OR10J1 (Human) Recombinant Protein

Total Page：16

File Type：pdf, Size：1020Kb

OR10J1 (Human) Recombinant Entrez GeneID: 26476 Protein Gene Symbol: OR10J1 Catalog Number: H00026476-G01 Gene Alias: HGMP07J, HSHGMP07J, MGC138495, MGC138497 Regulation Status: For research use only (RUO) Gene Summary: Olfactory receptors interact with Product Description: Human OR10J1 full-length ORF odorant molecules in the nose, to initiate a neuronal (NP_036483.1) recombinant protein without tag. response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family Sequence: of G-protein-coupled receptors (GPCR) arising from MLLCFRFGNQSMKRENFTLITDFVFQGFSSFHEQQITL single coding-exon genes. Olfactory receptors share a FGVFLALYILTLAGNIIIVTIIRIDLHLHTPMYFFLSMLSTS 7-transmembrane domain structure with many ETVYTLVILPRMLSSLVGMSQPMSLAGCATQMFFFVTF neurotransmitter and hormone receptors and are GITNCFLLTAMGYDRYVAICNPLRYMVIMNKRLRIQLVL responsible for the recognition and G protein-mediated GACSIGLIVAITQVTSVFRLPFCARKVPHFFCDIRPVMK transduction of odorant signals. The olfactory receptor LSCIDTTVNEILTLIISVLVLVVPMGLVFISYVLIISTILKIAS gene family is the largest in the genome. The VEGRKKAFATCASHLTVVIVHYSCASIAYLKPKSENTR nomenclature assigned to the olfactory receptor genes EHDQLISVTYTVITPLLNPVVYTLRNKEVKDALCRAVG and proteins for this organism is independent of other GKFS organisms. [provided by RefSeq] Host: Wheat Germ (in vitro) Theoretical MW (kDa): 35.9 Applications: AP (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: in vitro wheat germ expression system with proprietary liposome technology Purification: None Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Genetic Variation Across the Human Olfactory Receptor Repertoire Alters Odor Perception
bioRxiv preprint doi: https://doi.org/10.1101/212431; this version posted November 1, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Genetic variation across the human olfactory receptor repertoire alters odor perception Casey Trimmer1,*, Andreas Keller2, Nicolle R. Murphy1, Lindsey L. Snyder1, Jason R. Willer3, Maira Nagai4,5, Nicholas Katsanis3, Leslie B. Vosshall2,6,7, Hiroaki Matsunami4,8, and Joel D. Mainland1,9 1Monell Chemical Senses Center, Philadelphia, Pennsylvania, USA 2Laboratory of Neurogenetics and Behavior, The Rockefeller University, New York, New York, USA 3Center for Human Disease Modeling, Duke University Medical Center, Durham, North Carolina, USA 4Department of Molecular Genetics and Microbiology, Duke University Medical Center, Durham, North Carolina, USA 5Department of Biochemistry, University of Sao Paulo, Sao Paulo, Brazil 6Howard Hughes Medical Institute, New York, New York, USA 7Kavli Neural Systems Institute, New York, New York, USA 8Department of Neurobiology and Duke Institute for Brain Sciences, Duke University Medical Center, Durham, North Carolina, USA 9Department of Neuroscience, University of Pennsylvania School of Medicine, Philadelphia, Pennsylvania, USA *[email protected] ABSTRACT The human olfactory receptor repertoire is characterized by an abundance of genetic variation that affects receptor response, but the perceptual effects of this variation are unclear. To address this issue, we sequenced the OR repertoire in 332 individuals and examined the relationship between genetic variation and 276 olfactory phenotypes, including the perceived intensity and pleasantness of 68 odorants at two concentrations, detection thresholds of three odorants, and general olfactory acuity.
[Show full text]
Misexpression of Cancer/Testis (Ct) Genes in Tumor Cells and the Potential Role of Dream Complex and the Retinoblastoma Protein Rb in Soma-To-Germline Transformation
Michigan Technological University Digital Commons @ Michigan Tech Dissertations, Master's Theses and Master's Reports 2019 MISEXPRESSION OF CANCER/TESTIS (CT) GENES IN TUMOR CELLS AND THE POTENTIAL ROLE OF DREAM COMPLEX AND THE RETINOBLASTOMA PROTEIN RB IN SOMA-TO-GERMLINE TRANSFORMATION SABHA M. ALHEWAT Michigan Technological University, [email protected] Copyright 2019 SABHA M. ALHEWAT Recommended Citation ALHEWAT, SABHA M., "MISEXPRESSION OF CANCER/TESTIS (CT) GENES IN TUMOR CELLS AND THE POTENTIAL ROLE OF DREAM COMPLEX AND THE RETINOBLASTOMA PROTEIN RB IN SOMA-TO- GERMLINE TRANSFORMATION", Open Access Master's Thesis, Michigan Technological University, 2019. https://doi.org/10.37099/mtu.dc.etdr/933 Follow this and additional works at: https://digitalcommons.mtu.edu/etdr Part of the Cancer Biology Commons, and the Cell Biology Commons MISEXPRESSION OF CANCER/TESTIS (CT) GENES IN TUMOR CELLS AND THE POTENTIAL ROLE OF DREAM COMPLEX AND THE RETINOBLASTOMA PROTEIN RB IN SOMA-TO-GERMLINE TRANSFORMATION By Sabha Salem Alhewati A THESIS Submitted in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE In Biological Sciences MICHIGAN TECHNOLOGICAL UNIVERSITY 2019 © 2019 Sabha Alhewati This thesis has been approved in partial fulfillment of the requirements for the Degree of MASTER OF SCIENCE in Biological Sciences. Department of Biological Sciences Thesis Advisor: Paul Goetsch. Committee Member: Ebenezer Tumban. Committee Member: Zhiying Shan. Department Chair: Chandrashekhar Joshi. Table of Contents List of figures .......................................................................................................................v
[Show full text]
Differentially Methylated Genes
10/30/2013 Disclosures Key Rheumatoid Arthritis-Associated Pathogenic Pathways Revealed by Integrative Analysis of RA Omics Datasets Consultant: IGNYTA Funding: Rheumatology Research Foundation By John W. Whitaker, Wei Wang and Gary S. Firestein DNA methylation and gene regulation The RA methylation signature in FLS DNA methylation – DNMT1 (maintaining methylation) OA – DNMT3a, 3b (de novo methylation) RA % of CpG methylation: 0% 100% Nakano et al. 2013 ARD AA06 AANAT AARS ABCA6 ABCC12 ABCG1 ABHD8 ABL2 ABR ABRA ACACA ACAN ACAP3 ACCSL ACN9 ACOT7 ACOX2 ACP5 ACP6 ACPP ACSL1 ACSL3 ACSM5 ACVRL1 ADAM10 ADAM32 ADAM33 ADAMTS12 ADAMTS15 ADAMTS19 ADAMTS4 ADAT3 ADCK4 ADCK5 ADCY2 ADCY3 ADCY6 ADORA1 ADPGK ADPRHL1 ADTRP AFAP1 AFAP1L2 AFF3 AFG3L1P AGAP11 AGER AGTR1 AGXT AIF1L AIM2 AIRE AJUBA AK4 AKAP12 AKAP2 AKR1C2 AKR1E2 AKT2 ALAS1 ALDH1L1-AS1 ALDH3A1 ALDH3B1 ALDH8A1 ALDOB ALDOC ALOX12 ALPK3 ALS2CL ALX4 AMBRA1 AMPD2 AMPD3 ANGPT1 ANGPT2 ANGPTL5 ANGPTL6 ANK1 ANKMY2 ANKRD29 ANKRD37 ANKRD53 ANO3 ANO6 ANO7 ANP32C ANXA6 ANXA8L2 AP1G1 AP2A2 AP2M1 AP5B1 APBA2 APC APCDD1 APOBEC3B APOBEC3G APOC1 APOH APOL6 APOLD1 APOM AQP1 AQP10 AQP6 AQP9 ARAP1 ARHGAP24 ARHGAP42 ARHGEF19 ARHGEF25 ARHGEF3 ARHGEF37 ARHGEF7 ARL4C ARL6IP 5 ARL8B ARMC3 ARNTL2 ARPP21 ARRB1 ARSI ASAH2B ASB10 ASB2 ASCL2 ASIC4 ASPH ATF3 ATF7 ATL1 ATL3 ATP10A ATP1A1 ATP1A4 ATP2C1 ATP5A1 ATP5EP2 ATP5L2 ATP6V0CP3 ATP6V1C1 ATP6V1E2 ATXN7L1 ATXN7L2 AVPI1 AXIN2 B3GNT7 B3GNT8 B3GNTL1 BACH1 BAG3 Differential methylated genes in RA FLS BAIAP2L2 BANP BATF BATF2 BBS2 BCAS4 BCAT1 BCL7C BDKRB2 BEGAIN BEST1 BEST3
[Show full text]
Strand Breaks for P53 Exon 6 and 8 Among Different Time Course of Folate Depletion Or Repletion in the Rectosigmoid Mucosa
SUPPLEMENTAL FIGURE COLON p53 EXONIC STRAND BREAKS DURING FOLATE DEPLETION-REPLETION INTERVENTION Supplemental Figure Legend Strand breaks for p53 exon 6 and 8 among different time course of folate depletion or repletion in the rectosigmoid mucosa. The input of DNA was controlled by GAPDH. The data is shown as ΔCt after normalized to GAPDH. The higher ΔCt the more strand breaks. The P value is shown in the figure. SUPPLEMENT S1 Genes that were significantly UPREGULATED after folate intervention (by unadjusted paired t-test), list is sorted by P value Gene Symbol Nucleotide P VALUE Description OLFM4 NM_006418 0.0000 Homo sapiens differentially expressed in hematopoietic lineages (GW112) mRNA. FMR1NB NM_152578 0.0000 Homo sapiens hypothetical protein FLJ25736 (FLJ25736) mRNA. IFI6 NM_002038 0.0001 Homo sapiens interferon alpha-inducible protein (clone IFI-6-16) (G1P3) transcript variant 1 mRNA. Homo sapiens UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 15 GALNTL5 NM_145292 0.0001 (GALNT15) mRNA. STIM2 NM_020860 0.0001 Homo sapiens stromal interaction molecule 2 (STIM2) mRNA. ZNF645 NM_152577 0.0002 Homo sapiens hypothetical protein FLJ25735 (FLJ25735) mRNA. ATP12A NM_001676 0.0002 Homo sapiens ATPase H+/K+ transporting nongastric alpha polypeptide (ATP12A) mRNA. U1SNRNPBP NM_007020 0.0003 Homo sapiens U1-snRNP binding protein homolog (U1SNRNPBP) transcript variant 1 mRNA. RNF125 NM_017831 0.0004 Homo sapiens ring finger protein 125 (RNF125) mRNA. FMNL1 NM_005892 0.0004 Homo sapiens formin-like (FMNL) mRNA. ISG15 NM_005101 0.0005 Homo sapiens interferon alpha-inducible protein (clone IFI-15K) (G1P2) mRNA. SLC6A14 NM_007231 0.0005 Homo sapiens solute carrier family 6 (neurotransmitter transporter) member 14 (SLC6A14) mRNA.
[Show full text]
OR10J1 Sirna (H): Sc-78655
SANTA CRUZ BIOTECHNOLOGY, INC. OR10J1 siRNA (h): sc-78655 BACKGROUND STORAGE AND RESUSPENSION Olfactory receptors are G protein-coupled receptors that localize to the cilia Store lyophilized siRNA duplex at -20° C with desiccant. Stable for at least of olfactory sensory neurons where they display affinity for and bind to a one year from the date of shipment. Once resuspended, store at -20° C, variety of odor molecules. The genes encoding olfactory receptors comprise avoid contact with RNAses and repeated freeze thaw cycles. the largest family in the human genome. The binding of olfactory receptor Resuspend lyophilized siRNA duplex in 330 µl of the RNAse-free water proteins to odor molecules triggers a signal transduction that propagates provided. Resuspension of the siRNA duplex in 330 µl of RNAse-free water nerve impulses throughout the body, ultimately leading to transmission of the makes a 10 µM solution in a 10 µM Tris-HCl, pH 8.0, 20 mM NaCl, 1 mM signal to the brain and the subsequent perception of smell. OR10J1 (olfactory EDTA buffered solution. receptor, family 10, subfamily J, member 1), also known as olfactory receptor OR1-26, is a 320 amino acid multi-pass membrane protein encoded by a gene APPLICATIONS that maps to human chromosome 1q23.2. OR10J1 siRNA (h) is recommended for the inhibition of OR10J1 expression REFERENCES in human cells. 1. Parmentier, M., Libert, F., Schurmans, S., Schiffmann, S., Lefort, A., SUPPORT REAGENTS Eggerickx, D., Ledent, C., Mollereau, C., Gérard, C., Perret, J., et al.1992. Expression of members of the putative olfactory receptor gene family in For optimal siRNA transfection efficiency, Santa Cruz Biotechnology’s mammalian germ cells.
[Show full text]
View a Copy of This Licence, Visit
Robertson et al. BMC Biology (2020) 18:103 https://doi.org/10.1186/s12915-020-00826-z RESEARCH ARTICLE Open Access Large-scale discovery of male reproductive tract-specific genes through analysis of RNA-seq datasets Matthew J. Robertson1,2, Katarzyna Kent3,4,5, Nathan Tharp3,4,5, Kaori Nozawa3,5, Laura Dean3,4,5, Michelle Mathew3,4,5, Sandra L. Grimm2,6, Zhifeng Yu3,5, Christine Légaré7,8, Yoshitaka Fujihara3,5,9,10, Masahito Ikawa9, Robert Sullivan7,8, Cristian Coarfa1,2,6*, Martin M. Matzuk1,3,5,6 and Thomas X. Garcia3,4,5* Abstract Background: The development of a safe, effective, reversible, non-hormonal contraceptive method for men has been an ongoing effort for the past few decades. However, despite significant progress on elucidating the function of key proteins involved in reproduction, understanding male reproductive physiology is limited by incomplete information on the genes expressed in reproductive tissues, and no contraceptive targets have so far reached clinical trials. To advance product development, further identification of novel reproductive tract-specific genes leading to potentially druggable protein targets is imperative. Results: In this study, we expand on previous single tissue, single species studies by integrating analysis of publicly available human and mouse RNA-seq datasets whose initial published purpose was not focused on identifying male reproductive tract-specific targets. We also incorporate analysis of additional newly acquired human and mouse testis and epididymis samples to increase the number of targets identified. We detected a combined total of 1178 genes for which no previous evidence of male reproductive tract-specific expression was annotated, many of which are potentially druggable targets.
[Show full text]
Genome-Wide Profiling of Druggable Active Tumor Defense Mechanisms to Enhance Cancer Immunotherapy
bioRxiv preprint doi: https://doi.org/10.1101/843185; this version posted November 15, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Genome-wide profiling of druggable active tumor defense mechanisms to enhance cancer immunotherapy Rigel J. Kishton1,2,*,#, Shashank J. Patel1,2,†,*, Suman K. Vodnala1,2, Amy E. Decker3, Yogin Patel1,2, Madhusudhanan Sukumar1,2, Tori N. Yamamoto1,2,4, Zhiya Yu1,2, Michelle Ji1,2, Amanda N. Henning1,2, Devikala Gurusamy1,2, Douglas C. Palmer1,2, Winifred Lo1, Anna Pasetto1, Parisa Malekzadeh1, Drew C. Deniger1, Kris C. Wood3, Neville E. Sanjana5,6, Nicholas P. Restifo1,2, #, § 1Surgery Branch, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892, USA 2Center for Cell-Based Therapy, National Cancer Institute, Bethesda, MD 20892, USA 3Department of Pharmacology & Cancer Biology, Duke University School of Medicine, Durham, NC, USA 4Immunology Graduate Group, University of Pennsylvania, Philadelphia, PA 19104, USA 5New York Genome Center, New York, NY 10013 USA 6Department of Biology, New York University, New York, NY 10003, USA *These authors contributed equally to this work. †Present address: NextCure Inc., Beltsville, MD 20705, USA §Present address: Lyell Immunopharma, South San Francisco, CA 94080, USA #Corresponding authors. NPR: [email protected]. RJK: [email protected]. bioRxiv preprint doi: https://doi.org/10.1101/843185; this version posted November 15, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission.
[Show full text]
The Hypothalamus As a Hub for SARS-Cov-2 Brain Infection and Pathogenesis
bioRxiv preprint doi: https://doi.org/10.1101/2020.06.08.139329; this version posted June 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. The hypothalamus as a hub for SARS-CoV-2 brain infection and pathogenesis Sreekala Nampoothiri1,2#, Florent Sauve1,2#, Gaëtan Ternier1,2ƒ, Daniela Fernandois1,2 ƒ, Caio Coelho1,2, Monica ImBernon1,2, Eleonora Deligia1,2, Romain PerBet1, Vincent Florent1,2,3, Marc Baroncini1,2, Florence Pasquier1,4, François Trottein5, Claude-Alain Maurage1,2, Virginie Mattot1,2‡, Paolo GiacoBini1,2‡, S. Rasika1,2‡*, Vincent Prevot1,2‡* 1 Univ. Lille, Inserm, CHU Lille, Lille Neuroscience & Cognition, DistAlz, UMR-S 1172, Lille, France 2 LaBoratorY of Development and PlasticitY of the Neuroendocrine Brain, FHU 1000 daYs for health, EGID, School of Medicine, Lille, France 3 Nutrition, Arras General Hospital, Arras, France 4 Centre mémoire ressources et recherche, CHU Lille, LiCEND, Lille, France 5 Univ. Lille, CNRS, INSERM, CHU Lille, Institut Pasteur de Lille, U1019 - UMR 8204 - CIIL - Center for Infection and ImmunitY of Lille (CIIL), Lille, France. # and ƒ These authors contriButed equallY to this work. ‡ These authors directed this work *Correspondence to: [email protected] and [email protected] Short title: Covid-19: the hypothalamic hypothesis 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.06.08.139329; this version posted June 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
[Show full text]
Amino Acid Sequences Directed Against Cxcr4 And
(19) TZZ ¥¥_T (11) EP 2 285 833 B1 (12) EUROPEAN PATENT SPECIFICATION (45) Date of publication and mention (51) Int Cl.: of the grant of the patent: C07K 16/28 (2006.01) A61K 39/395 (2006.01) 17.12.2014 Bulletin 2014/51 A61P 31/18 (2006.01) A61P 35/00 (2006.01) (21) Application number: 09745851.7 (86) International application number: PCT/EP2009/056026 (22) Date of filing: 18.05.2009 (87) International publication number: WO 2009/138519 (19.11.2009 Gazette 2009/47) (54) AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME GEGEN CXCR4 UND ANDERE GPCR GERICHTETE AMINOSÄURESEQUENZEN SOWIE VERBINDUNGEN DAMIT SÉQUENCES D’ACIDES AMINÉS DIRIGÉES CONTRE CXCR4 ET AUTRES GPCR ET COMPOSÉS RENFERMANT CES DERNIÈRES (84) Designated Contracting States: (74) Representative: Hoffmann Eitle AT BE BG CH CY CZ DE DK EE ES FI FR GB GR Patent- und Rechtsanwälte PartmbB HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL Arabellastraße 30 PT RO SE SI SK TR 81925 München (DE) (30) Priority: 16.05.2008 US 53847 P (56) References cited: 02.10.2008 US 102142 P EP-A- 1 316 801 WO-A-99/50461 WO-A-03/050531 WO-A-03/066830 (43) Date of publication of application: WO-A-2006/089141 WO-A-2007/051063 23.02.2011 Bulletin 2011/08 • VADAY GAYLE G ET AL: "CXCR4 and CXCL12 (73) Proprietor: Ablynx N.V. (SDF-1) in prostate cancer: inhibitory effects of 9052 Ghent-Zwijnaarde (BE) human single chain Fv antibodies" CLINICAL CANCER RESEARCH, THE AMERICAN (72) Inventors: ASSOCIATION FOR CANCER RESEARCH, US, • BLANCHETOT, Christophe vol.10, no.
[Show full text]
Expression Pattern of Olfactory Receptor Genes in Human Cumulus Cells As an Indicator for Competent Oocyte Selection
Turkish Journal of Biology Turk J Biol (2020) 44: 371-380 http://journals.tubitak.gov.tr/biology/ © TÜBİTAK Research Article doi:10.3906/biy-2003-79 Expression pattern of olfactory receptor genes in human cumulus cells as an indicator for competent oocyte selection 1 2 1,3 4 5 Neda DAEI-FARSHBAF , Reza AFLATOONIAN , Fatemeh-Sadat AMJADI , Sara TALEAHMAD , Mahnaz ASHRAFI , 3,1, Mehrdad BAKHTIYARI * 1 Department of Anatomy, Faculty of Medicine, Iran University of Medical Sciences, Tehran, Iran 2 Department of Endocrinology and Female Infertility, Reproductive Biomedicine Research Center, Royan Institute for Reproductive Biomedicine, Academic Center for Education, Culture and Research, Tehran, Iran 3 Cellular and Molecular Research Center, Faculty of Medicine, Iran University of Medical Sciences, Tehran, Iran 4 Department of Molecular Systems Biology, Cell Science Research Center, Royan Institute for Stem Cell Biology and Technology (RI-SCBT), Academic Center for Education, Culture and Research, Tehran, Iran 5 Department of Obstetrics and Gynecology, Faculty of Medicine, Iran University of Medical Sciences, Tehran, Iran Received: 26.03.2020 Accepted/Published Online: 09.09.2020 Final Version: 14.12.2020 Abstract: Odorant or olfactory receptors are mainly localized in the olfactory epithelium for the perception of different odors. Interestingly, many ectopic olfactory receptors with low expression levels have recently been found in nonolfactory tissues to involve in local functions. Therefore, we investigated the probable role of the olfactory signaling pathway in the surrounding microenvironment of oocyte. This study included 22 women in intracytoplasmic sperm injection cycle. The expression of olfactory target molecules in cumulus cells surrounding the growing and mature oocytes was evaluated by Western blotting and real-time polymerase chain reaction.
[Show full text]
Supplementary Data
1 SUPPLEMENTARY FILES – DESCRIPTION AND LEGENDS Supplementary Data: Validation of amplicons, analysis of grade III IDC-NST of indeterminate phenotype and quantification of PPM1D protein levels by densitometric analysis. Supplementary Figure 1: Validation of CCND1 and EGFR amplifications in a series of 91 grade III-IDC-NST and CCNE1 amplifications on selected cases. (A) i) H&E ii) CISH iii) IHC for a) luminal tumour for CCND1 showing amplification and protein over-expression, b) basal-like tumour for CCND1 with normal copy number and no protein expression, c) EGFR non-amplified tumour with no protein expression d) EGFR amplified tumour showing strong protein expression. Amplification of CCNE1 in basal-like breast cancers. (B) Genome plots of two cases exhibiting amplification with the smallest region of overlap highlighted (i). FISH confirmation of CCNE1 amplification with RP11-327I05 (CCNE1) (red), showing amplification > 5 copies per nucleus (Bii). Supplementary Figure 2: Microarray-based comparative genomic hybridisation analysis of five grade III invasive ductal carcinomas of no special type of indeterminate phenotype. A) Representative genome plots. Log2 ratios are plotted on the Y axis against each clone according to genomic location on the X axis. The centromere is represented by a vertical dotted line. BACs categorised as displaying genomic gains as defined by aws ratios > 0.08 are highlighted in green and those categorised as genomic losses as defined by aws ratios < -0.08 are highlighted in red. Bi) The proportion of tumours in which each clone is gained (green bars) or lost (red bars) is plotted (Y axis) for each BAC clone according to genomic location (X axis).
[Show full text]
Exome Array Analysis Identifies GPR35 As a Novel Susceptibility Gene for Anthracycline-Induced Cardiotoxicity in Childhood Cancer
Exome array analysis identifies GPR35 as a novel susceptibility gene for anthracycline-induced cardiotoxicity in childhood cancer Sara Ruiz-Pinto1, Guillermo Pita1, Ana Patiño-García, PhD 2, Purificación García-Miguel, MD3, Javier Alonso, MD4, Antonio Pérez-Martínez, MD, PhD3, Antonio J Cartón, MD, PhD 5, Federico Gutiérrez-Larraya, MD, PhD 5, María R Alonso1, Daniel R. Barnes, PhD6, Joe Dennis7, Kyriaki Michailidou, PhD 6,8, Carmen Gómez-Santos9, Deborah J. Thompson, PhD 7, Douglas F. Easton, PhD 6,7, Javier Benítez, PhD 1,10, Anna González-Neira, PhD 1 1 Human Genotyping Unit-CeGen, Human Cancer Genetics Programme. Spanish National Cancer Research Centre (CNIO), Madrid, 28029, Spain 2 Department of Pediatrics, Universidad de Navarra, University Clinic of Navarra, Pamplona, 31008, Spain 3 Department of Pediatric Hemato-Oncology, Hospital Universitario La Paz, Madrid, 28046, Spain 4 Pediatric solid tumor laboratory. Human Genetic Department. Research Institute of Rare Diseases. Instituto de Salud Carlos III, Majadahonda, 28220, Madrid, Spain 5 Department of Pediatric Cardiology, Hospital Universitario La Paz, Madrid, 28046, Spain 6 Department of Public Health and Primary Care, Centre for Cancer Genetic Epidemiology, Cambridge, CB1 8RN, UK 7 Department of Oncology, Centre for Cancer Genetic Epidemiology, University of Cambridge, Cambridge, CB1 8RN, UK 1 8 Department of Electron Microscopy/Molecular Pathology, Cyprus Institute of Neurology and Genetics, Nicosia, 1683, Cyprus 9 Department of Pediatrics, Hospital Universitario Infanta Elena, 28342, Madrid, Spain 10 Human Genetics Group, Human Cancer Genetics Programme, Spanish National Cancer Research Centre (CNIO), Madrid, 28029, Spain CORRESPONDING AUTHOR INFORMATION Dr Anna González-Neira Human Genotyping Unit-CeGen, Human Cancer Genetics Programme, Spanish National Cancer Centre, Melchor Fernández Almagro 3, Madrid 28029, Spain.
[Show full text]