DOCSLIB.ORG

Global Journal of Human Social Science of the Xixth Century – Beginning of the Xxth Century) a Achievements – Landmarks, Choices – Crossroads

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Global Journal of Human Social Science of the Xixth Century – Beginning of the Xxth Century) a Achievements – Landmarks, Choices – Crossroads Online ISSN : 2249-460X Print ISSN : 0975-587X Transit Programme in Nigeria The Political Economy Petroleum Subsidy Intervention Legal Challenges to Election VOLUME 14 ISSUE 1 VERSION 1.0 Global Journal of Human-Social Science: F Political Science Global Journal of Human-Social Science: F Political Science Volume 14 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society Social Sciences. 2014. Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG 301st Edgewater Place Suite, 100 Edgewater Dr.-Pl, XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ Wakefield MASSACHUSETTS, Pin: 01880, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free Fax: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ Global Journals Incorporated SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG Packaging & Continental Dispatching 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG Global Journals QRZDUUDQW\RUILWQHVVLVLPSOLHG E- 3130 Sudama Nagar, Near Gopur Square, (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ Indore, M.P., Pin:452009, India ULVN 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG Find a correspondence nodal officer near you FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU To find nodal officer of your country, please ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI eContacts DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH Press Inquiries: [email protected] ERXQGE\WKHWHUPVWKHUHRI Investor Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO Technical Support: [email protected] DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Media & Releases: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Pricing (Including by Air Parcel Charges): Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 For Authors: Employer Identification Number (EIN): 22 USD (B/W) & 50 USD (Color) USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional): 200 USD (B/W) & 250 USD (Color) Integrated Editorial Board (Computer Science, Engineering, Medical, Management, Natural Science, Social Science) John A. Hamilton,"Drew" Jr., Dr. Wenying Feng Ph.D., Professor, Management Professor, Department of Computing & Computer Science and Software Information Systems Engineering Department of Mathematics Director, Information Assurance Trent University, Peterborough, Laboratory ON Canada K9J 7B8 Auburn University Dr. Thomas Wischgoll Dr. Henry Hexmoor Computer Science and Engineering, IEEE senior member since 2004 Wright State University, Dayton, Ohio Ph.D. Computer Science, University at B.S., M.S., Ph.D. Buffalo (University of Kaiserslautern) Department of Computer Science Southern Illinois University at Carbondale Dr. Abdurrahman Arslanyilmaz Dr. Osman Balci, Professor Computer Science & Information Systems Department of Computer Science Department Virginia Tech, Virginia University Youngstown State University Ph.D.and M.S.Syracuse University, Ph.D., Texas A&M University Syracuse, New York University of Missouri, Columbia M.S. and B.S. Bogazici University, Gazi University, Turkey Istanbul, Turkey Dr. Xiaohong He Professor of International Business Yogita Bajpai University of Quinnipiac M.Sc. (Computer Science), FICCT BS, Jilin Institute of Technology; MA, MS, U.S.A.Email: PhD,. (University of Texas-Dallas) [email protected] Burcin Becerik-Gerber Dr. T. David A. Forbes University of Southern California Associate Professor and Range Ph.D. in Civil Engineering Nutritionist DDes from Harvard University Ph.D. Edinburgh University - Animal M.S. from University of California, Berkeley Nutrition & Istanbul University M.S. Aberdeen University - Animal Nutrition B.A. University of Dublin- Zoology Dr. Bart Lambrecht Dr. Söhnke M. Bartram Director of Research in Accounting and Department of Accounting and FinanceProfessor of Finance FinanceLancaster University Management Lancaster University Management School SchoolPh.D. (WHU Koblenz) BA (Antwerp); MPhil, MA, PhD MBA/BBA (University of Saarbrücken) (Cambridge) Dr. Miguel Angel Ariño Dr. Carlos García Pont Professor of Decision Sciences Associate Professor of Marketing IESE Business School IESE Business School, University of Barcelona, Spain (Universidad de Navarra) Navarra CEIBS (China Europe International Business Doctor of Philosophy (Management), School). Massachusetts Institute of Technology Beijing, Shanghai and Shenzhen (MIT) Ph.D. in Mathematics Master in Business Administration, IESE, University of Barcelona University of Navarra BA in Mathematics (Licenciatura) Degree in Industrial Engineering, University of Barcelona Universitat Politècnica de Catalunya Philip G. Moscoso Dr. Fotini Labropulu Technology and Operations Management Mathematics - Luther College IESE Business School, University of Navarra University of ReginaPh.D., M.Sc. in Ph.D in Industrial Engineering and Mathematics Management, ETH Zurich B.A. (Honors) in Mathematics M.Sc. in Chemical Engineering, ETH Zurich University of Windso Dr. Sanjay Dixit, M.D. Dr. Lynn Lim Director, EP Laboratories, Philadelphia VA Reader in Business and Marketing Medical Center Roehampton University, London Cardiovascular Medicine - Cardiac BCom, PGDip, MBA (Distinction), PhD, Arrhythmia FHEA Univ of Penn School of Medicine Dr. Mihaly Mezei Dr. Han-Xiang Deng ASSOCIATE PROFESSOR MD., Ph.D Department of Structural and Chemical Associate Professor and Research Biology, Mount Sinai School of Medical Department Division of Neuromuscular Center Medicine Ph.D., Etvs Lornd University Davee Department of Neurology and Clinical Postdoctoral Training, NeuroscienceNorthwestern University New York University Feinberg School of Medicine Dr. Pina C. Sanelli Dr. Michael R. Rudnick Associate Professor of Public Health M.D., FACP Weill Cornell Medical College Associate Professor of Medicine Associate Attending Radiologist Chief, Renal Electrolyte and NewYork-Presbyterian Hospital Hypertension Division (PMC) MRI, MRA, CT, and CTA Penn Medicine, University of Neuroradiology and Diagnostic Pennsylvania Radiology Presbyterian Medical Center, M.D., State University of New York at Philadelphia Buffalo,School of Medicine and Nephrology and Internal Medicine Biomedical Sciences Certified by the American Board of Internal Medicine Dr. Roberto Sanchez Associate Professor Dr. Bassey Benjamin Esu Department of Structural and Chemical B.Sc. Marketing; MBA Marketing; Ph.D Biology Marketing Mount Sinai School of Medicine Lecturer, Department of Marketing, Ph.D., The Rockefeller University University of Calabar Tourism Consultant, Cross River State Tourism Development Department Dr. Wen-Yih Sun Co-ordinator , Sustainable Tourism Professor of Earth and Atmospheric Initiative, Calabar, Nigeria SciencesPurdue University Director National Center for Typhoon and Dr. Aziz M. Barbar, Ph.D. Flooding Research, Taiwan IEEE Senior Member University Chair Professor Chairperson, Department of Computer Department of Atmospheric Sciences, Science National Central University, Chung-Li, AUST - American University of Science & TaiwanUniversity Chair Professor Technology Institute of Environmental Engineering, Alfred Naccash Avenue – Ashrafieh National Chiao Tung University, Hsin- chu, Taiwan.Ph.D., MS The University of Chicago, Geophysical Sciences BS National Taiwan University, Atmospheric Sciences Associate Professor of Radiology President Editor (HON.) Dr. George Perry, (Neuroscientist) Dean and Professor, College of Sciences Denham Harman Research Award (American Aging Association) ISI Highly Cited Researcher, Iberoamerican Molecular Biology Organization AAAS Fellow, Correspondent Member of Spanish Royal Academy of Sciences University of Texas at San Antonio Postdoctoral Fellow (Department of Cell Biology) Baylor College of Medicine Houston, Texas, United States Chief Author (HON.) Dr. R.K. Dixit M.Sc., Ph.D., FICCT Chief Author, India Email: [email protected] Dean & Editor-in-Chief (HON.) Vivek Dubey(HON.) Er. Suyog Dixit MS (Industrial Engineering), (M. Tech), BE (HONS. in CSE), FICCT MS (Mechanical Engineering) SAP Certified Consultant University of Wisconsin, FICCT CEO at IOSRD, GAOR & OSS Technical Dean, Global Journals Inc. (US) Editor-in-Chief, USA Website: www.suyogdixit.com [email protected] Email:[email protected] Sangita Dixit Pritesh Rajvaidya M.Sc., FICCT (MS) Computer Science Department Dean & Chancellor (Asia Pacific) California State University [email protected] BE (Computer Science), FICCT Suyash Dixit Technical Dean,
Load more

Recommended publications
  • Domain Without Subjects Traditional Rulers in Post-Colonial Africa
    Taiwan Journal of Democracy, Volume 13, No. 2: 31-54 Domain without Subjects Traditional Rulers in Post-Colonial Africa Oscar Edoror Ubhenin Abstract The domain of traditional rulers in pre-colonial Africa was the state, defined by either centralization or fragmentation. The course of traditional rulers in Africa was altered by colonialism, thereby shifting their prerogative to the nonstate domain. Their return in post-colonial Africa has coincided with their quest for constitutional “space of power.” In effect, traditional rulers are excluded from modern state governance and economic development. They have remained without subjects in post-colonial Africa. Thus, the fundamental question: How and why did traditional rulers in post-colonial Africa lose their grip over their subjects? In explaining the loss of traditional rulers’ grip over subjects in their domains, this essay refers to oral tradition and published literature, including official government documents. Empirical evidence is drawn from Nigeria and other parts of Africa. Keywords: African politics, chiefs and kings, post-colonialism, traditional domain. During the era of pre-colonialism, African chiefs and kings (also called traditional rulers) operated in the domain of the state, characterized by either centralization or fragmentation. This characterization refers to the variations in political cum administrative institutions along the lines of several hundred ethnic groups that populated Africa. “Centralized” or “fragmented” ethnic groups were based on the number of levels of jurisdiction that transcended the local community, “where more jurisdictional levels correspond[ed] to more centralized groups.”1 Traditional rulers in Africa had mechanisms for formulating public policies and engaging public officers who assisted them in development and delivering relevant services to their subjects.
    [Show full text]
  • No. 14 LAGOS- 7Thmarch,1963 Vol. 50
    Ed mG i fe a Giooh te No. 14 LAGOS- 7th March,1963 Vol. 50 ‘CONTENTS we. / Page . Page Movethents of Officers - 270-7 Disposal of Unclaimed Firearms i .. 283 Appointment of Acting Chief Justice of the : 3 " Treasury Statements Nos..3-5 . 284-8 : Federation of Nigeria .. 277- List of Registered Contractors—Building, Probate Notice : 278 CivilEngineering and Electrical * 289-319 Delegation of Powers Notice, 1963 .. .. 279 List of Registered Chemists and Druggists 320-29 Grantof PioneerCertificate .. | 279 Paim Oil and Palm Kernels Purchasesiin the Federation of Nigeria 329 Appointment of Parliamentary Secretary 279 Awards for Undergraduate Studies and . Ministry of Communications Notices +279 Technical Training, 1963 .. .. 329-31 Loss ofLocal Purchase Orders,etc. 279-81 University of Nigeria—Applications for ss Admission 1963-4 . 331 Cancellation of Certificate of Registration of Trade Unions. 281 Tenders . tees . «. 332-3 Licensed Commercial Banks’ Analysisof . “Vacancies «» 333-9 Loans and Advances . 281 UNESCO Vacancies .. oe «awe 83339 Lagos Consumer Price Index—Lower Income Group - -. 281 -3 Board of Customs and Excise Sales Notices 339-40 Lagos Consumer Price Index—Middle . ' Application to operate ScheduledAir Services Income Group* . 282 340 ~ ‘Training of Nigerians as Commercial Pilots 282 Inpex To Lecan Notices n SUPPLEMENT ‘Teachers’ Grade III Certificate Examination, . 1956—-Supplementary Pass List -. 283 LN. No. Short Title Page Teachers’ Grade .II Certificate Examination, 983 - 27 Tin (Research tevy) Regulations, -1956—Supplementary Pass List — , : 1963 . os -- B73 270 (OFFICIAL ‘GAZETTE No. 14, Vol. 50 Guzernment Notice No, 429 + ~ NEW APPOINTMENTS AND OTHER STAFF CHANGES The following are notified for general information :— NEWAPPOINTMENTS Tv Depariment Name Appointment Date of Date of, Appointment Arrival Administration Adelaja, A.
    [Show full text]
  • MEDIA AS ACTORS in INTERSTATE CONFLICT: LESSONS from NIGERIAN PRESS COVERAGE of the BAKASSI PENINSULA DISPUTE Thomas Anomoaphe Alemoh (Ph.D.)1, Mrs
    American International Journal of Available online at http://www.iasir.net Research in Humanities, Arts and Social Sciences ISSN (Print): 2328-3734, ISSN (Online): 2328-3696, ISSN (CD-ROM): 2328-3688 AIJRHASS is a refereed, indexed, peer-reviewed, multidisciplinary and open access journal published by International Association of Scientific Innovation and Research (IASIR), USA (An Association Unifying the Sciences, Engineering, and Applied Research) MEDIA AS ACTORS IN INTERSTATE CONFLICT: LESSONS FROM NIGERIAN PRESS COVERAGE OF THE BAKASSI PENINSULA DISPUTE Thomas Anomoaphe Alemoh (Ph.D.)1, Mrs. Lucy Ishima (M.Sc.)2 1,2Lecturers, Department of Mass Communication, Kwararafa University, Wukari, Taraba State, NIGERIA Abstract: It is becoming increasingly acceptable among scholars that media play an important role in interstate affairs in contemporary global relations. Ordinarily in diplomatic circles as in all other spheres of life, the media as an institution in society, should concern itself with purveying information by acting as news sources. However, changing circumstances have redefined the role of the media in the international arena. The media may not be seen openly as participants in the nexus of factors that drive international discourse but they act as shadow parties in influencing what goes on in diplomatic circles. Sometimes, they initiate key decisions and at other times, they act as go-between among parties in a situation where open communication is virtually difficult. It is this unique role of the media in resolving interstate conflicts that forms the focus of this article using the Bakassi Peninsula conflict as a reference point. This article does not assume that the media were directly involved in the negotiation process to resolve the conflict but it establishes the fact that through cautious reportage, the Nigerian press could have positively influenced the peaceful outcome of the dispute between Nigeria and Cameroun over the Bakassi Peninsula.
    [Show full text]
  • Nigeria's Nascent Democracy
    An International Multi-Disciplinary Journal, Ethiopia Vol. 5 (2), Serial No. 19, April, 2011 ISSN 1994-9057 (Print) ISSN 2070-0083 (Online) Nigeria’s Nascent Democracy and ‘WAR’ Against Corruption: A Rear View Mirror (56-71) Ojo, Emmanuel O. - University of Ilorin, P.M.B. 1515, Ilorin, Kwara State, Nigeria E-mail: [email protected] Cell: +2348033822383; 07057807714 Home: 022-008330 Abstract One of the problems facing the nascent democracy in Nigeria which is more pressing than economic development is the high rate of brazen corruption in virtually all facets of the polity’s national life. Thus, the thrust of this paper is a review of the recent ‘WAR’ against corruption in Nigeria. The paper surveys a number of manifestations of corruption in the body politik and the country’s woes. The paper however infers that unless the institutional mechanisms put in place are rejuvenated coupled with political will on the part of the political actors, the so-called war may be a mirage after all. Key words: Corruption, Kleptocracy, Constitutionalism, Integrity, Poverty. Introduction Most of us came into the National Assembly with very high expectations...when we go around campaigning and asking for votes, we don’t get these votes free. You spend some money. Most of us even sold houses. You come in through legitimate means but you can’t recoup what you spent (The News , April 4, 2005:50). Copyright © IAARR 2011: www.afrrevjo.com 56 Indexed African Journals Online: www.ajol.info Vol. 5 (2), Serial No. 19, April, 2011. Pp. 56-71 The above quotation by a one time Senate President – Adolphus Wabara – betrayed what psychologists would call a Freudian slip.
    [Show full text]
  • The Impact of Transportation Infrastructure on Nigeria's Economic Developmeny
    Walden University ScholarWorks Walden Dissertations and Doctoral Studies Walden Dissertations and Doctoral Studies Collection 2016 The mpI act of Transportation Infrastructure on Nigeria's Economic Developmeny William A. Agbigbe Walden University Follow this and additional works at: https://scholarworks.waldenu.edu/dissertations Part of the Business Administration, Management, and Operations Commons, Databases and Information Systems Commons, and the Management Sciences and Quantitative Methods Commons This Dissertation is brought to you for free and open access by the Walden Dissertations and Doctoral Studies Collection at ScholarWorks. It has been accepted for inclusion in Walden Dissertations and Doctoral Studies by an authorized administrator of ScholarWorks. For more information, please contact [email protected]. Walden University College of Management and Technology This is to certify that the doctoral dissertation by William A. Agbigbe Sr. has been found to be complete and satisfactory in all respects, and that any and all revisions required by the review committee have been made. Review Committee Dr. Robert DeYoung, Committee Chairperson, Management Faculty Dr. Godwin Igein, Committee Member, Management Faculty Dr. Salvatore Sinatra, University Reviewer, Management Faculty Chief Academic Officer Eric Riedel, Ph.D. Walden University 2016 Abstract The Impact of Transportation Infrastructure on Nigeria’s Economic Development by William A. Agbigbe, Sr. MA, Southern Illinois University, 1981 BSBA, University of Missouri, 1976 Dissertation Submitted in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Management Walden University August 2016 Abstract The United Nations Development Programme (UNDP) described Nigeria’s road networks as one of the poorest and deadliest transportation infrastructural systems in the world.
    [Show full text]
  • NIGERIA COUNTRY of ORIGIN INFORMATION (COI) REPORT COI Service
    NIGERIA COUNTRY OF ORIGIN INFORMATION (COI) REPORT COI Service 6 January 2012 NIGERIA 6 JANUARY 2012 Contents Preface Latest news EVENTS IN NIGERIA FROM 16 DECEMBER 2011 TO 3 JANUARY 2012 Useful news sources for further information REPORTS ON NIGERIA PUBLISHED OR ACCESSED AFTER 15 DECEMBER 2011 Paragraphs Background Information 1. GEOGRAPHY ............................................................................................................ 1.01 Map ........................................................................................................................ 1.07 2. ECONOMY ................................................................................................................ 2.01 3. HISTORY (1960 – 2011) ........................................................................................... 3.01 Independence (1960) – 2010 ................................................................................ 3.02 Late 2010 to February 2011 ................................................................................. 3.04 4. RECENT DEVELOPMENTS (MARCH 2011 TO NOVEMBER 2011) ...................................... 4.01 Elections: April, 2011 ....................................................................................... 4.01 Inter-communal violence in the middle belt of Nigeria ................................. 4.08 Boko Haram ...................................................................................................... 4.14 Human rights in the Niger Delta .........................................................................
    [Show full text]
  • 2018 DG Report on the Safety of Journalists and the Danger of Impunity
    CI-18/COUNCIL-31/6/REV 2 2018 DG Report on the Safety of Journalists and the Danger of Impunity INTRODUCTION This report is submitted to the Intergovernmental Council of the International Programme for the Development of Communication (IPDC) in line with the Decision on the Safety of Journalists and the issue of Impunity adopted by the Council at its 26th session on 27 March 2008, and renewed at subsequent sessions in 2010, 2012, 2014 and 2016. In its latest Decision, adopted in November 2016, the IPDC Council urged Member States to “continue to inform the Director-General of UNESCO, on a voluntary basis, on the status of the judicial inquiries conducted on each of the killings condemned by the Director-General”. The present report provides an analysis of the cases of killings of journalists and associated media personnel that were condemned by the Director-General in 2016 and 2017. It also takes stock of the status of judicial enquiries conducted on each of the killings recorded by UNESCO between 2006 and 2017, based on information provided by Member States. TABLE OF CONTENTS 1. Executive Summary 2 2. Background and Context 2 3. Journalists’ killings in 2016 and 2017: key findings 7 3.1 Most dangerous regions 8 3.2 Rise in number of women journalists among fatalities 9 3.3 Highest number of killings among TV journalists 11 3.4 Majority of victims are local journalists 11 3.5 Freelance and staff journalists 12 3.6 More killings occurring in countries with no armed conflict 12 4. Member States’ responses: status of the judicial enquiries on cases of journalists killed from 2006 to end 2017 13 4.1 Decrease in Member State response rate to Director-General’s request 18 4.2 Slight reduction in impunity rate, but 89% of cases remain unresolved 19 4.3 Member States reporting on measures to promote safety of journalists and to combat impunity 22 5.
    [Show full text]
  • Armed Conflicts
    Map 22 1 . 1. Armed conicts Ukraine Turkey Syria Palestine Afghanistan Iraq Israel Algeria Pakistan Libya Egypt India Myanmar Mali Niger Chad Sudan Thailand Yemen Burkina Philippines Faso Nigeria South Ethiopia CAR Sudan Colombia Somalia Cameroon DRC Burundi Countries with armed conflicts End2018 of armed conflict in Alert 2019 1. Armed conflicts • 34 armed conflicts were reported in 2018, 33 of them remained active at end of the year. Most of the conflicts occurred in Africa (16), followed by Asia (nine), the Middle East (six), Europe (two) and America (one). • The violence affecting Cameroon’s English-speaking majority regions since 2016 escalated during the year, becoming a war scenario with serious consequences for the civilian population. • In an atmosphere characterised by systematic ceasefire violations and the imposition of international sanctions, South Sudan reached a new peace agreement, though there was scepticism about its viability. • The increase and spread of violence in the CAR plunged it into the third most serious humanitarian crisis in the world, according to the United Nations. • The situation in Colombia deteriorated as a result of the fragility of the peace process and the finalisation of the ceasefire agreement between the government and the ELN guerrilla group. • High-intensity violence persisted in Afghanistan, but significant progress was made in the exploratory peace process. • The levels of violence in southern Thailand were the lowest since the conflict began in 2004. • There were less deaths linked to the conflict with the PKK in Turkey, but repression continued against Kurdish civilians and the risk of destabilisation grew due to the repercussions of the conflict in Syria.
    [Show full text]
  • The Digital Dilemma 2 Perspectives from Independent Filmmakers, Documentarians and Nonprofi T Audiovisual Archives
    Copyright ©2012 Academy of Motion Picture Arts and Sciences. “Oscar,” “Academy Award,” and the Oscar statuette are registered trademarks, and the Oscar statuette the copyrighted property, of the Academy of Motion Picture Arts and Sciences. The accuracy, completeness, and adequacy of the content herein are not guaranteed, and the Academy of Motion Picture Arts and Sciences expressly disclaims all warranties, including warranties of merchantability, fi tness for a particular purpose and non-infringement. Any legal information contained herein is not legal advice, and is not a substitute for advice of an attorney. All rights reserved under international copyright conventions. No part of this document may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying, recording, or by any information storage and retrieval system without permission in writing from the publisher. Published by the Academy of Motion Picture Arts and Sciences Inquiries should be addressed to: Science and Technology Council Academy of Motion Picture Arts and Sciences 1313 Vine Street, Hollywood, CA 90028 (310) 247-3000 http://www.oscars.org Printed in the United States of America Library of Congress Cataloging-in-Publication Data The Digital Dilemma 2 Perspectives from Independent Filmmakers, Documentarians and Nonprofi t Audiovisual Archives 1. Digital preservation – Case Studies. 2. Film Archives – Technological Innovations 3. Independent Filmmakers 4. Documentary Films 5. Audiovisual I. Academy of Motion Picture Arts and
    [Show full text]
  • The Media and the Militants: Constructing the Niger Delta Crisis
    THE MEDIA AND THE MILITANTS THE MEDIA AND THE MILITANTS: CONSTRUCTING THE NIGER DELTA CRISIS by Innocent Chiluwa This study applies Critical Discourse Analysis (CDA) and Corpus Linguistics methods to analyse the frequently used lexical items by the Nigerian press to represent the Niger Delta militia groups and their activities. The study shows that the choice of particular vocabulary over other available options reveals value judgements that reflect power, identity and socio-economic marginalization. Concordances and collocational tools are used to provide semantic profiles of the selected lexical items and collocational differences are highlighted. A list of collocates was obtained from the concordances of the 'Nigerian Media Corpus' (NMC) (a corpus of 500,000 words compiled by the author). The study reveals that the negative representations of the ethnic militia are an ideological strategy used to shift attention from the real issues of ethnic marginalization and exploitation of the Niger Delta – a region solely responsible for Nigeria's oil-based economy. Arguably, the over-publicised security challenges in the Niger Delta succeed in creating suspicion and apprehension among the citizenry, whereas the government, which receives abundant revenue from oil, does little to develop the entire country. Keywords: Nigeria, ethnic militants, Niger Delta, corpus linguistics, ideology, the press 1. Introduction The conflict in the Niger Delta (ND) of Nigeria has often been attributed to Nigeria's federal structure that groups the country into unequal regions. The north and the west and some parts of the eastern region are the 'majority' ethnic groups with full political and demographic privileges. These groups are said to dominate the 'minority' ethnic groups such as those populating the Delta region.
    [Show full text]
  • Role of Transportation and Marketing in Enhancing Agricultural Production in Ikwo Local Government Area of Ebonyi State, Nigeria
    Sustainability, Agri, Food and Environmental Research, (ISSN: 0719-3726), 6(4), 2018: 22-39 22 http://dx.doi.org/10.7770/safer-V0N0-art1353 ROLE OF TRANSPORTATION AND MARKETING IN ENHANCING AGRICULTURAL PRODUCTION IN IKWO LOCAL GOVERNMENT AREA OF EBONYI STATE, NIGERIA. ROL DEL TRANSPORTE Y MERCADO EN ESTIMULACIÓN DE LA PRODUCCIÓN AGRICOLA EN EL GOBIERNO LOCAL DEL AREA DEL ESTADO DE EBONYI, NIGERIA. Ume Smiles Ifeanyichukwu*, K.O. knadosie, C Kadurumba Agricultural Extension and Management.Federal College of Agriculture Ishiagu, Ebonyi State, Nigeria. Department of Agricultural Economics and Extension, Nnamdi Azikiwe University, Awka, Anambra State, Nigeria. * Corresponding Author; [email protected] ABSTRACT Role of transport and marketing in enhancing agricultural production in Ikwo Local Government Area of Ebonyi State, Nigeria was studied. A multi stage sampling procedure was used to select 300 respondents for the detailed study. A structured questionnaire was used to elicit information from the respondents. Data collected were analyzed using of chi-square. The results show that head carrying, use of wheel barrows, bicycles, motor van, keke, donkeys, and motor cycles were various traditional modes of transportation for inter local transport of agricultural products. Furthermore, the result reveals that producers, retailers, consumers, wholesalers and processors were the marketing channels in the study area. Additionally, transportation and marketing have greatly enhanced the growth of agricultural production in the study area, despite existing problems such as bad roads, high cost of transport, few vehicles, poor drainage channels, culverts, few bridges and poverty. Also, the solutions to the identified problems were giving out loans to farmers, construction and repairs of roads, use of rail, mass transit, encouraging farmers’ cooperative societies and processing centres.
    [Show full text]
  • Global Journal of Human Social Science: F Political Science
    Online : 2249-460X Print : 0975-587X Politicisation of Education Democracy in Tajikistan Oil Pipeline Vandalism Boko Haram Insurgency VOLUME 13 ISSUE 5 VERSION 1.0 Global Journal of Human Social Science: F Political Science Global Journal of Human Social Science: F Political Science Volume 13 Issue 5 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI+XPDQ *OREDO-RXUQDOV,QF Social Sciences. 2013. $'HODZDUH86$,QFRUSRUDWLRQZLWK³*RRG6WDQGLQJ´Reg. Number: 0423089 6SRQVRUV Open Association of Research Society $OOULJKWVUHVHUYHG 2SHQ6FLHQWLILF6WDQGDUGV 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI+XPDQ6RFLDO 3XEOLVKHU¶V+HDGTXDUWHUVRIILFH 6FLHQFHV´%\*OREDO-RXUQDOV,QF $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG *OREDO-RXUQDOV,QF+HDGTXDUWHUV&RUSRUDWH2IILFH XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ &DPEULGJH2IILFH&HQWHU,,&DQDO3DUN)ORRU1R 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH WKCambridge (Massachusetts)3LQ0$ (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV 8QLWHG6WDWHV RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 86$7ROO)UHH 86$7ROO)UHH)D[ 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV 2IIVHW7\SHVHWWLQJ HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ Open Asso ciation of Research Society , Marsh Road, SHUPLVVLRQ Rainham, Essex, London RM13 8EU 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV United Kingdom. ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG
    [Show full text]