DOCSLIB.ORG

Gentian Violet (APRD00998)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Gentian Violet (APRD00998) Home Browse PharmaBrowse ChemQuery Text Query SeqSearch Data Extractor Download Search DrugBank for: Search DrugBank Gentian Violet (APRD00998) Show Similar Structure(s) for Approved Drugs Creation Date 2005/12/21 02:59:09 GMT Last Update Feb 01, 2007 Accession Number APRD00998 Generic Name Gentian Violet 1. Adergon 2. Aizen Crystal Violet 3. Aizen Crystal Violet Extra Pure 4. Aniline Violet 5. Aniline Violet pyoktanine 6. Atmonil 7. Avermin 8. Axuris 9. Badil 10. Basic Violet 3 11. Basic Violet BN 12. Basic Violet-3 13. Bismuth Violet 14. Brilliant Violet 5B 15. C.I. Basic Violet 3 16. Calcozine Violet 6BN 17. Calcozine Violet C 18. Crystal Violet 19. Crystal Violet 10B 20. Crystal Violet 5BO 21. Crystal Violet 6B Brand 22. Crystal Violet 6BO Names/Synonyms 23. Crystal Violet AO 24. Crystal Violet AON 25. Crystal Violet BP 26. Crystal Violet BPC 27. Crystal Violet Extra Pure 28. Crystal Violet Extra Pure APN 29. Crystal Violet Extra Pure APNX 30. Crystal Violet FN 31. Crystal Violet HL2 32. Crystal Violet O 33. Crystal Violet Pure DSC 34. Crystal Violet Pure DSC Brilliant 35. Crystal Violet SS 36. Crystal Violet Technical 37. Crystal Violet USP 38. Crystal Violet base 39. Crystal Violet chloride 40. Crystal Violet chloride salt 41. GV-Eleven 42. Genapax 43. Gentersal 44. Gentiaverm 45. Genticid 46. Gentioletten 47. Gvs 48. Hecto Violet R 49. Hectograph Violet SR 50. Hexamethyl Violet 51. Hexamethylpararosaniline chloride 52. Hidaco Brilliant Crystal Violet 53. Hidaco crystal Violet 54. Meroxyl-Wander 55. Meroxylan-Wander 56. Methyl Violet 10B 57. Methyl Violet 10BD 58. Methyl Violet 10BK 59. Methyl Violet 10BN 60. Methyl Violet 10BNS 61. Methyl Violet 10BO 62. Methyl Violet 5BNO 63. Methyl Violet 5BO 64. Methyl Violet 6B 65. Methyl violet 66. Methylrosaniline chloride 67. Mitsui Crystal Violet 68. Oxiuran 69. Oxycolor 70. Oxyozyl 71. Paper Blue R 72. Plastoresin Violet 5BO 73. Pyoktanin 74. Vermicid 75. Vianin 76. Viocid 77. Violet 5BO 78. Violet 6BN 79. Violet CP 80. Violet XXIII 81. crystal violet for microscopy 82. gentian violet gr 83. gention violet alchoholic staining solution 84. methylrosanilinium chloride 1. Blu Kote Dr Naylors (Acriflavine + Gentian Violet + Glycerine + Isopropyl Alcohol + Sodium Propionate + Urea) 2. Blue Lotion (Gentian Violet + Methylene Blue + Tannic Acid) 3. Co-Op Pinkeye Spray (Gentian Violet + Neomycin (Neomycin Sulfate)) 4. Cristisol (Acriflavine + Gentian Violet + Isopropyl Alcohol) 5. Pink Eye Guard (Allantoin + Boric Acid + Gentian Violet) Brand Name Mixtures 6. Pink Eye Spray (Furfural + Gentian Violet + Isopropyl Alcohol + Methylene Blue + Phenylmercuric Nitrate (Basic) + Tetrahydrofurfuryl Alcohol + Urea) 7. Pinkeye Spray (Gentian Violet + Neomycin (Neomycin Sulfate)) 8. Triple Dye (Brilliant Green + Gentian Violet + Proflavine Hemisulfate) 9. Wound & Pinkeye Spray (Gentian Violet + Neomycin (Neomycin Sulfate)) 10. Wound Kote Gentian Violet Spray Wound Dre (Acriflavine + Furfural + Methyl Violet + Sodium Propionate + Urea) Chemical IUPAC Name [4-[bis(4-dimethylaminophenyl)methylidene]-1-cyclohexa-2,5-dienylidene]-dimethyl-azanium Chemical Formula C25 H30 N3+ Chemical Structure CAS Registry Number 14426-25-6 InChI=1/C25H30N3/c1-26(2)22-13-7-19(8-14-22)25(20-9-15-23(16-10-2 InChi Identifier 0)27(3)4)21-11-17-24(18-12-21)28(5)6/h7-18H,1-6H3/q+1 KEGG Compound ID D01046 Substance: 538591 PubChem ID Compound: 3468 ChEBI ID Not Available PharmGKB ID PA449755 HET ID Not Available SwissProt ID Not Available GenBank ID Not Available Drug ID Number [DIN] 00050857 RxList Link Not Available FDA Label Not Available Material Safety Data Click Here for MSDS File (html) Sheet (MSDS) Synthesis Reference Not Available Molecular Weight 372.526 g/mol Melting Point 215 °C H2O Solubility 4 mg/mL State Solid LogP/Hydrophobicity 3.18 pKa/Isoelectric Point Not Available NMR Spectrum Not Available Mass Spectrum Not Available MOL File Image View 2D Structure MOL File Text Click Here for MOL File SDF File Click Here for SDF File PDB File Calculated Not Available Image PDB File Calculated Not Available Text PDB Experimental ID Not Available Smiles String CN(C)C1=CC=C(C=C1)C(=C2C=CC(=[N+](C)C)C=C2)C3=CC=C(C=C3)N(C)C Drug Type Approved Drug Drug Category Anti-Infective Agents, Local For the treatment of bacterial and fungal infections inside the mouth (thrush) and skin, also Indication for the prevention of transmission of Chagas' disease (as a blood additive). Gentian violet is a mutagen, a mitotic poison, and a clastogen. Gentian violet has been used in medicine for almost 100 years: as an antiseptic for external use, as a topical antibiotic, as a topical antifungal agent, as an antihelminthic agent by oral administration, and more Pharmacology recently, as a blood additive to prevent transmission of Chagas' disease. It is thought to work by binding to the DNA of target organisms and causing disruption, mutation or inhibition of DNA replication. In aqueous solutions Gentian violet (GV) dissociates into positive (GV+)and negative ions (Cl-) that penetrate through the wall and membrane of both gram-positive and gram-negative bacterial cells. The GV+ interacts with negatively charged components of bacterial cells including the lipopolysaccharide (on the cell wall), the peptidoglycan and DNA. A similar cell penetration and DNA binding process is thought to take place for fungal cells as well. Because Gentian violet is a mutagen and mitotic poison, cell growth is consequently Mechanism of Action inhibited. A photodynamic action of gentian violet, apparently mediated by a free-radical mechanism, has recently been described in bacteria and in the protozoan T. cruzi. Evidence also suggests that gentian violet dissipates the bacterial (and mitochondrial) membrane potential by inducing permeability. This is followed by respiratory inhibition. This anti-mitochondrial activity might explain gentian violet's efficacy towards both bacteria and yeast with relatively mild effects on mammalian cells. Absorption Not Available LD =420 mg/kg (rat, oral). Oral administration can cause gastrointestinal irritation, and Toxicity 50 intravenous injection can cause depression in the white blood cell count. Protein Binding Not Available Biotransformation Primarily hepatic, mostly demethylation Half Life Not Available Liquid Dosage Forms Tincture Patient Information Not Available Interactions Not Available Contraindications Not Available Drug Reference http://www.pharmgkb.org/views/index.jsp?objId=PA449755&objCls=Drug Organisms Affected Yeast and other fungi, bacteria and protozoans Phase 1 Metabolizing Not Available Enzyme Phase 1 Metabolizing Not Available Enzyme Sequence Phase 1 Metabolizing Not Available Enzyme SwissProt ID Drug Target 1 Drug Target 1 Name DNA Drug Target 1 Gene Not Applicable Name Drug Target 1 Deoxyribonucleic acid Synonyms Drug Target 1 Protein > Dickerson dodecamer Sequence CGCGAATTCGCG(example) Drug Target 1 Number 12 of Residues Drug Target 1 7656 (double stranded) g/mol Molecular Weight Drug Target 1 Not Available Theoretical pI Function: information storage Function: information transfer || Biological process: DNA replication and chromosomal cycle Biological process: DNA replication Biological process: DNA-dependent DNA replication Drug Target 1 GO Biological process: DNA replication, synthesis of RNA primer Classification Biological process: transcription Biological process: transcription, DNA dependent || Cellular component: cell Cellular component: intracellular Cellular component: nucleus Cellular component: mitochondria Drug Target 1 General Biological information storage and information transfer Function DNA is the molecule of heredity, as it is responsible for the genetic propagation of most inherited traits. It is a polynucleic acid that carries genetic information on cell growth, division, and function. DNA consists of two long strands of nucleotides twisted into a double Drug Target 1 Specific helix and held together by hydrogen bonds. The sequence of nucleotides determines Function hereditary characteristics. Each strand serves as the template for subsequent DNA replication and as a template for mRNA production, leading to protein synthesis via ribosomes. Map03030 DNA replication Drug Target 1 Pathway Map03020 RNA transcription DNA + DNA polymerase + nNTP = 2 DNA + nNDP ; DNA + RNA polymerase + NTP = Drug Target 1 Reaction mRNA + nNDP Drug Target 1 Pfam None Domain Function Drug Target 1 Signals None Drug Target 1 Transmembrane None Regions Drug Target 1 Essential Essentiality Drug Target 1 GenBank Not Applicable ID Protein Drug Target 1 Not Applicable SwissProt ID Drug Target 1 PDB ID 1BNA Drug Target 1 3D Click for PDB File Structure Text Drug Target 1 3D View 3D Structure Structure Image Drug Target 1 Cellular Nucleus and mitochondria Location Drug Target 1 Gene > DNA, Dickerson dodecamer Sequence CGCGAATTCGCG Drug Target 1 GenBank Not Applicable ID Gene Drug Target 1 All chromosomes Chromosome Location Drug Target 1 Locus All loci Drug Target 1 SNPs Not Available Drug Target 1 15556400 References Last Update: Nov 06, 2006.
Load more

Recommended publications
  • Therapeutic Potential of Nicotinamide Adenine Dinucleotide (NAD) T ∗ Marta Arenas-Jala,B, , J.M
    European Journal of Pharmacology 879 (2020) 173158 Contents lists available at ScienceDirect European Journal of Pharmacology journal homepage: www.elsevier.com/locate/ejphar Therapeutic potential of nicotinamide adenine dinucleotide (NAD) T ∗ Marta Arenas-Jala,b, , J.M. Suñé-Negrea, Encarna García-Montoyaa a Pharmacy and Pharmaceutical Technology Department (Faculty of Pharmacy and Food Sciences), University of Barcelona, Barcelona, Spain b ICN2 – Catalan Institute of Nanoscience and Nanotechnology (Autonomous University of Barcelona), Bellaterra (Barcelona), Spain ARTICLE INFO ABSTRACT Keywords: Nicotinamide adenine nucleotide (NAD) is a small ubiquitous hydrophilic cofactor that participates in several NAD aspects of cellular metabolism. As a coenzyme it has an essential role in the regulation of energetic metabolism, Metabolism but it is also a cosubstrate for enzymes that regulate fundamental biological processes such as transcriptional Therapeutic potential regulation, signaling and DNA repairing among others. The fluctuation and oxidative state of NAD levels reg- Drug discovery ulate the activity of these enzymes, which is translated into marked effects on cellular function. While alterations Supplementation in NAD homeostasis are a common feature of different conditions and age-associated diseases, in general, in- creased NAD levels have been associated with beneficial health effects. Due to its therapeutic potential, the interest in this molecule has been renewed, and the regulation of NAD metabolism has become an attractive target for drug discovery. In fact, different approaches to replenish or increase NAD levels have been tested, including enhancement of biosynthesis and inhibition of NAD breakdown. Despite further research is needed, this review provides an overview and update on NAD metabolism, including the therapeutic potential of its regulation, as well as pharmacokinetics, safety, precautions and formulation challenges of NAD supplementa- tion.
    [Show full text]
  • Metabolic-Hydroxy and Carboxy Functionalization of Alkyl Moieties in Drug Molecules: Prediction of Structure Influence and Pharmacologic Activity
    molecules Review Metabolic-Hydroxy and Carboxy Functionalization of Alkyl Moieties in Drug Molecules: Prediction of Structure Influence and Pharmacologic Activity Babiker M. El-Haj 1,* and Samrein B.M. Ahmed 2 1 Department of Pharmaceutical Sciences, College of Pharmacy and Health Sciences, University of Science and Technology of Fujairah, Fufairah 00971, UAE 2 College of Medicine, Sharjah Institute for Medical Research, University of Sharjah, Sharjah 00971, UAE; [email protected] * Correspondence: [email protected] Received: 6 February 2020; Accepted: 7 April 2020; Published: 22 April 2020 Abstract: Alkyl moieties—open chain or cyclic, linear, or branched—are common in drug molecules. The hydrophobicity of alkyl moieties in drug molecules is modified by metabolic hydroxy functionalization via free-radical intermediates to give primary, secondary, or tertiary alcohols depending on the class of the substrate carbon. The hydroxymethyl groups resulting from the functionalization of methyl groups are mostly oxidized further to carboxyl groups to give carboxy metabolites. As observed from the surveyed cases in this review, hydroxy functionalization leads to loss, attenuation, or retention of pharmacologic activity with respect to the parent drug. On the other hand, carboxy functionalization leads to a loss of activity with the exception of only a few cases in which activity is retained. The exceptions are those groups in which the carboxy functionalization occurs at a position distant from a well-defined primary pharmacophore. Some hydroxy metabolites, which are equiactive with their parent drugs, have been developed into ester prodrugs while carboxy metabolites, which are equiactive to their parent drugs, have been developed into drugs as per se.
    [Show full text]
  • Drugbank 3.0: a Comprehensive Resource for 'Omics' Research On
    Published online 8 November 2010 Nucleic Acids Research, 2011, Vol. 39, Database issue D1035–D1041 doi:10.1093/nar/gkq1126 DrugBank 3.0: a comprehensive resource for ‘Omics’ research on drugs Craig Knox1, Vivian Law2, Timothy Jewison1, Philip Liu3, Son Ly2, Alex Frolkis1, Allison Pon1, Kelly Banco2, Christine Mak2, Vanessa Neveu1, Yannick Djoumbou3, Roman Eisner1, An Chi Guo1 and David S. Wishart1,2,3,4,* 1Department of Computing Science, University of Alberta, Edmonton, AB, Canada T6G 2E8, 2Faculty of Pharmacy and Pharmaceutical Sciences, University of Alberta, Edmonton, AB, Canada T6G 2N8, 3Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada T6G 2E8 and 4National Institute for Nanotechnology, 11421 Saskatchewan Drive, Edmonton, AB, Canada T6G 2M9 Received September 15, 2010; Revised October 20, 2010; Accepted October 21, 2010 ABSTRACT drug target, drug description and drug action data. DrugBank (http://www.drugbank.ca) is a richly DrugBank 3.0 represents the result of 2 years annotated database of drug and drug target infor- of manual annotation work aimed at making mation. It contains extensive data on the nomencla- the database much more useful for a wide ture, ontology, chemistry, structure, function, range of ‘omics’ (i.e. pharmacogenomic, action, pharmacology, pharmacokinetics, metabol- pharmacoproteomic, pharmacometabolomic and ism and pharmaceutical properties of both small even pharmacoeconomic) applications. molecule and large molecule (biotech) drugs. It also contains comprehensive information on the INTRODUCTION target diseases, proteins, genes and organisms on which these drugs act. First released in 2006, Historically most of the known information on drugs, DrugBank has become widely used by pharmacists, drug targets and drug action has resided in books, medicinal chemists, pharmaceutical researchers, journals and expensive commercial databases.
    [Show full text]
  • Smart Drugs: a Review
    International Journal for Innovation Education and Research www.ijier.net Vol:-8 No-11, 2020 Smart Drugs: A Review Sahjesh Soni, Dr Rashmi Srivastava, Ayush Bhandari Mumbai Educational Trust, India Abstracts Smart drugs can change the way our mind functions. Smart drugs are also known as nootropics, which literally means the ability to bend or shape our mind. Smart drugs are classified into two main categories. They are classified based on their pharmacological action and their availability. The stimulant category of drugs is highly used and misused. There has been a rampant increase in the sale of smart drugs, which could be attributed to the rise in competition all over the world. Two major criteria for selecting a good drug are its mechanism of action and bioavailability. Owing to the short-term benefits of smart drugs, many countries have openly accepted this concept. There is still no concrete scientific evidence backing the safety and efficacy of these drugs. Some believe that this is just a fad that will soon pass, while others believe that this is something that will revolutionize our future. Key Words: Smart drugs, Nootropics, Cognitive enhancers, Stimulants, Uses and Side effects. What are Smart Drugs? "Smart drugs" are a group of compounds that can promote brain performance. They have got a lot of attention due to our stressful lifestyle, and these drugs help to boost our memory, focus, creativity, intelligence, and motivation. The origin of the word comes from the Greek language meaning “to bend or shape the mind”.1 These chemicals have many mechanisms of action.
    [Show full text]
  • Drug Knowledge Bases and Their Applications in Biomedical Informatics Research Yongjun Zhu, Olivier Elemento, Jyotishman Pathak and Fei Wang
    Briefings in Bioinformatics, 2018, 1–14 doi: 10.1093/bib/bbx169 Paper Drug knowledge bases and their applications in biomedical informatics research Yongjun Zhu, Olivier Elemento, Jyotishman Pathak and Fei Wang Corresponding author: Fei Wang, Division of Health Informatics, Department of Healthcare Policy and Research at Weill Cornell Medicine at Cornell University, 425 East 61st Street, Suite 301, DV-308, New York, NY 10065, USA. E-mail: [email protected] Abstract Recent advances in biomedical research have generated a large volume of drug-related data. To effectively handle this flood of data, many initiatives have been taken to help researchers make good use of them. As the results of these initiatives, many drug knowledge bases have been constructed. They range from simple ones with specific focuses to comprehensive ones that contain information on almost every aspect of a drug. These curated drug knowledge bases have made significant contributions to the development of efficient and effective health information technologies for better health-care service delivery. Understanding and comparing existing drug knowledge bases and how they are applied in various biomedical studies will help us recognize the state of the art and design better knowledge bases in the future. In addition, researchers can get insights on novel applications of the drug knowledge bases through a review of successful use cases. In this study, we provide a review of existing popular drug knowledge bases and their applications in drug-related studies. We discuss challenges in constructing and using drug knowledge bases as well as future research directions toward a better ecosystem of drug knowledge bases.
    [Show full text]
  • Computational Drug Repurposing Algorithm Targeting TRPA1 Calcium Channel As a Potential Therapeutic Solution for Multiple Sclerosis
    Supplementary Materials: Computational Drug Repurposing Algorithm Targeting TRPA1 Calcium Channel as a Potential Therapeutic Solution for Multiple Sclerosis Dragos Paul Mihai, George Mihai Nitulescu *, George Nicolae Daniel Ion, Cosmin Ionut Ciotu, Cornel Chirita, and Simona Negres Table S1. Descriptive statistics for pIC50 and druglikeness-related descriptors for the TRPA1 inhibitors set. Descriptor Range Minimum Maximum Mean ± SD pIC50 (M) 4.48 4.52 9.00 6.57 ± 1.01 ALogP 8.28 −0.71 7.57 4.02 ± 1.34 Molecular weight 482.03 175.10 657.13 389.70 ± 101.73 Polar surface area 193.59 17.82 211.41 82.80 ± 40.83 Rotatable bonds 12 1 13 5.01 ± 2.08 Hydrogen bonds acceptors 8 0 8 2.92 ± 1.46 Hydrogen bonds donors 3 0 3 1.06 ± 0.54 SD – standard deviation. Figure S1. Diagram of similarity/activity cliffs based on flexophores with 80% similarity within TRPA1 inhibitors. Larger dots indicate the presence of an activity cliff. Figure S2. Representative structures for similarity/activity cliffs analysis of TRPA1 inhibitors. Table S2. Highest similarity pairs between TRPA1 inhibitors and screened drugs based on flexophore descriptors data mining procedure. TRPA1 inhibitors Repurposing dataset Entry Similarity (ChEMBL ID) (DrugBank ID) 1 CHEMBL3298238 DB08135 0.9832 2 CHEMBL3220230 DB08561 0.9696 3 CHEMBL3220228 DB08561 0.9614 4 CHEMBL593902 DB07311 0.9553 5 CHEMBL3297780 DB01065 0.9533 6 CHEMBL3220448 DB08561 0.9509 Figure S3. Diagram of similarity/activity cliffs based on flexophores with 80% similarity threshold for merged TRPA1 inhibitors dataset (colored dots) and similar DrugBank entries (grey dots). Table S3.
    [Show full text]
  • Package 'Dbparser'
    Package ‘dbparser’ August 26, 2020 Title 'DrugBank' Database XML Parser Version 1.2.0 Description This tool is for parsing the 'DrugBank' XML database <https://www.drugbank.ca/>. The parsed data are then returned in a proper 'R' dataframe with the ability to save them in a given database. License MIT + file LICENSE Encoding UTF-8 LazyData true Imports DBI, dplyr, odbc, progress, purrr, readr, RMariaDB, RSQLite, tibble, tools, XML RoxygenNote 7.1.0 Suggests knitr, rmarkdown, testthat VignetteBuilder knitr URL https://docs.ropensci.org/dbparser/, https://github.com/ropensci/dbparser/ BugReports https://github.com/ropensci/dbparser/issues Depends R (>= 2.10) NeedsCompilation no Author Mohammed Ali [aut, cre], Ali Ezzat [aut], Hao Zhu [rev], Emma Mendelsohn [rev] Maintainer Mohammed Ali <[email protected]> Repository CRAN Date/Publication 2020-08-26 12:10:03 UTC 1 2 R topics documented: R topics documented: articles . .3 attachments . .5 books . .8 cett.............................................. 10 cett_actions_doc . 12 cett_doc . 14 cett_ex_identity_doc . 17 cett_go_doc . 19 cett_poly_doc . 21 cett_poly_pfms_doc . 24 cett_poly_syn_doc . 26 dbparser . 28 drugs . 29 drug_affected_organisms . 31 drug_ahfs_codes . 33 drug_atc_codes . 35 drug_calc_prop . 36 drug_categories . 38 drug_classification . 40 drug_dosages . 42 drug_element . 44 drug_element_options . 46 drug_exp_prop . 47 drug_external_links . 49 drug_ex_identity . 51 drug_food_interactions . 53 drug_general_information . 54 drug_groups . 57 drug_interactions . 58 drug_intern_brand
    [Show full text]
  • Drug Repositioning: New Approaches and Future Prospects for Life-Debilitating Diseases and the COVID-19 Pandemic Outbreak
    viruses Review Drug Repositioning: New Approaches and Future Prospects for Life-Debilitating Diseases and the COVID-19 Pandemic Outbreak Zheng Yao Low 1 , Isra Ahmad Farouk 1 and Sunil Kumar Lal 1,2,* 1 School of Science, Monash University, Bandar Sunway, Subang Jaya 47500, Selangor Darul Ehsan, Malaysia; [email protected] (Z.Y.L.); [email protected] (I.A.F.) 2 Tropical Medicine & Biology Platform, Monash University, Subang Jaya 47500, Selangor Darul Ehsan, Malaysia * Correspondence: [email protected] Received: 3 July 2020; Accepted: 21 August 2020; Published: 22 September 2020 Abstract: Traditionally, drug discovery utilises a de novo design approach, which requires high cost and many years of drug development before it reaches the market. Novel drug development does not always account for orphan diseases, which have low demand and hence low-profit margins for drug developers. Recently, drug repositioning has gained recognition as an alternative approach that explores new avenues for pre-existing commercially approved or rejected drugs to treat diseases aside from the intended ones. Drug repositioning results in lower overall developmental expenses and risk assessments, as the efficacy and safety of the original drug have already been well accessed and approved by regulatory authorities. The greatest advantage of drug repositioning is that it breathes new life into the novel, rare, orphan, and resistant diseases, such as Cushing’s syndrome, HIV infection, and pandemic outbreaks such as COVID-19. Repositioning existing drugs such as Hydroxychloroquine, Remdesivir, Ivermectin and Baricitinib shows good potential for COVID-19 treatment. This can crucially aid in resolving outbreaks in urgent times of need.
    [Show full text]
  • Home Browse Drug Browse Pharma Browse Geno Browse Reaction
    13/12/13 DrugBank: Asparaginase (DB00023) Home Browse Drug Browse Pharma Browse Geno Browse Reaction Browse Pathway Browse Class Browse Association Browse Search ChemQuery Text Query Interax Interaction Search Sequence Search Data Extractor Downloads About About DrugBank Statistics Other Databases Data Sources News Archive Wishart Research Group Help Citing DrugBank DrugCard Documentation Searching DrugBank Tools Human Metabolome Database T3DB Toxin Database Small Molecule Pathway Database FooDB Food Component Database More Contact Us DrugBank version 4.0 beta is now online for public preview! Take me to the beta site now. Search: Search DrugBank Search Help / Advanced Identification Taxonomy Pharmacology Pharmacoeconomics Properties References Interactions 0 Comments targets (1) Identification Name Asparaginase Accession Number DB00023 (BIOD00011, BTD00011) Type biotech Groups approved Description L-asparagine amidohydrolase from E. coli www.drugbank.ca/drugs/DB00023#identification 1/4 13/12/13 DrugBank: Asparaginase (DB00023) Protein structure Display: 3D Structure Protein chemical C H N O S formula 1377 2208 382 442 17 Protein average 31731.9000 weight >DB00023 sequence QMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPLFNAGIGAVFTRDE THELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGEGAENFAFARGMER VSPEIFSTSLRYEQLLAARKEGATVLDHSGAPLDEKQKMGTVGAVALDLDGNLAAATSTG Sequences GMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRALAAYDIAALMDYGGLSLAE ACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAWGYAGDTPTTGIYREKGDTV ATQ FASTA L-asparagine amidohydrolase Synonyms Putative
    [Show full text]
  • Safety Data Sheet: Brilliant Green (C.I. 42040)
    Safety data sheet according to Regulation (EC) No. 1907/2006 (REACH), amended by 2015/830/EU Brilliant green (C.I. 42040) for microscopy article number: 0324 date of compilation: 2020-01-28 Version: 1.0 en SECTION 1: Identification of the substance/mixture and of the company/ undertaking 1.1 Product identifier Identification of the substance Brilliant green (C.I. 42040) Article number 0324 Registration number (REACH) It is not required to list the identified uses be- cause the substance is not subject to registration according to REACH (< 1 t/a) EC number 211-190-1 CAS number 633-03-4 1.2 Relevant identified uses of the substance or mixture and uses advised against Identified uses: laboratory chemical laboratory and analytical use 1.3 Details of the supplier of the safety data sheet Carl Roth GmbH + Co KG Schoemperlenstr. 3-5 D-76185 Karlsruhe Germany Telephone: +49 (0) 721 - 56 06 0 Telefax: +49 (0) 721 - 56 06 149 e-mail: [email protected] Website: www.carlroth.de Competent person responsible for the safety data : Department Health, Safety and Environment sheet: e-mail (competent person): [email protected] 1.4 Emergency telephone number Name Street Postal code/city Telephone Website National Poisons In- Dudley Rd B187QH Birmingham 844 892 0111 formation Service City Hospital Emergency information service +49/(0)89 19240 SECTION 2: Hazards identification 2.1 Classification of the substance or mixture Classification according to Regulation (EC) No 1272/2008 (CLP) Classification acc. to GHS Section Hazard class Hazard class and cat- Hazard egory state- ment 3.1O acute toxicity (oral) (Acute Tox.
    [Show full text]
  • Potential Herb–Drug Interactions in the Management of Age-Related Cognitive Dysfunction
    pharmaceutics Review Potential Herb–Drug Interactions in the Management of Age-Related Cognitive Dysfunction Maria D. Auxtero 1, Susana Chalante 1,Mário R. Abade 1 , Rui Jorge 1,2,3 and Ana I. Fernandes 1,* 1 CiiEM, Interdisciplinary Research Centre Egas Moniz, Instituto Universitário Egas Moniz, Quinta da Granja, Monte de Caparica, 2829-511 Caparica, Portugal; [email protected] (M.D.A.); [email protected] (S.C.); [email protected] (M.R.A.); [email protected] (R.J.) 2 Polytechnic Institute of Santarém, School of Agriculture, Quinta do Galinheiro, 2001-904 Santarém, Portugal 3 CIEQV, Life Quality Research Centre, IPSantarém/IPLeiria, Avenida Dr. Mário Soares, 110, 2040-413 Rio Maior, Portugal * Correspondence: [email protected]; Tel.: +35-12-1294-6823 Abstract: Late-life mild cognitive impairment and dementia represent a significant burden on health- care systems and a unique challenge to medicine due to the currently limited treatment options. Plant phytochemicals have been considered in alternative, or complementary, prevention and treat- ment strategies. Herbals are consumed as such, or as food supplements, whose consumption has recently increased. However, these products are not exempt from adverse effects and pharmaco- logical interactions, presenting a special risk in aged, polymedicated individuals. Understanding pharmacokinetic and pharmacodynamic interactions is warranted to avoid undesirable adverse drug reactions, which may result in unwanted side-effects or therapeutic failure. The present study reviews the potential interactions between selected bioactive compounds (170) used by seniors for cognitive enhancement and representative drugs of 10 pharmacotherapeutic classes commonly prescribed to the middle-aged adults, often multimorbid and polymedicated, to anticipate and prevent risks arising from their co-administration.
    [Show full text]
  • (12) United States Patent (10) Patent No.: US 9,474,729 B2 Grigorian Et Al
    US009474729B2 (12) United States Patent (10) Patent No.: US 9,474,729 B2 Grigorian et al. (45) Date of Patent: *Oct. 25, 2016 (54) TOPCAL ANTIMICROBAL (56) References Cited COMPOSITIONS AND METHODS OF USING SAME U.S. PATENT DOCUMENTS 4,548,807 A * 10/1985 Westfall et al. ................ 424/45 (75) Inventors: Irina Grigorian, Bridgewater, NJ (US); 5,000,954. A * 3/1991 Stadtmueller ...... ... 424f770 Manfred F. Dyck, Far Hills, NJ (US); 5,763,412 A * 6/1998 Khan et al. ..................... 514, 23 Rainer Gruening, Basking Ridge, NJ 5,774,909 A * 7/1998 Stable ............................... 4,622 5,780,064 A * 7/1998 Meisters et al. ... ... 424,616 (US) 6,168,794 B1* 1/2001 Reusser et al. ............... 424,769 6,458,391 B1 10/2002 Reusser et al. (73) Assignee: HYDROMER, INC., Branchburg, NJ 6,699,510 B2 3/2004 McSherry et al. 2003/0078242 A1 4/2003 Raad et al. (US) 2005, OO13836 A1 1/2005 Raad 2005/O197634 A1 9, 2005 Raad et al. (*) Notice: Subject to any disclaimer, the term of this 2005/0226826 A1 10, 2005 Eason et al. patent is extended or adjusted under 35 2006, OO62829 A1 3/2006 Simonson et al. U.S.C. 154(b) by 169 days. 2007/0027119 A1 2/2007 Ahmed et al. ................ 514f159 2007/OO74672 A1 4/2007 Torgerson et al. This patent is Subject to a terminal dis 2007/0167379 A1* 7, 2007 Hacket et al. .................. 514, 28 claimer. 2007/0298.085 Al 12/2007 Lestage et al. 2008/0145390 A1* 6/2008 Taylor et al.
    [Show full text]