PIN1 antibody - N-terminal region (ARP63256_P050) Data Sheet
Product Number ARP63256_P050 Product Name PIN1 antibody - N-terminal region (ARP63256_P050) Size 50ug Gene Symbol PIN1 Alias Symbols DOD; UBL5 Nucleotide Accession# NM_006221 Protein Size (# AA) 163 amino acids Molecular Weight 18kDa Product Format Lyophilized powder NCBI Gene Id 5300 Host Rabbit Clonality Polyclonal Official Gene Full Name Peptidylprolyl cis/trans isomerase, NIMA-interacting 1 This is a rabbit polyclonal antibody against PIN1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: RPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEA Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation Description of Target catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene. CCND1,CDC27,PKMYT1,PLK1,RAF1,TP73,TP73,APP,BCL2,CCNB1,CCNE1,CDC25C,CDC27,CDK1,CDK 9,CHPF,CSNK2A1,CSNK2A2,CSNK2B,CTNNB1,DAB2,DDX24,FASLG,GGA2,GPAA1,GPHN,JUN,KIF20B, KLHL20,LEPR,MAPT,MDFI,MTFR1,NCOA3,NEK6,NFATC2,NONO,PKMYT1,PLK1,POLR2A,PTOV1,PTPN1, RAB4A,RAF1,RAI1,RBBP8,RBPMS,RELA,RPS6KB1,SOCS3,SREK1,STIL,SUPT5H,TOP2A,TP53,TRAF2,T SC22D4,UBB,UBQLN4,ZCCHC10,ZMIZ2,ADARB1,AP2A1,BCL2,BCLAF1,CAPRIN1,CCNK,CDC25C,CDC2 Partner Proteins 7,CDK11A,CDK11B,CDK12,CHAMP1,CSNK2A1,CSNK2A2,CTNNB1,DAB2,DDB1,DDX17,DDX24,DDX3X, DDX5,DHX15,EFTUD2,ETV6,FOXO4,G3BP1,G3BP2,GGA2,GPAA1,HADHA,HNRNPC,HNRNPH1,HNRNPK ,HNRNPU,JUN,KIAA1429,KIF20B,KLHL20,LEPR,MAP1S,MAPT,MCL1,MDFI,MED1,MYT1,NFATC2,NONO,P ABPC1,PKM2,PKMYT1,PLK1,POLR2A,PRPF8,PRRC1,PTOV1,RAB4A,RAI1,RARA,RBBP8,RBPMS,REPS1 ,RNPS1,RPL4,SFPQ,SMAD2,SMAD3,SNRNP200,SOCS3,SRRM1,SRRM2,SRSF11,SUPT5H,TBC1D4,TFG, THRAP3,TLE3,TOP2A,TP53,TRAF2,TSC22D4,TUT1,U2AF2,UBC,VHL,WEE1,WRNIP1,XRCC6,ZCCHC10,Z MIZ2,pkmyt1,sox3,ventx2.1-b,wee1B Reconstitution and Add 50 ul of distilled water. Final anti-PIN1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-PIN1 antibody is Catalog # AAP63256 Swissprot Id Q13526 Protein Name Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Sample Type Confirmation PIN1 is supported by BioGPS gene expression data to be expressed in Jurkat Protein Accession # NP_006212 Purification Affinity Purified Species Reactivity Rat, Dog, Pig, Horse, Guinea pig, Human, Mouse, Bovine, Zebrafish, Yeast
Application WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 85% Sequence Human Jurkat
WB Suggested Anti-PIN1 Antibody Titration: 1.0 ug/ml Positive Control: Jurkat Whole Cell Image 1 PIN1 is supported by BioGPS gene expression data to be expressed in Jurkat
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.