lack.) Conrad Chrysostephanosphaera splendens Margalef CHRYSOSPHAERACEAE CHRYSOCOCCACEAE Chrysosphaera nitellae (Geitler) Bourr. Bicoeca planctonica Kiss HYDRURACEAE var. multiannulata (Skuja) Bourr. Hydrurus foetidus (Vaucher) Kirchner Chrysococcus biporus Skuja Fn. irregularis (2) Chrysococcus minutus (Fritsch) NUg. PEDINELLACEAE Chrysococcus punctiformis Pascher Pseudopedinella erkensis Skuja Chrysococcus rufescens Klebs Chrysococcus tesselatus (Fritsch) Nygaard OCHROMONADALES DINOBRYACEAE Pseudokephyrion ellipsoideum (Pascher) G. Schmid Chrysoikos skujae (Nauw.) Willen (3) Pseudokephyrion entzii Conrad Chrysolykos planctonicus Mack Fn. granulata Bourr. Dinobryon acuminatum Ruttner Pseudokephyrion ovum (Pascher et Dinnbryon bavaricum Imhof Ruttner) G. Schmid var. medium (Leon.) Krieger Pseudokephyrion ruttneri (Schiller) Conrad Dinobryon cylindricum Imhof Stokesiella cavanillesiana Gonzalez Guerrero var. alpinum (Imhof) Bachmann Stylochrysallis aurea (Chodat) Bachmann Dinobryon divergens Imhof Stylopyxis (4) var. angulatum (Sel.) Brunn. MALLOMONADACEAE var. schauinslandii (Lemm.) Bruno. Mallomonas acaroides Perty Dinobryon sertularia [hr. Mallomonas akrokomos Ruttner Dinobryon sociale [hr. Mallomonas caudata Iwanoff Dinobryon suecicum Lemm. Mallomonas coronata Bol. var. longispinum Lemm. Mallomonas elegans Lemm. Dinobryon utriculus (Ehr.) blebs Mallomonas elliptica (Kiss.) Conrad var. acutum Schiller Mallomonas marjorensis Skuja Epipyxis lauterbornii (Lenin.) Hilliard Mallomonas pulcherrima (Stokes) Lenin. et Asmund Mallomonas tonsurata Teiling Epipyxis ramosum (Lauterborn) Hilliard Synura echinulata Korssch. et Asmund Synura uvella em. Korssch. Pseudokephyrion conicum Schiller 29 M. ALVAREZ COBELAS OCHROMONADACEAE Ochromonas pallida Korssch. Anthophysa vegetans (D.F. Milner) Ochromonas perlata Dofl. Erkenia subaequiciliata Skuja Ochromonas polychrisis Skuja Ochromonas fragilis Dofl. Spumella vulgaris Cienk. (6) Ochromonas minuscula Conrad Uroglena americana Calkins Ochromonas nanus (5) Uroglena volvox Ehr. RHIZOCHRYSIDALES STYLOCOCCACEAE Lagynion ampullaceum (Stokes) Pascher Bitrichia chodati (Reverdin) Chodat Lagynion macrotrachelum (Stokes) Pascher Bitrichia ollula Fott Lagynion triangularis (Stokes) Pascher ST ICHOGLOEALES STICHOGLOEACEAE Stichogloea doederleinii (Schmidle) Wille DUDOSAS PARA ESPAÑA: Chrysocapsa planctonica (West et West) Pascher (7), Chrysococcus rufes- cens var. compressa Skuja (8), Kephyrion littorale Lund (9), Uroglena irregularis Skuja (7). SINONIMIAS: Bicoeca multiannulata Skuja = Bicoeca planctonica Kiss, var. •ultiannulata (Skw.) Bourr. Diceras Reverdin 1917 = Bitrichia Woloszynska 1914. Dinobryon hispanicum Bachmann Dinobryum divergens var. schauinslandii (Lamm.) Brunn. Dinobryon sertularia var. thyrsoi- deum Chodat = Dinobryon sertularia [hr. Epichrysis Pascher 1925 = Chrysosphaera Pascher 1914. Epipyxis utriculus [hr. = Dinobryon utriculus (Ehr.) Klebs. Hyalobryon Lauterborn 1896 - Epipyxis Ehr. 1838. Kephyriopsis Pascher et Buttner 1913 = Pseudokephyrion Pascher 1913. Monas [hr. 1835 pro parte = Spumella Cienk. 1870. Stenocalyx Schiller 1926 = Kephyrion Pas- cher 1911. DINOPHYCEAE Fritsch D I NOCOCCALES GLOEODINIACEAE Cystodinium unicorne Klebs Gloeodinium montanum Klebs Stylodinium cerasiforme Pascher PHYTODINIACEAE Stylodinium globosum Klebs Cystodinium cornifax (Schilling) Klebs Tetradinium intermedium Geitler Cystodinium steinii Klebs CERATIACEAE fm. robustum (Amberg) Bachmann Ceratium hirudinella (0.F.Müller) DINOSPHAERACEAE Schrank Diplopsalis acuta Entz Fm. austriacum (Zeder.)Bachmann Diplopsalis lenticula Bergh Fm. carinthiacum (Zeder.) Bachmann Fm. minor Paulsen Fm. furcoides Schroeder GLENODINIACEAE Fm. gracile Bachmann Glenodinium dybowskii (Wolosz.) Lindemann Fm. piburgense (Zederb.) Bachmann Glenodinium foliaceum Stein 30 Algas continentales espafiolas GONIAULACACEAE Peridinium cunniphormi (11) Gonyaulax apiculata (Penard) Entz Fil. Peridinium deflandrei Lefv. GYMNODINIACEAE Peridinium godlewskii Wolosz. Gymnodinium albulum Lindemann Peridinium gutwinskii Wolsz. Gymnodinium ordinatum Skuja Peridinium inconspicuum Lemm. Gymnodinium rotundatum Klebs (10) tab. conjunctum Lefv. Gymnodinium uberrimum (Allman) Fm. armatum (Lema.) Lefv. Kofoid et Sweezy tab. contactum (Lindemann) Lefv. fm. Gymnodinium varians Maskell spiniferum (Lindemann) Lefv. Katodinium tetragonops (Harris) Fott tab. remotum Lefv. HEMIDINIACEAE Peridinium Tominckii Molosz. Hemidinium nasutum Stein Peridinium lubieniense Wolosz. var. tatricum Wolosz. Peridinium minimum Schiller (12) PERIDINIACEAF Peridinium palatinum Lauterborn Peridiniopsis borgei Lens. Peridinium palustre (Lindemann) Lefv . Peridiniopsis cunningtonii (Lemm.) fm. Peridinium pusillum (Penard) Lemm. quinquecuspidata (Massart)
Load more

Recommended publications
  • University of Oklahoma
    UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements for the Degree of DOCTOR OF PHILOSOPHY By JOSHUA THOMAS COOPER Norman, Oklahoma 2017 MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Boris Wawrik, Chair ______________________________ Dr. J. Phil Gibson ______________________________ Dr. Anne K. Dunn ______________________________ Dr. John Paul Masly ______________________________ Dr. K. David Hambright ii © Copyright by JOSHUA THOMAS COOPER 2017 All Rights Reserved. iii Acknowledgments I would like to thank my two advisors Dr. Boris Wawrik and Dr. J. Phil Gibson for helping me become a better scientist and better educator. I would also like to thank my committee members Dr. Anne K. Dunn, Dr. K. David Hambright, and Dr. J.P. Masly for providing valuable inputs that lead me to carefully consider my research questions. I would also like to thank Dr. J.P. Masly for the opportunity to coauthor a book chapter on the speciation of diatoms. It is still such a privilege that you believed in me and my crazy diatom ideas to form a concise chapter in addition to learn your style of writing has been a benefit to my professional development. I’m also thankful for my first undergraduate research mentor, Dr. Miriam Steinitz-Kannan, now retired from Northern Kentucky University, who was the first to show the amazing wonders of pond scum. Who knew that studying diatoms and algae as an undergraduate would lead me all the way to a Ph.D.
    [Show full text]
  • Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016
    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016 April 1981 Revised, May 1982 2nd revision, April 1983 3rd revision, December 1999 4th revision, May 2011 Prepared for U.S. Department of Commerce Ohio Department of Natural Resources National Oceanic and Atmospheric Administration Division of Wildlife Office of Ocean and Coastal Resource Management 2045 Morse Road, Bldg. G Estuarine Reserves Division Columbus, Ohio 1305 East West Highway 43229-6693 Silver Spring, MD 20910 This management plan has been developed in accordance with NOAA regulations, including all provisions for public involvement. It is consistent with the congressional intent of Section 315 of the Coastal Zone Management Act of 1972, as amended, and the provisions of the Ohio Coastal Management Program. OWC NERR Management Plan, 2011 - 2016 Acknowledgements This management plan was prepared by the staff and Advisory Council of the Old Woman Creek National Estuarine Research Reserve (OWC NERR), in collaboration with the Ohio Department of Natural Resources-Division of Wildlife. Participants in the planning process included: Manager, Frank Lopez; Research Coordinator, Dr. David Klarer; Coastal Training Program Coordinator, Heather Elmer; Education Coordinator, Ann Keefe; Education Specialist Phoebe Van Zoest; and Office Assistant, Gloria Pasterak. Other Reserve staff including Dick Boyer and Marje Bernhardt contributed their expertise to numerous planning meetings. The Reserve is grateful for the input and recommendations provided by members of the Old Woman Creek NERR Advisory Council. The Reserve is appreciative of the review, guidance, and council of Division of Wildlife Executive Administrator Dave Scott and the mapping expertise of Keith Lott and the late Steve Barry.
    [Show full text]
  • The Plankton Lifeform Extraction Tool: a Digital Tool to Increase The
    Discussions https://doi.org/10.5194/essd-2021-171 Earth System Preprint. Discussion started: 21 July 2021 Science c Author(s) 2021. CC BY 4.0 License. Open Access Open Data The Plankton Lifeform Extraction Tool: A digital tool to increase the discoverability and usability of plankton time-series data Clare Ostle1*, Kevin Paxman1, Carolyn A. Graves2, Mathew Arnold1, Felipe Artigas3, Angus Atkinson4, Anaïs Aubert5, Malcolm Baptie6, Beth Bear7, Jacob Bedford8, Michael Best9, Eileen 5 Bresnan10, Rachel Brittain1, Derek Broughton1, Alexandre Budria5,11, Kathryn Cook12, Michelle Devlin7, George Graham1, Nick Halliday1, Pierre Hélaouët1, Marie Johansen13, David G. Johns1, Dan Lear1, Margarita Machairopoulou10, April McKinney14, Adam Mellor14, Alex Milligan7, Sophie Pitois7, Isabelle Rombouts5, Cordula Scherer15, Paul Tett16, Claire Widdicombe4, and Abigail McQuatters-Gollop8 1 10 The Marine Biological Association (MBA), The Laboratory, Citadel Hill, Plymouth, PL1 2PB, UK. 2 Centre for Environment Fisheries and Aquacu∑lture Science (Cefas), Weymouth, UK. 3 Université du Littoral Côte d’Opale, Université de Lille, CNRS UMR 8187 LOG, Laboratoire d’Océanologie et de Géosciences, Wimereux, France. 4 Plymouth Marine Laboratory, Prospect Place, Plymouth, PL1 3DH, UK. 5 15 Muséum National d’Histoire Naturelle (MNHN), CRESCO, 38 UMS Patrinat, Dinard, France. 6 Scottish Environment Protection Agency, Angus Smith Building, Maxim 6, Parklands Avenue, Eurocentral, Holytown, North Lanarkshire ML1 4WQ, UK. 7 Centre for Environment Fisheries and Aquaculture Science (Cefas), Lowestoft, UK. 8 Marine Conservation Research Group, University of Plymouth, Drake Circus, Plymouth, PL4 8AA, UK. 9 20 The Environment Agency, Kingfisher House, Goldhay Way, Peterborough, PE4 6HL, UK. 10 Marine Scotland Science, Marine Laboratory, 375 Victoria Road, Aberdeen, AB11 9DB, UK.
    [Show full text]
  • Plant Life Magill’S Encyclopedia of Science
    MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE Volume 4 Sustainable Forestry–Zygomycetes Indexes Editor Bryan D. Ness, Ph.D. Pacific Union College, Department of Biology Project Editor Christina J. Moose Salem Press, Inc. Pasadena, California Hackensack, New Jersey Editor in Chief: Dawn P. Dawson Managing Editor: Christina J. Moose Photograph Editor: Philip Bader Manuscript Editor: Elizabeth Ferry Slocum Production Editor: Joyce I. Buchea Assistant Editor: Andrea E. Miller Page Design and Graphics: James Hutson Research Supervisor: Jeffry Jensen Layout: William Zimmerman Acquisitions Editor: Mark Rehn Illustrator: Kimberly L. Dawson Kurnizki Copyright © 2003, by Salem Press, Inc. All rights in this book are reserved. No part of this work may be used or reproduced in any manner what- soever or transmitted in any form or by any means, electronic or mechanical, including photocopy,recording, or any information storage and retrieval system, without written permission from the copyright owner except in the case of brief quotations embodied in critical articles and reviews. For information address the publisher, Salem Press, Inc., P.O. Box 50062, Pasadena, California 91115. Some of the updated and revised essays in this work originally appeared in Magill’s Survey of Science: Life Science (1991), Magill’s Survey of Science: Life Science, Supplement (1998), Natural Resources (1998), Encyclopedia of Genetics (1999), Encyclopedia of Environmental Issues (2000), World Geography (2001), and Earth Science (2001). ∞ The paper used in these volumes conforms to the American National Standard for Permanence of Paper for Printed Library Materials, Z39.48-1992 (R1997). Library of Congress Cataloging-in-Publication Data Magill’s encyclopedia of science : plant life / edited by Bryan D.
    [Show full text]
  • Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes
    LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + +
    [Show full text]
  • Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea
    Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I.
    [Show full text]
  • New Records for the Turkish Freshwater Algal Flora
    Turkish Journal of Water Science & Management Research Article ISSN: 2536 474X / e-ISSN: 2564-7334 Setting Measures for TacklingVolume: 5 Issue: Agricultural 2 Year: 2021 Diffuse Pollution of Küçük Menderes Basin ResearchKüçük Article Menderes Havzası’nda Tarımsal Kaynaklı Yayılı Kirlilikle New Records Mücadelefor the Turkish Tedbirlerinin Freshwater Belirlenmesi Algal Flora in Twenty Five River Basins of Turkey, Part IV: Ochrophyta Ayşegül Tanık1, Asude Hanedar*2, Emine Girgin3, Elçin Güneş2, Erdem Görgün1,3, Nusret Karakaya4, Gökçen Gökdereli5, Burhan Fuat Çankaya 5, Taner Kimence5, Yakup Karaaslan5 1Türkiye’dekiİstanbul Technical University25 Nehir (ITU), Havzasından Faculty of Civil Engineering, Türkiye DepartmentTatlı Su of Alg Environmental Florası İçin YeniEngineering, Kayıtlar, 34469, BölümMaslak-Istanbul/TURKEY IV: Ochrophyta [email protected] (0000-0002-0319-0298) 2 Namk Kemal University,1 Çorlu 2Faculty of Engineeri3 ng, Department of Environmental4 Engineering,5 Nilsun Demir , Burak Öterler , 59860Haşim Çorlu-Sömek Tekirda, Tuğbağ /TurkeyOngun Sevindik *, Elif Neyran Soylu , 6 6 7 1 8 [email protected] Karaaslan , Tolga (0000-0003-4 Çetin , Abuzer827-5954), Çelekli [email protected], Tolga Coşkun , Cüneyt (0000-0002-1457-1504) Nadir Solak , Faruk 3io EnvironmentalMaraşlioğlu Solutions,9, Murat Re şParlakitpaşa1 ,Mah., Merve Katar Koca Cd.1, Doğan Ar Teknokent Can Manavoğlu 1 2/5 D:2 12, 34469 1Ankara University, Faculty of Agriculture,Saryerİstanbul/Turkey Fisheries and Aquaculture Engineering, 06120, [email protected],
    [Show full text]
  • HIGH-THROUGHPUT SEQUENCING REVEALS UNEXPECTED PHYTOPLANKTON PREY of an ESTUARINE COPEPOD a Thesis Submitted to the Faculty of Sa
    HIGH-THROUGHPUT SEQUENCING REVEALS UNEXPECTED PHYTOPLANKTON PREY OF AN ESTUARINE COPEPOD A Thesis submitted to the faculty of San Francisco State University In partial fulfillment of z o l i the requirements for OL the Degree • Hk ^ Master of Science In Biology: Ecology, Evolution, and Conservation Biology by Ann Elisabeth Holmes San Francisco, California Copyright by Ann Elisabeth Holmes 2018 CERTIFICATION OF APPROVAL I certify that I have read High-throughput sequencing reveals unexpected phytoplankton prey of an estuarine copepod by Ann Elisabeth Holmes, and that in my opinion this work meets the criteria for approving a thesis submitted in partial fulfillment of the requirement for the degree Master of Science in Biology: Ecology, Evolution and Conservation Biology at San Francisco State University. Wim Kimmerer, PhD Professor Jopathon Stillman, PhD Professor Andrea Swei, PhD Assistant Professor HIGH-THROUGHPUT SEQUENCING REVEALS UNEXPECTED PHYTOPLANKTON PREY OF AN ESTUARINE COPEPOD Ann Elisabeth Holmes San Francisco, California 2018 Selective feeding by copepods has important ecological implications such as food web length, nutrient limitation, and control of algal blooms. Traditional methods for investigating copepod feeding in natural waters (e.g. stable isotope and fatty acid tracers or microdissection) have low taxonomic specificity or significant biases. We used high- throughput genetic sequencing (HTS) to identify in situ the phytoplankton prey of Pseudodiaptomus forbesi (Copepoda: Calanoida) in the San Francisco Estuary. Amplicons of the 16s rRNA gene were sequenced on an Illumina MiSeq. Cyanobacteria were the most frequently detected prey taxon, a result not predicted due to expected low nutritional value. In contrast, prey taxa expected to have high nutritional value for copepods (diatoms and cryptophytes) were not detected as frequently as anticipated based on the expectations generated using traditional approaches.
    [Show full text]
  • Isolation and Physiological Characterization of a Novel Virus Infecting Stephanopyxis Palmeriana (Bacillariophyta)
    Note Algae 2015, 30(2): 81-87 http://dx.doi.org/10.4490/algae.2015.30.2.081 Open Access Isolation and physiological characterization of a novel virus infecting Stephanopyxis palmeriana (Bacillariophyta) JinJoo Kim1, Seok-Hyun Yoon1 and Tae-Jin Choi2,* 1Fishery and Ocean Information Division, National Fisheries Research & Development Institute, Busan 619-705, Korea 2Department of Microbiology, Pukyong National University, Busan 608-737, Korea Recent studies have shown the importance of viruses as potential sources of plankton mortality, which affect primary production and biogeochemical functions of their hosts. Here, we report basic characteristics of a novel virus (Stepha- nopyxis palmeriana virus: SpalV) that causes lysis of a culture of the diatom S. palmeriana, which was isolated in Jaran Bay, Korea, in August 2008. SpalV is a round-shaped viral particle ~25-30 nm in diameter that propagates in its host’s cytoplasm. In addition, it shows species-specific infectivity among the tested diatom species. The burst size and latent period are estimated to be roughly 92 infectious units cell-1 and <80 h, respectively. Key Words: algal virus; Bacillariophyceae; Stephanopyxis palmeriana INTRODUCTION Seawater contains diverse organisms and viruses that (Smetacek 1999). Therefore, lysis of these species by virus infect their host, with ~105-109 virus particles in 1 mL of infection can reduce primary production. For example, seawater (Suttle et al. 1990, Suttle 2007). The majority of the inoculation of phytoplankton communities of several these viruses infect bacteria, cyanobacteria, archaea, and major algal species with viral concentrates from seawater other eukaryotic organisms, but some of these viruses in- reduced primary production by as much as 78% (Suttle et fect macro- or microalgae.
    [Show full text]
  • Bangor University DOCTOR of PHILOSOPHY
    Bangor University DOCTOR OF PHILOSOPHY Studies on micro algal fine-structure, taxonomy and systematics : cryptophyceae and bacillariophyceae. Novarino, Gianfranco Award date: 1990 Link to publication General rights Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal ? Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Download date: 02. Oct. 2021 Studies on microalgal fine-structure, taxonomy, and systematics: Cryptopbyceae and Bacillariopbyceae In Two Volumes Volume I (Text) ,, ý,ý *-ýýI Twl by Gianfranco Novarino, Dottore in Scienze Biologiche (Rom) A Thesis submitted to the University of Wales in candidature for the degree of Philosophiae Doctor University of Wales (Bangor) School of Ocean Sciences Marine Science Laboratories Menai Bridge, Isle of Anglesey, United Kingdom December 1990 Lýýic. JýýVt. BEST COPY AVAILABLE Acknowledge mehts Dr I. A. N. Lucas, who supervised this work, kindly provided his helpful guidance, sharing his knowledge and expertise with patience and concern, critically reading the manuscripts of papers on the Cryptophyceae, and supplying many starter cultures of the strains studied here.
    [Show full text]
  • Nanoplankton Protists from the Western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)*
    sm69n1047 4/3/05 20:30 Página 47 SCI. MAR., 69 (1): 47-74 SCIENTIA MARINA 2005 Nanoplankton protists from the western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)* GIANFRANCO NOVARINO Department of Zoology, The Natural History Museum, Cromwell Road, London SW7 5BD, U.K. E-mail: [email protected] SUMMARY: This paper is an electron microscopical account of cryptomonad flagellates (Cryptophyceae = Cryptomon- adea) in the plankton of the western Mediterranean Sea. Bottle samples collected during the spring-summer of 1998 in the Sea of Alboran and Barcelona coastal waters contained a total of eleven photosynthetic species: Chroomonas (sensu aucto- rum) sp., Cryptochloris sp., 3 species of Hemiselmis, 3 species of Plagioselmis including Plagioselmis nordica stat. nov/sp. nov., Rhinomonas reticulata (Lucas) Novarino, Teleaulax acuta (Butcher) Hill, and Teleaulax amphioxeia (Conrad) Hill. Identification was based largely on cell surface features, as revealed by scanning electron microscopy (SEM). Cells were either dispersed in the water-column or associated with suspended particulate matter (SPM). Plagioselmis prolonga was the most common species both in the water-column and in association with SPM, suggesting that it might be a key primary pro- ducer of carbon. Taxonomic keys are given based on SEM. Key words: Cryptomonadea, cryptomonads, Cryptophyceae, flagellates, nanoplankton, taxonomy, ultrastructure. RESUMEN: PROTISTAS NANOPLANCTÓNICOS DEL MAR MEDITERRANEO NOROCCIDENTAL II. CRYPTOMONADALES (CRYPTOPHY- CEAE = CRYPTOMONADEA). – Este estudio describe a los flagelados cryptomonadales (Cryptophyceae = Cryptomonadea) planctónicos del Mar Mediterraneo Noroccidental mediante microscopia electrónica. La muestras recogidas en botellas durante la primavera-verano de 1998 en el Mar de Alboran y en aguas costeras de Barcelona, contenian un total de 11 espe- cies fotosintéticas: Chroomonas (sensu auctorum) sp., Cryptochloris sp., 3 especies de Hemiselmis, 3 especies de Plagio- selmis incluyendo Plagioselmis nordica stat.
    [Show full text]
  • (12) United States Patent (10) Patent No.: US 7.256,023 B2 Metz Et Al
    US007256023B2 (12) United States Patent (10) Patent No.: US 7.256,023 B2 Metz et al. (45) Date of Patent: Aug. 14, 2007 (54) PUFA POLYKETIDE SYNTHASE SYSTEMS (58) Field of Classification Search ..................... None AND USES THEREOF See application file for complete search history. (75) Inventors: James G. Metz, Longmont, CO (US); (56) References Cited James H. Flatt, Longmont, CO (US); U.S. PATENT DOCUMENTS Jerry M. Kuner, Longmont, CO (US); William R. Barclay, Boulder, CO (US) 5,130,242 A 7/1992 Barclay et al. 5,246,841 A 9, 1993 Yazawa et al. ............. 435.134 (73) Assignee: Martek Biosciences Corporation, 5,639,790 A 6/1997 Voelker et al. ............. 514/552 Columbia, MD (US) 5,672.491 A 9, 1997 Khosla et al. .............. 435,148 (*) Notice: Subject to any disclaimer, the term of this (Continued) patent is extended or adjusted under 35 U.S.C. 154(b) by 347 days. FOREIGN PATENT DOCUMENTS EP O823475 A1 2, 1998 (21) Appl. No.: 11/087,085 (22) Filed: Mar. 21, 2005 (Continued) OTHER PUBLICATIONS (65) Prior Publication Data Abbadi et al., Eur: J. Lipid Sci. Technol. 103: 106-113 (2001). US 2005/0273884 A1 Dec. 8, 2005 (Continued) Related U.S. Application Data Primary Examiner Nashaat T. Nashed (63) Continuation of application No. 10/124,800, filed on (74) Attorney, Agent, or Firm—Sheridan Ross P.C. Apr. 16, 2002, which is a continuation-in-part of application No. 09/231,899, filed on Jan. 14, 1999, (57) ABSTRACT now Pat. No. 6,566,583. (60) Provisional application No. 60/284,066, filed on Apr.
    [Show full text]