A
DETAILS OF THE PARTICIPANTS
A M Publishers and Distributors Pvt. Ltd. HALL 7/31, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9311196013 STALL 255-272 E: [email protected] Contact: Ishwar Rawat Publishers of literary books in Hindi language.
APC Books HALL 1002, Faiz Road, Karol Bagh, New Delhi - 110005 Delhi 8-11 M: 9560777001 STALL 333-341 E: [email protected] W: www.apcbooks.co.in Contact: Arnav Distributors of books across genres.
Aadarsh Private Limited HALL Shikhar Varta, 4 Press Complex, Zone 1, MP Nagar, Bhopal - 462011 7D, 7F-H Madhya Pradesh STALL 29-31 M: 9755504005 E: [email protected] W: www.aadarsh.com Contact: Pradeep Batham Manufacturers of talking books, religious books, children’s educational books, notebooks, stationeries, school bags and other school products.
Aadhar Prakashan Pvt. Ltd. HALL SCF 267, Sector 16, Panchkula - 134113 Haryana 12A M: 9417267004 STALL 49-50 E: [email protected] W: www.aadharprakashan.com Contact: Desh Nirmohi Publishers of books on literature, history, sociology, philosophy, management and banking in Hindi language. A FAIR DIRECTORY 2
Aadi Publication House HALL 33 B, Suvidhi Nagar, Indore - 452006 Madhya Pradesh 7D, 7F-H M: 7771883908 STALL 119 E: [email protected] Contact: Sunil Mehta Publishers of a wide range of books for pre-school, primary and middle school children and young adults.
Aadya Publication and Distribution HALL 20B, British India Street, Fifth Floor, Room No 21, Kolkata - 700069 12A West Bengal STALL 7 M: 9830090698 E: [email protected] Contact: Anup Publishers and distributors of books in Hindi literature.
Aakar Books HALL 28E, Pocket IV, Mayur Vihar Phase 1, Delhi - 110091 Delhi 8-11 M: 9810185228 STALL 182 E: [email protected] W: www.aakarbooks.com Contact: Amit Saxena Distributors, library suppliers and publishers of books on social sciences.
Aarti Playgroup Solution HALL HALL 1706, Gali No 3, Govindpuri Extn, Near Vishal Megamart, Kalkaji, 8-11 7D, 7F-H New Delhi - 110019 Delhi STALL STALL 294 123 M: 9910262782 E: [email protected] Contact: Shashi Bhushan Kumar Manufacturers of wooden educational aids.
Abhishek Publications HALL B-1A-40A, Janak Puri, New Delhi - 110058 Delhi 7D, 7F-H M: 9810283757 STALL 170-171 E: [email protected] Contact: Abhishek Bajaj Distributors of a wide range of children’s books from Geronimo Stilton to Wimpy Kid. 3 NEW DELHI WORLD BOOK FAIR 2020 A
Academic India Publishers HALL 18 Rajendra Place, New Delhi - 110008 Delhi 8-11 M: 8860202249 STALL 239 E: [email protected] W: www.academicindiapublishers.com Contact: Amber Raj Chowdhry Publishers of children’s books, story books, activity, colouring and sticker books as well as manufacturers of board games for children.
Adarsh Pustak Sadan HALL H-604, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 9311196030 STALL 273-280 E: [email protected] Contact: Amod Kumar Publishers of literary works in Hindi.
Adhikaran Prakashan HALL House No 133, Gali No-14, First Floor, B-Block, Khajoori Khas, 12A Delhi - 110094 Delhi STALL 14 M: 9716927587 E: [email protected] Contact: Manish Kumar Sinha Publishers of books in Hindi language.
Adhunik Sahitya Sadan HALL G-17A, Second Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 8376074278 STALL 273-280 E: [email protected] Contact: Ajay Singh Publishers of literary books in Hindi language.
Adwait Prakashan HALL E17, Panchsheel Garden, Naveen Shahdara, Delhi - 110032 Delhi 12A M: 9971895162 STALL 162-165 E: [email protected] Contact: Aditya Maheshwari Publishers of books in Hindi language. A FAIR DIRECTORY 4
Agam Kala Prakashan HALL 34, Central Market, Ashok Vihar, Phase -1, Delhi - 110052 Delhi 8-11 M: 9213218061 STALL 561 E: [email protected] W: www.agamkala.com Contact: Ashok Kumar Pandey Deals in books across genres including indology, archaeology, art & architecture, tourism, culture & religion, sculpture, iconography, anthropology, rock art, conservation & museums, epigraphy, numismatics & inscriptions, Buddhism, Hinduism & Jainism, dance & music, folk art, history, social science & humanities, etc.
Aggarwal Book Center HALL 176 C, Paschim Vihar Extn., New Delhi - 110063 Delhi 8-11 M: 9654818730 STALL 12 E: [email protected] Contact: Pankaj Deals in general books, English novels and children’s books.
Agrawal Publications HALL -\RWL%ORFN2SSRVLWH3RVW2IÀFH6DQMD\3ODFH$JUD 8-11 Uttar Pradesh STALL 185 M: 9258088445 E: [email protected] Contact: Krishan Kumar Publishers of books for B.Ed, M.Ed, D.El.Ed, Bachelor of Arts and 4-year integrated courses.
Ahmadiyya Muslim Jamaat Delhi HALL 53 Institutional Area, Tughlakbad, New Delhi - 110062 Delhi 12 M: 9761086628 STALL 71-72 E: [email protected] W: www.alislam.org Contact: Firoz Ahmad Publishers of Islamic books, Holy Quran and books on human rights, etc.
Ahuti Prakashan HALL 330, Main Road, Burari, Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] 5 NEW DELHI WORLD BOOK FAIR 2020 A
Contact: Ayush Gupta Publishers of educational and story books for children.
AITBS Publishers India HALL J-5/6, Krishna Nagar, Delhi - 110051 Delhi 8-11 M: 9810088977 STALL 559-560 E: [email protected] W: www.aitbspublishersindia.com Contact: Virender Kumar Arya Publishers of books on nursing, pharmacy, management, economics, science, mathematics, engineering, English literature, dentistry and medical books.
Ajmani Trader HALL B 11, Part 1, Vishnu Garden, Opp. Bansal Sweets, New Delhi - 110018 12A Delhi STALL 329 M: 8802020900 E: [email protected] Contact: Shankar Ajmani Deals in religious books.
Akhil Bharatiya Itihas Sankalan Yojana HALL Baba Saheb Apte Bhawan, Keshav Kunj, Jhandewala, New Delhi - 110055 12A Delhi STALL 62-63 T: 011-23385670 M: 8130858410 E: [email protected] W: www.abisy.org Contact: Mukesh Kumar Upadhyay An organisation with the objective to write history truthfully on the basis of facts and evidences.
Akshar Prakashan Pvt. Ltd. HALL T 23/10, DLF, Phase 3, Gurugram - 122002 Haryana 12A M: 9810622144 STALL 15 E: [email protected] Contact: Rachana Yadav Publishers of Hans , a monthly literary magazine in Hindi which was founded in 1930 by the legendary writer Premchand and, later revived in 1986 by renowned author Rajendra Yadav. A FAIR DIRECTORY 6
Akshar Publications HALL Sanjeeb Villa, J B Road, Agartala - 799001 Tripura 12A M: 9436121109 STALL 105 E: [email protected] W: www.aksharagartala.com Contact: Subhabrata Deb Publishers of books on northeast focusing on languages such as Bangla, Manipuri, English, Kokborok, etc.
Alind Pustak Sadan HALL H-604, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 9311196020 STALL 273-280 E: [email protected] Contact: Alind Publishers of Hindi literary books.
All India Nature Cure Federation HALL BM 7, West Shalimar Bagh, Delhi - 110088 Delhi 8-11 M: 9810019273 STALL 179 E: [email protected] W: www.lifehapy.org Contact: Brij Bhushan Goel Publishers and sellers of books on naturopathy and yoga in Hindi and English. Also organises seminars, health camps and educational courses.
Al-mawrid Hind Foundation HALL Lane F Mustafabad, Zainakote, HMT, Srinagar - 190012 12A Jammu and Kashmir STALL 320 M: 9808633615 E: [email protected] W: www.almawridindia.org Contact: Mohd. Asjad $OPDZULG+LQG)RXQGDWLRQLVDQRQSURÀWQRQJRYHUQPHQWDOWUXVWUHJLVWHUHGLQ India. It aims to develop and inculcate in people qualities like faith, morality, patience, knowledge, research, integrity, rationality, positive thinking, chastity and modesty.
Aman Book Center Delhi HALL 3527, NS Marg, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 8800812439 STALL 25 E: [email protected] 7 NEW DELHI WORLD BOOK FAIR 2020 A
Contact: Aman Jain Deals in novels, encyclopaedia and children’s books.
Aman Prakashan HALL 104 A, 80 C, Rambagh, Kanpur - 208012 Uttar Pradesh 12A M: 9839218516 STALL 24-25 E: [email protected] W: www.amanprakashan.com Contact: Arvind Bajpai Publishers of literary books in Hindi language.
Amar Chitra Katha Pvt. Ltd. HALL AFL House, Seventh Floor, Lok Bharati Complex, Marol Naroshi Road, 8-11 Andheri East, Mumbai - 400059 Maharashtra STALL 35-38 M: 9848112132 E: [email protected] W: www.amarchitrakatha.com Contact: Srinivas Rao Addagarla Publishers of various comic series which focus on epics, mythology, humor, visionaries and brave hearts among others in over 26 languages.
Amarsatya Prakashan HALL 109, Block -B, Preet Vihar, Delhi - 110092 Delhi 12A M: 9582117777 STALL 207-212 E: [email protected] Contact: Rajiv Sharma Publishers of literary books in Hindi language.
Amisee Educational Aids LLP HALL 715, Ground Floor, Kalkaji Extn, New Delhi - 110019 Delhi 7D, 7F-H M: 9873094518 STALL 179 E: [email protected] W: www.amiseeeduaids.com Contact: Lakshya Manaktala Publishers and distributors of children’s books.
Amity University Press HALL Amity University Campus, E- 2 Block, Sector- 125, Noida - 201303 8-11 Uttar Pradesh STALL 74-77 M: 9818644640 A FAIR DIRECTORY 8
E: [email protected] W: www.amityuniversitypress.com Contact: Sanjay Kumar Sinha Publishers of books from pre-school to higher secondary levels.
Amod Kumar Maheshwari and Sons HALL H-601, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 9311196017 STALL 255-272 E: [email protected] Contact: Munnalal Pandey Publishers of books in Hindi language.
Amod Pustak Sadan HALL H-604, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 011-23288769 STALL 273-280 E: [email protected] Contact: Amod Kumar Maheshwari Publishers of literary books in Hindi language.
Ananya Prakashan HALL E17, Panchsheel Garden, Naveen Shahdara, Shahdara, Delhi - 110032 12A Delhi STALL 161-165 M: 9971895162 E: [email protected] Contact: Aditya Maheshwari Publishers of books in Hindi language.
Angel Publishing House Pvt. Ltd. HALL 508, Rattan Jyoti Building, 18 Rajendra Place, New Delhi - 110008 8-11 Delhi STALL 108 M: 9999625766 E: [email protected] Contact: Sunil Rao Publishers of children’s and educational books.
Angoor Prakashan HALL C709, Street No 3, Ganesh Nagar II, Shakarpur, Delhi - 110092 Delhi 12A M: 9810136706 STALL 45 9 NEW DELHI WORLD BOOK FAIR 2020 A
E: [email protected] Contact: Harish Chandra Gupta Publishers and distributors of books in Hindi language.
Anideaz Media International Pvt. Ltd. HALL HALL 71/7, B-5, Third Floor, Rama Road Industrial Area, Kirti Nagar, 8-11 7D, 7F-H New Delhi - 110015 Delhi STALL STALL 563 185 M: 9810139897 E: [email protected] W: www.aniideaz.com Contact: Ashish Khurana Provides complete educational solutions in different languages.
Anjuman Prakashan HALL 942 Mutthiganj, Arya Kanya Chauraha, Allahabad - 211003 12A Uttar Pradesh STALL 170-173 M: 9453004398 E: [email protected] W: www.anjumanpublication.com Contact: Venus Kumar Kesari Publishers of books in Hindi and English languages.
Ankit Toys Manufacturing Company HALL A 16, Sector 5, Bawana Industrial Area, Bawana, Delhi - 110039 Delhi 7D, 7F-H M: 9810207080 STALL 174 E: [email protected] W: www.ankittoys.in Contact: Aayush Aggarwal Distributors and manufacturers of board games and puzzles.
Ankur Prakashan HALL G-17, Jagatpuri, Delhi - 110051 Delhi 12A M: 9311196014 STALL 255-272 E: [email protected] Contact: Pradeep Saini Publishers of books in Hindi language.
Anshika Publication HALL 330, Main Road, Burari, Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 A FAIR DIRECTORY 10
E: [email protected] Contact: Ayush Gupta Publishers of educational and story books for children.
Antika Prakashan HALL C56/ UGF-4, Shalimar Garden Extn II, Ghaziabad - 201005 12A Uttar Pradesh STALL 20-21 M: 9871856053 E: [email protected] W: www.antikaprakashan.com Contact: Gouri Nath Publishers of classical and modern literature & literary criticism in Hindi language. Also publisher of literary magazines Baya in Hindi and Antika in Maithili languages.
Anybook HALL Shri Krishna Hospital Campus, Mandu Road, Dhar - 454001 12A Madhya Pradesh STALL 170-173 M: 9971698930 E: [email protected] W: www.anybook.org Contact: Parag Agrawal Publishers of books in several languages.
Arihant Books Distributor HALL RZ 437, B/2, Raj Nagar - I, Gali No- 02, Palam Colony, 8-11 New Delhi - 110045 Delhi STALL 55-56 M: 9810833574 E: [email protected] Contact: Mahavir Jain 'HDOVLQERRNVDFURVVJHQUHVLQFOXGLQJÀFWLRQQRQÀFWLRQEXVLQHVVVFLHQFHDQG children’s books.
Arsee Publishers HALL 51 Pardabagh, Daryaganj, Near Petrol Pump, New Delhi - 110002 12A Delhi STALL 110 M: 9811225357 E: [email protected] W: www.arseepublishers.com Contact: Ranjit Singh %RRNVHOOHUVH[SRUWHUVSULQWHUVDQGSXEOLVKHUVRIÀFWLRQQRQÀFWLRQJHQHUDOERRNV textbooks, children & religious books in Punjabi, English and Hindi languages. 11 NEW DELHI WORLD BOOK FAIR 2020 A
Arsh Sahitya Prachar Trust HALL HALL Khari Bawali, Delhi - 110006 Delhi 7D, 7F-H 12A M: 9650183339 STALL STALL 62-63 151-160 E: [email protected] Contact: Sandeep Arya The Trust works towards the promotion of teachings and philosophy of Swami Dayanand.
Arts and Science Academic Publications HALL A2, Mittal Tower, Nimri Commercial Complex, Phase - IV, Ashok Vihar, 8-11 New Delhi - 110052 Delhi STALL 39-40 M: 9873739235 E: [email protected] W: www.asapglobe.com Contact: Puneet Minda Deals in electronic/digital versions of books, journals, periodicals as well as articles.
Arunodaya Prakashan HALL 21A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9811053214 STALL 233-252 E: [email protected] Contact: Arun Maheshwari Publishers of books in Hindi language.
Arya Book Depot HALL 30 Naiala, Karol Bagh, New Delhi - 110005 Delhi 12 T: 011-28751221 M: 9811111162 STALL 36-37 E: [email protected] W: www.aryabookdepot.com Contact: Puneet Gupta Publishers of educational books, textbooks and workbooks as per CBSE/ICSE curriculum on various subjects like social science, Hindi, English, mathematics, computer science, etc.
Arya Kendriya Sabha Delhi HALL 15, Hanuman Road, New Delhi - 110001 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] Contact: Sandeep Arya Publishers of books based on Arya Samaj and other Hindi literature. A FAIR DIRECTORY 12
Arya Prakashan Mandal HALL Room No-101, 4855/24, Ansari Road, Daryaganj, New Delhi - 110002 12A Delhi STALL 207-212 M: 9818345537 E: [email protected] Contact: Rajiv Sharma Publishers of books in Hindi language.
Arya Publications HALL 1002, Faiz Road, Karol Bagh, New Delhi - 110005 Delhi 8-11 M: 9810235221 STALL 333-341 E: [email protected] W: www.apcbooks.co.in Contact: Naveen Gupta Publishers of school textbooks on subjects like mathematics, social sciences and science, etc. according to CBSE/ICSE syllabus both in English and Hindi medium. Also publishes books for MBBS, BDS and other paramedical courses for undergraduate students.
Arya Publishing Company HALL 1002 Faiz Road, Karol Bagh, New Delhi - 110005 Delhi 8-11 M: 9810235221 STALL 333-341 E: [email protected] W: www.apcbooks.co.in Contact: Tushar Gupta Publishers of school textbooks on subjects like mathematics, social sciences and science, etc. according to CBSE/ICSE syllabus both in English and Hindi medium. Also publishes medical books for MBBS, BDS and other paramedical courses for undergraduate students.
Arya Samaj Janak Puri HALL A Block, Janak Puri, New Delhi - 110058 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Arya Samaj Hanuman Road HALL 15, Hanuman Road, New Delhi - 110001 Delhi 12A M: 9650183339 STALL 151-160 13 NEW DELHI WORLD BOOK FAIR 2020 A
E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Arya Samaj Kirti Nagar HALL A37, Devender Marg, Kirti Nagar, New Delhi - 110015 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Arya Samaj Naya Bans HALL Naya Bans, New Delhi - 110006 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Arya Samaj Pankha Road HALL C Block, Janak Puri, New Delhi - 110058 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Arya Samaj Preet Vihar HALL Preet Vihar, Delhi - 110092 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Arya Samaj Punjabi Bagh HALL Punjabi Bagh, New Delhi - 110026 Delhi 12A M: 9650183339 STALL 151-160 E: [email protected] A FAIR DIRECTORY 14
Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Aryan Book Seller HALL H. No. 83, Shaheed Bhagat Singh Colony, Gali No 4, Near Bharat Tailor, 12 New Sabhapur Gujran, New Delhi - 110090 Delhi STALL 75 M: 7982934882 E: [email protected] Contact: Ram Niwas Kumar Suppliers of general books.
Ashok Kumar Maheshwari and Sons HALL H-601, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 9311196022 STALL 255-272 E: [email protected] Contact: Deepak Saxena Publishers of books in Hindi language.
Association of Indian Publishers and Booksellers HALL 7/22, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12 M: 9899995000 STALL 98 E: [email protected] W: www.atlanticbooks.com Contact: Manish Kumar An organisation working towards the promotion of Indian publishing and bookselling industry.
Athena Books International HALL G 36, First Floor, Vijay Chowk, Laxmi Nagar, Delhi - 110092 Delhi 8-11 M: 9313472353 STALL 257-258 E: [email protected] Contact: Ramesh Ojha Suppliers of general books.
Atlantic Publishers Distributors Pvt. Ltd. HALL 7/22, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9811134611 STALL 424-435 E: [email protected] W: www.atlanticbooks.com 15 NEW DELHI WORLD BOOK FAIR 2020 A
Contact: Ashish Kumar Publishers and distributors of books on science & technology, management, humanities and social sciences.
Atmajaa Publishers HALL 2/6 Beharilal Ghosh Road, Nawdapara Ariadaha, Kolkata - 700057 12A West Bengal STALL 107 M: 6289457589 E: LQDUXQDYDRIÀFLDO#JPDLOFRP W: www.atmajaa.com Contact: Arunava Chatterjee 3XEOLVKHUVRIÀFWLRQQRQÀFWLRQP\WKRORJLFDODQGKLVWRULFDOERRNVLQ%DQJODDQG English languages.
Atulya Publications HALL C-5/F-2, East Joyti Nagar, Delhi - 110093 Delhi 12A M: 9971895162 STALL 162-165 E: [email protected] Contact: Aditya Maheshwari Publishers of books in Hindi language.
Authors Pride Publisher Pvt. Ltd. HALL 47B, Pocket A2, Mayur Vihar-3, Delhi - 110096 Delhi 12A M: 9810408776 STALL 317 E: [email protected] W: www.authorspridepublisher.com Contact: Aditya Tiwari Publishers of general and children’s books.
Avichal Publishing Company HALL 1002, Faiz Road, Karol Bagh, New Delhi - 110005 Delhi 8-11 M: 9810127407 STALL 333-341 E: [email protected] W: www.apcbooks.co.in Contact: Vipin Gupta Publishers of school textbooks on subjects like mathematics, social sciences and science, based on CBSE/ICSE syllabus both in English and Hindi medium. Also publishes books for MBBS, BDS and other paramedical courses for undergraduate students. B FAIR DIRECTORY 16
Ayush Prakashan HALL 330, Main Road, Burari, Delhi - 110084 Delhi 12A M: 9873723789 STALL 310 E: [email protected] Contact: Ayush Gupta Publishers of children’s educational and story books.
Ayushvedam HALL G82, D Mall, Shakti Khand-II, Indirapuram, Ghaziabad - 201014 8-11 Uttar Pradesh STALL 176 M: 9810216993 E: [email protected] W: www.ayushvedam.com Contact: Kamal Kant Anand An acupressure healing center, it also publishes books on natural health and healing.
B R Publishing Corporation HALL 4760-61/23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810441875 STALL 244-245 E: [email protected] Contact: Neeraj Mittal Publishers of books on history, art, archaeology, as well as on Buddhism and music & dance.
Bak Chakra Publishing House HALL Mrinalini Apartment 9A, Gariahat Road (South), Kolkata - 700068 8-11 West Bengal STALL 17 M: 8420310992 E: [email protected] Contact: Prasenjit Manna Publishers of books on English literature according to the syllabi of CBCS and books on economics for UGC category students.
Banyan Tree Books Pvt. Ltd. HALL 7/31, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9311196031 STALL 273-280 E: [email protected] 17 NEW DELHI WORLD BOOK FAIR 2020 B
Contact: Ashok Tyagi Publishers of literary books in Hindi language.
Benten Books HALL HALL D28, Akriti Garden, Nehru Nagar, Bhopal - 462003 8-11 12A Madhya Pradesh STALL STALL 184 184 M: 7697852440 E: [email protected] W: www.bentenbooks.com Contact: Sannidhya Narayan Agrawal Publishers of books in Hindi and English languages. Besides it promotes habit of reading through ‘Pustak Padho Abhiyaan’.
Bhagwan Shree Lakshmi Narayan Dham HALL 5/120, Sant Nirankari Colony, Delhi - 110009 Delhi 12 T: 011-27608951 STALL 20-23 E: [email protected] W: www.cosmicgrace.org Contact: Sushil Verma Publications of Bhagwan Shree Lakshmi Narayan Dham being run under the aegis of revered Brahmrishi Shree Kumar Swamiji.
Bhai Vir Singh Sahitya Sadan HALL Gole Market, New Delhi - 110001 Delhi 12A T: 011-23363510 M: 9811472462 STALL 108 E: [email protected] W: www.bvsss.org Contact: Maninder Kaur Bhai Vir Singh Sahitya Sadan was established in memory of Bhai Vir Singh, an eminent saint-poet of India. It is a premier literary and cultural organisation which also runs a reference library, bookstore and a charitable dispensary.
Bhaktivedanta Institute HALL RC/8, Raghunathpur - 700059 West Bengal 8-11 M: 9051561526 STALL 178 E: [email protected] W: www.binstitute.org Contact: Avinash Kumar $QRQSURÀWFHQWHUIRUDGYDQFHGVWXGLHVLQVFLHQFHDQGYHGDQWDGHGLFDWHGWR IDFLOLWDWLQJFRPPXQLFDWLRQEHWZHHQVFLHQWLÀFDQGUHOLJLRXVFRPPXQLWLHVRQDZLGH range of issues, through conferences, seminars and publications. B FAIR DIRECTORY 18
Bharatiya Jnanpith HALL 18 Institutional Area, Lodhi Road, New Delhi - 110003 Delhi 12A T: 011-24698417 M: 9350536020 STALL 91-92 E: [email protected] W: www.jnanpith.net Contact: Dinesh Bhatnagar Publishers of award winning books and also confers the Jnanpith Award, Moortidevi Award and Navlekhan Award to distinguished writers in Indian languages.
Bhartiya Pustak Parishad HALL 3320-21, Jatwara, NS Marg, Daryaganj, New Delhi - 110002 Delhi 12A M: 9811607086 STALL 147-150 E: [email protected] Contact: Mahesh Kumar Bhardwaj Publishers of Hindi literary books.
Bhartiya Vidya Bhavan HALL KG Marg, New Delhi - 110001 Delhi 8-11 M: 9818181391 STALL 564 E: [email protected] Contact: Vijay Bhardwaj Publishers of books across genres.
Bhavna Prakashan HALL 109A, Patparganj Village, Opp Community Centre, Delhi - 110091 Delhi 12A M: 8800139684 STALL 42-43 E: [email protected] Contact: Abid Ali 3XEOLVKHUVRIJHQHUDOERRNVDVZHOODVERRNVRQQRQÀFWLRQFXOWXUHDQGGDOLWVWXGLHVLQ Hindi and English languages.
Bhumika Prakashan HALL G-17, Jagatpuri, Delhi - 110051 Delhi 12A M: 9311196015 STALL 255-272 E: [email protected] Contact: Raghunath Publishers of literary books in Hindi language. 19 NEW DELHI WORLD BOOK FAIR 2020 B
Big Book Bazar HALL 3531, NS Marg, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810211258 STALL 167-168 E: [email protected] Contact: Sushil Jain Deals in novels, encyclopaedia and children’s books.
Bihar Hindi Granth Academy HALL Premchand Marg, Rajendra Nagar, Patna - 800016 Bihar 12A M: 9835489034 STALL 180 E: [email protected] W: www.bhga.co.in Contact: Bijendra Kumar Ojha Publishers of university level books.
Bihar Rashtra Bhasha Parishad HALL Acharya Shiv Pujan Sahay Marg, Saidpur - 800004 Delhi 12A M: 9334152020 STALL 51 E: [email protected] Contact: Satyendra Kumar A body constituted under the department of Higher Education, Government of Bihar. Publishers of books on literature in Bhojpuri, Maithili and Hindi and also a quarterly magazine.
Bloomsbury Publishing India Pvt. Ltd. HALL DDA Complex, LSC Building No.4, Second Floor, Pocket C-6&7, Vasant Kunj, 8-11 New Delhi - 110070 Delhi STALL 532-547 M: 9810459374 E: [email protected] W: www.bloomsbury.com Contact: Sudipto Mookherjee 3XEOLVKHUVRIERRNVRQÀFWLRQQRQÀFWLRQIDVKLRQODZKXPDQLWLHVHFRQRPLFV business, etc. Also provides imprints including Bloomsbury circus, Arden Shakespeare, Hart, Methune Drama, etc.
Bluerose Publishers Private Limited HALL 123, Ansal Bhawan, 16 KG Marg, New Delhi - 110001 Delhi 8-11 M: 9015719530 STALL 261-262 E: [email protected] B FAIR DIRECTORY 20
Contact: Syed Arshad Provides self-publishing services across the country.
Bodhi Prakashan HALL C-46 (Basement), Sudarshanpura Industrial Area, Main Road, 22 Godam, 12A Jaipur - 302006 Rajasthan STALL 94 M: 9829018087 E: [email protected] Contact: Sandeep Kumar Publishers of books in Hindi language.
Boltee Ramayan HALL 1892, Pratap Nagar, Mayur Vihar Phase 1, Delhi - 110091 Delhi 12A M: 9717991762 STALL 161 E: [email protected] W: www.bolteeramayan.com Contact: Rakesh Manufacturers of devices containing musical Ramayana and other epics.
Bolti Ramayan HALL HALL 2IÀFH1R2P6KXEKDP7RZHU1HHODP%DWD5RDG 8-11 12A Faridabad - 121001 Haryana STALL STALL 173 48 M: 9810442152 E: [email protected] W: www.boltiramayan.com Contact: Shrikanta Maheshwari Manufacturers of a device containing preloaded Ramcharitmanas , Bhagwat Geeta and other mantras, etc. along with a book on Ramayana.
Book Affair HALL HALL HALL HALL 3531, Netaji Subhash Marg, Daryaganj, 12 8-11 8-11 7D, 7F-H New Delhi - 110002 Delhi STALL STALL STALL STALL 1-2 292 169-170 120 M: 9891570009 E: [email protected] Contact: Narendra Kumar Jain Deals in novels, encyclopedias and children’s books. 21 NEW DELHI WORLD BOOK FAIR 2020 B
Book Sales Company HALL 4327-3, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810009145 STALL 480-481 E: [email protected] Contact: Navin Anand Distributors of general, arts & coffee table books on India.
Bookazine Co. Inc. HALL S-2, Akarshan Bhawan, Third Floor, 4754/23, Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 26 T: 011-23240778 M: 9560400673 E: [email protected] W: www.bookazine.com Contact: Ram Jagan Bookazine is a global distributor and wholesaler located in the USA with one of its sale RIÀFHLQ,QGLD,WRIIHUVSHUVRQDOLVHGVHUYLFHVWRERRNVWRUHVRQOLQHUHWDLOHUVOLEUDULHVHWF
Bookchor Literary Solutions Pvt. Ltd. HALL 474, HSIDC Rai, Rai - 131029 Haryana 8-11 M: 9996968010 STALL 372-377 E: [email protected] W: www.bookchor.com Contact: Vidyut Sharma E-tailers for books.
Books Etc HALL 16 Zakir Bagh, Opposite Surya Hotel, New Delhi - 110025 Delhi 8-11 M: 9818749560 STALL 177 E: [email protected] Contact: Syed Amir Bashir Markets a unique collection of merchandise and gifts for those fond of reading, writing and fans of literature.
Bookscape LLP HALL 6-7, Khedapati Marg, Dhar - 454001 Madhya Pradesh 12A M: 9971698930 STALL 170-173 E: [email protected] W: www.bookscape.com Contact: Parag Agrawal Publishers of books in English language. C FAIR DIRECTORY 22
Bookwell HALL 3/79, Nirankari Colony, Delhi - 110009 Delhi 8-11 M: 9810043240 STALL 550 E: [email protected] W: www.bookwellindia.com Contact: Manmohan Singh Khurana / Bachanpal Khurana Publishers, distributors and library suppliers of Indian (including government & institutional) and foreign publications.
British Council Division HALL British Council Division, New Delhi - 110001 Delhi 8-11 M: 9910114595 STALL 246-247 E: [email protected] Contact: Himani Taneja The British Council is the UK’s international organisation for cultural relations and educational opportunities.
Buddha Light Art and Living Pvt. Ltd. HALL Farm No. 45, Dera Mandi Road, Dera Gaon, Chattarpur, 12 New Delhi - 110074 Delhi STALL 13 M: 8826934914 E: [email protected] Contact: Junu Promotes the teachings of Buddha and philosophy of humanistic Buddhism.
Bureau International de l’Edition Française (BIEF) HALL 115, Boulevard Saint-Germain, Paris - 75006 France 7ABC T: +33-0-44411310 M: +33-0-677851629 STALL 1-6 E: [email protected] W: www.bief.org Contact: Christine Karavias The BIEF is responsible for the international promotion of French books, subsidized by the French Ministry of Culture with the support of the French diplomatic services. The BIEF is developing a wide range of initiatives that will permit the agency to maintain WKHSUHVHQFHDQGLQÁXHQFHRIWKH)UHQFKLQGXVWU\WKURXJKRXWWKHZRUOG
CAPEXIL HALL 4B, Fourth Floor, Vandana Building, 11 Tolstoy Marg, 7ABC New Delhi - 110001 Delhi STALL 19 T: 011-23356703 M: 9899426423 23 NEW DELHI WORLD BOOK FAIR 2020 C
E: [email protected] W: www.capexil.org Contact: Sunil Kumar CAPEXIL is a responsive trade support organisation under Miniotry of Commerce, Govt. of India, facilitating and strengthening India’s publishing and printing industry and external trade through effective networking with the global community.
CIET NCERT HALL Chacha Nehru Bhawan, Sri Aurobindo Marg, New Delhi - 110016 Delhi 8-11 M: 9868912332 STALL 119-132 E: [email protected] Contact: Anjula Sagar CIET is a premiere national institute of education technolgy. CIET promotes equity and works towards improving the quality of education processess at school level.
CSTS HALL BE-7B, DDA Flats, Munirka, New Delhi - 110067 Delhi 12A M: 9430585378 STALL 123-124 E: [email protected] Contact: Amit Anand CSTS works for language, literature and culture.
Central Hindi Directorate HALL West Block - 7, R K Puram, New Delhi - 110066 Delhi 12A T: 011-26102575 M: 9968285638 STALL 32-33 E: [email protected] W: www.chdpublication.mhrd.gov.in Contact: Ravi Mala The Central Hindi Directorate was set up under MHRD for the promotion and development of Hindi. The Directorate undertook the task of implementation of several schemes for preparation of dictionaries in Hindi and various Indian and foreign languages.
Central Reference Library HALL Belvedere, Alipore, Kolkata - 700027 West Bengal 8-11 T: 033-24481529 M: 9432308313 STALL 54 E: [email protected] W: www.crlindia.gov.in Contact: Vaishnavi Kulkarni An organisation under the Ministry of Culture, Government of India, Central Reference Library is engaged in production of the Indian National Bibliography, language bibliographies and other special publications. C FAIR DIRECTORY 24
Centre for Cultural Resources and Training HALL 15A, Sector-7, Dwarka, New Delhi - 110075 Delhi 12A M: 9313904432 STALL 313 E: [email protected] W: www.ccrtindia.gov.in Contact: Ramnik Kumar CCRT is a premier autonomous organisation funded by the Ministry of Culture. Its mandate is to look education with culture. It gives training to government school teachers.
Centre for Science and Environment HALL 41, Tughlakabad Institutional Area, New Delhi - 110062 Delhi 8-11 M: 9810799432 STALL 554-555 E: [email protected] W: www.cseindia.org Contact: Santhosh M P Centre for Science & Environment (CSE) is an environment research organisation based in Delhi.
Chhavi Publication HALL 330, Main Road, Burari, Delhi - 110084 Delhi 12A M: 9873723789 STALL 309 E: [email protected] Contact: Ayush Gupta Publishers of children’s educational and story books.
Children Book Temple HALL C 55, Ganesh Nagar, Pandav Nagar, Delhi - 110092 Delhi 12A M: 8700863156 STALL 289-304 E: [email protected] Contact: Jagdish Publishers of books in Hindi language.
Children’s Book Trust HALL Nehru House, 4 Bahadur Shah Zafar Marg, New Delhi - 110002 Delhi 7D, 7F-H M: 9312871576 STALL 193-196 E: [email protected] W: www.childrensbooktrust.com Contact: Inderjeet Miglani Publishers of children’s books and Children’s World Magazine . 25 NEW DELHI WORLD BOOK FAIR 2020 C
Chirag Book Depot HALL F Block, Pocket 6, Flat No. 60, Sector 16, Rohini, 8-11 Delhi - 110008 Delhi STALL 13-14 M: 8376000528 E: [email protected] Contact: Dimple Tilwani Sellers of medical, children’s, educational and general books.
Cloudtail India Private Limited HALL B Wing, Divyasree Chambers 11, O Shaughnessy Road, Langford Gardens, 12 Bengaluru - 560025 Karnataka STALL 78 M: 9711928592 E: [email protected] Contact: Tanmoy Verma Online retailers of products like books, apparels, shoes, furniture, appliances, consumables, etc.
&RPPLVVLRQIRU6FLHQWLÀFDQG7HFKQLFDO7HUPLQRORJ\ HALL CSTT, Ministry of HRD, West Block-7, R.K. Puram, New Delhi - 110066 12A Delhi STALL 32-33 M: 9711018123 E: [email protected] W: www.csttpublication.mhrd.gov.in Contact: Jai Singh Rawat 3XEOLVKHUVRIXQLYHUVLW\WH[WERRNVUHIHUHQFHPDWHULDOVGHÀQLWLRQDOGLFWLRQDULHV glossaries, monographs as well as the quarterly journals, Vigyan Garima Sindhu and Gyan Garima Sindhu .
Consortium Elearning Network Pvt. Ltd. HALL A-118, First Floor, Sector 63, Noida - 201301 Uttar Pradesh 8-11 M: 9810078958 STALL 549 E: [email protected] W: www.stmjournals.com, www.journalspub.com, www.skillzip.com Contact: Rahul Kumar Publishers of journals, books, video training programs in science, technology, engineering, medical, management and law domains both in print and e-formats. D FAIR DIRECTORY 26
Craxy Inc HALL A-48, Nirman Vihar, Delhi - 110092 Delhi 12 M: 9899601401 STALL 44 E: [email protected] W: www.craxystore.com Contact: Harsh Bhatia $QRQOLQHDQGRIÁLQHVWRUHZKLFKVHOOVFUHDWHVVWDWLRQHU\DSSDUHOVDQGRWKHU products.
Creative Graphics HALL 21, First Floor, BAV College Complex, Near PNB Bank, Subhash Bazar, 12 Meerut - 250002 Uttar Pradesh STALL 96 M: 9997212112 E: [email protected] W: www.creativgraphics.com Contact: Badrul Islam Deals in concept, illustration, title designing, content development, etc. for the print or electronic media in various languages like English, Urdu, Hindi, Sanskrit, Arabic and Kashmiri.
D K Agencies International HALL 211, Second Floor, Gagandeep Building, 12 Rajendra Place, 8-11 New Delhi - 110008 Delhi STALL 2-3 M: 9313654179 E: [email protected] Contact: Ramesh K Mittal Distributors of books & periodicals and also provides bibliographic services.
D S Store HALL BM 127, First Floor, West Shalimar Bagh, Delhi - 110088 Delhi 12 M: 9910654666 STALL 7-8 E: [email protected] Contact: Shikha Chugh Distributors of all kinds of general books.
Dalit Dastak HALL Block 25, H No. 422, Trilokpuri, Delhi - 110091 Delhi 12A M: 9711666056 STALL 176 E: [email protected] W: www.dalitdastak.com 27 NEW DELHI WORLD BOOK FAIR 2020 D
Contact: Ashok Kumar Publishers of the monthly magazine in Hindi, Dalit Dastak .
Datanet India Pvt. Ltd. HALL D-100, First Floor, Okhla Industrial Area Phase 1, 12 New Delhi - 110020 Delhi STALL 66 M: 9310831223 E: [email protected] W: www.datanetindia-ebooks.com Contact: Bhupendra Singh Provides services in the socio-economic and electoral information domain. Its main ZHEVLWHVDUHZZZLQGLDVWDWFRPZZZGLVWULFWVRÀQGLDFRPZZZHOHFWLRQVLQLQGLD com, etc.
Dawat E Islami Hind HALL 421, Urdu Market, Matia Mahal, Jama Masjid, Delhi - 110006 Delhi 12A M: 7992433768 STALL 133 E: [email protected] W: www.dawateislamihind.net Contact: Md Asif Ansari 3XEOLVKHUVRIERRNVRQ6XÀVP
Deep Book Distributors HALL BM-127, West Shalimar Bagh, New Delhi - 110088 Delhi 8-11 M: 9810654666 STALL 486-487 E: [email protected] Contact: Deepak Chugh Distributors of general books.
Deepak Prakashan HALL DP House-1, Durga Colony, 6 Number Chauraha, Army Cantonment Area 12 Morar, Gwalior - 474006 Madhya Pradesh STALL 65 M: 7999420688 E: [email protected] Contact: Deepak Gupta Publishers of technical books as well as books on management, computer, environment, commerce, pharmacy, microbiology, biotechnology in Hindi and English languages. D FAIR DIRECTORY 28
Deepti Publications HALL 22-7-38, Kothapet, Tenali, Guntur District - 522201 Andhra Pradesh 7D, 7F-H M: 8885528465 STALL 187 E: [email protected] W: www.deeptipublications.com Contact: B Sravan Kumar Publishers of educational books.
Defence Research and Development Organisation HALL Director Desidoc DRDO, Metcalfe House, New Delhi - 110054 Delhi 12 M: 9818687844 STALL 76 E: [email protected] W: www.drdo.gov.in Contact: Tapesh Sinha DRDO is the R&D wing of Ministry of Defence, Govt of India, with a vision to empower India with cutting-edge defence technologies and a mission to achieve self-reliance in critical defence technologies and systems, while equipping our armed forces with state-of-the-art weapon systems and equipment in accordance with requirements laid down by the three services. DRDO was formed in 1958 from the amalgamation of the then already functioning Technical Development Establishment (TDES) of the Indian Army and the Directorate of Technical Development & Production (DTDP) with the Defence Science Organisation (DSO). DRDO was then a small organisation with establishments or laboratories. Over the years, it has grown multi-directionally in terms of the variety of subject disciplines, number of laboratories, achievements and stature.
Delhi Arya Pratinidhi Sabha HALL HALL 15, Hanuman Road, New Delhi - 110001 Delhi 7D, 7F-H 12A M: 9650183339 STALL STALL 62-63 151-160 E: [email protected] Contact: Sandeep Arya Promotes teachings and philosophy of Swami Dayanand Saraswati.
Delhi Educational Stores HALL D-14/75, Sector-3, Rohini, New Delhi - 110085 Delhi 12 M: 8368050897 STALL 99 E: [email protected] W: www.delhieducationalstores.com Contact: Vishal Sabharwal Manufacturers of educational teaching aids. 29 NEW DELHI WORLD BOOK FAIR 2020 D
Delhi Open Books HALL HALL 4771/23, Ground Floor, Bharat Ram Road, Daryaganj, 12 8-11 New Delhi - 110002 Delhi STALL STALL 92 24 M: 7011624381 E: [email protected] Contact: Prateek Bihani Deals in books across genres.
Delhi Public Library HALL Dr. Shyama Prasad Mukherjee Marg, New Delhi - 110006 Delhi 8-11 M: 9811450584 STALL 479 E: [email protected] W: www.dpl.gov.in Contact: Mahesh Arora The Delhi Public Library under the Ministry of Culture, Government of India, provides free library services to the people, and provides a platform for social education.
Delhi Sanskrit Academy HALL Plot No 5, Jhandewalan, Karol Bagh, New Delhi - 110005 Delhi 12A M: 8930834401 STALL 99 E: [email protected] Contact: Mohit Kumar Promotes and publishes books in Sanskrit language.
Delhi Saraswat Sangh HALL 22 to 25, Hargovind Enclave, Rajpur Khurd, Chhatarpur, 12A New Delhi - 110068 Delhi STALL 13 M: 9810709203 E: [email protected] Contact: Ranjit Lenka Delhi Saraswat Sangh is a branch of Neelachala Saraswat Sangh, Puri.
Delhi Sikh Gurdwara Management Committee HALL Guru Gobind Singh Bhawan, Gurdwara Rakab Ganj Sahib, New Delhi - 12A 110001 Delhi STALL 111 M: 9810593462 E: [email protected] W: www.dsgmc.in D FAIR DIRECTORY 30
Contact: Amarjit Singh Delhi Sikh Gurdwara Management Committee is a statutory representative organisation of the Sikhs that publishes religious books on Sikhism to propagate the teachings of the Sikh gurus enshrined in Holy Guru Granth Sahib Ji.
Delhi State Booksellers and Publishers Association HALL 4760-61, First Floor, 23, Ansari Road, Daryaganj, New Delhi - 110002 12 Delhi STALL 103 M: 9873791227 E: [email protected] W: www.dsbpa.in Contact: Chander Singh Delhi State Booksellers and Publishers Association is the oldest existing body dedicated towards furthering the interests of the book industry in Delhi, NCR.
Department of Culture and Tourism - Abu Dhabi HALL Abu Dhabi National Exhibition Centre, Abu Dhabi UAE 7ABC T: +97125995304 STALL 43-45 E: [email protected] W: www.adbowokfair.com Contact: Ibrahim Al Salama It regulates, supports, develops and markets Abu Dhabi’s culture and tourism.
Department of Publication HALL Controller of Publication, Civil Lines, Behind Vidhan Sabha Metro Station, 8-11 New Delhi - 110054 Delhi STALL 53 M: 9718878860 E: [email protected] W: www.deptpub.nic.in Contact: Sube Singh The Department is the authorized publisher and custodian of Government of India Publications and Periodicals brought out by various Ministries/Departments including Army Publications and Supreme Court Reports. It is responsible for storage, sale and GLVWULEXWLRQRIDOOVDOHDEOHRIÀFLDOSXEOLFDWLRQVDQGFRS\ULJKWKROGHU
Diksha HALL C-65, Kiran Garden, Uttam Nagar, New Delhi - 110059 Delhi 12A M: 9250352039 STALL 18-19 E: [email protected] Contact: Neeru Deals in general books. 31 NEW DELHI WORLD BOOK FAIR 2020 E
Divya Jyoti Foundation HALL 2IÀFH1R:HGGLQJ0DOO6KDUGD1LNHWDQ3LWDP3XUD1HZ'HOKL 12A 110034 Delhi STALL 69-70 M: 9810784859 E: [email protected] W: www.djjs.org Contact: Narender Kumar Divya Jyoti Jagrati Sansthan, established and run under the mentorship of His +ROLQHVV6KUL$VKXWRVK0DKDUDM-LLVDVRFLRVSLULWXDOFXOWXUDOQRWIRUSURÀW organisation, actively involved in the humanitarian and social re-engineering arena.
Eastern Book Company HALL 34 Lalbagh, Lucknow - 226001 Uttar Pradesh 8-11 M: 9935096017 STALL 113-118 E: [email protected] W: www.ebc.co.in Contact: Sudip Chatterji Publishers of a wide range of legal texts, electronic and web products.
Edu Hub Publishing Company HALL C-170, Naraina Industrial Area, Phase I, New Delhi - 110028 Delhi 7D, 7F-H M: 9811053530 STALL 100-103 E: [email protected] Contact: Bharat Rai Mediratta Publishers of educational, general and children’s books.
Educart HALL 28-115, Jyoti Block, Sanjay Palace, Agra - 282002 Uttar Pradesh 7D, 7F-H M: 9258088445 STALL 124-127 E: [email protected] W: www.agpgroup.in Contact: Krishan Kumar Publishers of children’s books from Nursery to Class 10.
(GXFDWRQDODQG6FLHQWLÀF$LGV HALL H104, New Seelampur, Delhi - 110053 Delhi 8-11 M: 9312841314 STALL 30 E: [email protected] Contact: Sahil Malik 'HDOVLQHGXFDWLRQDOVFLHQWLÀFDLGV E FAIR DIRECTORY 32
Effective Business Solutions HALL 10, Mathura Road, Jangpura B, Near Rajdoot Hotel, New Delhi - 110014 8-11 Delhi STALL 365 M: 9899356783 E: [email protected] W: www.scientologydelhi.org Contact: Amiyajyoti Bhoi Deals in life improvement books.
Eklavya- Pitara HALL HALL Jamnalal Bajaj Parisar, Near Fortune Kasturi, Jatkhedi, 12A 7D, 7F-H Hoshangabad Road, Bhopal - 462026 Madhya Pradesh STALL STALL 55-56 72-73 T: 0755-2977773 M: 9981015610 E: [email protected] W: www.eklavya.in/www.pitarakart.in Contact: Jalaj Kumar Verma $QRQSURÀWQRQJRYWRUJDQLVDWLRQWKDWGHYHORSVDQGÀHOGWHVWVLQQRYDWLYH educational programmes and trains resource persons to implement these programmes. It functions through a network of education resource centres located in Madhya Pradesh.
Ektara HALL E-1/212, Arera Colony, Bhopal - 462016 Madhya Pradesh 12A M: 9109915118 STALL 64-65 E: [email protected] W: www.ektaraindia.in Contact: Rajesh Parashar Ektara is Takshila Educational Society’s centre for children’s literature and arts located at Bhopal. It works towards the tri-faceted objective of creating as well as reaching quality literature and art for young readers; generating a comprehensive understanding of what good children’s literature should entail; and working as a resource and facilitation hub.
Embassy Book Distributors HALL 23-180, Anand Nagar, Nehru Road, Near Vakola Police Station, Santacruz 8-11 East, Mumbai - 400055 Maharashtra STALL M: 9820187511 289-291 E: [email protected] W: www.embassybooks.in Contact: Sohin Lakhani Publishers of books on personal growth, self-help, motivation, inspiration, management, marketing, health, spirituality and literature. 33 NEW DELHI WORLD BOOK FAIR 2020 F
Esskay Enterprises HALL C-54, Ganesh Nagar Complex, Delhi - 110092 Delhi 12A M: 9811022103 STALL 289-304 E: [email protected] Contact: Ajay Sharma Publishers of books for children.
Excel ID Card Solutions HALL 2600/5, First Floor, Beadonpura, Karol Bagh, New Delhi - 110005 Delhi 12 M: 9899980987 STALL 94 E: [email protected] W: www.excelidcardsolutions.com Contact: Manpreet Kaur Manufacturers of different models of ID card holders, printing digital lanyards, digital school belts, name plates of different shapes, badges, key chains, sublimating mugs, t-shirts, caps etc.
Faroma Media Pvt. Ltd. HALL Sahu Complex, Ashok Nagar, Ranchi - 834002 Jharkhand 12A M: 9122427771 STALL 41 E: [email protected] W: www.faromamedia.com Contact: Sapan Jaiswal 3XEOLVKHUVRIERRNVRQÀFWLRQQRQÀFWLRQHWF
Filhaal HALL L164, Road No. 23, Sri Krishna Nagar, Patna - 800001 Bihar 12A M: 9471000890 STALL 8 E: ÀOKDDOSDWQD#JPDLOFRP Contact: Preeti Bala Sinha Publishers of books in Hindi language.
Fleur Books HALL 1, Fleur House, 498-110, Hasanganj Charahi, Faizabad Road, Lucknow - 7D, 7F-H 226020 Uttar Pradesh STALL 131 M: 7080916202 E: LQIR#ÁHXUERRNVFRP W: ZZZÁHXUERRNVFRP Contact: Mateenuddin Ahmad Publishers and distributors of children’s books, games and gifts. G FAIR DIRECTORY 34
GBD Books HALL 16 Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810229648 STALL 456-475 E: [email protected] W: www.pigeonbooks.in Contact: Kaushal Goyal Publishers of books across genres.
G R Bathla and Sons HALL 50A, Opp Mainawati Park, Saket, Meerut - 250001 Uttar Pradesh 8-11 M: 9811397661 STALL 477-478 E: [email protected] Contact: Vishal Gupta Publishers of textbooks for classes IX to XII of various school boards in the country as well as for medical and engineering entrance examinations focusing mainly on physics, chemistry, biology and mathematics.
Gamooz Interactive Solutions Pvt. Ltd. HALL 615, Vipul Business Park, Sector-48, Gurugram - 122018 Haryana 7D, 7F-H M: 8383871645 STALL 178 E: [email protected] W: www.gamooz.com Contact: Gaurav Wadhwa Provides services to book publishers in adding fun and interactivity to their printed books using Augmented Reality (AR) technology.
Gargi Prakashan HALL 1-4649-45-B, Gali Number 4, New Modern Shahdara, Delhi - 110032 Delhi 12A M: 9810104481 STALL 6 E: [email protected] W: www.gargibooks.com Contact: Atul Kumar Publishers of books in Hindi language.
Garuda Prakashan Private Limited HALL K-44A, South City-1, Sector-41, Gurugram - 122001 Haryana 12 M: 7992124444 STALL 89 E: [email protected] Contact: Prateek Kumar Dwivedi Publishers of books across genres. 35 NEW DELHI WORLD BOOK FAIR 2020 G
Gautam Book Centre HALL 1-4446, Ramnagar Extention, Dr Ambedkar Gate, Mandoli Road, Shahdara, 12A Delhi - 110032 Delhi STALL 16-17 M: 9810173667 E: [email protected] W: gautambookcenter.com Contact: S S Gautam Publishers of books on Dr Ambedkar, Buddha, saints and dalit literature.
General Book Depot HALL 1691, Nai Sarak, New Delhi - 110006 Delhi 8-11 M: 9871225151 STALL 298-307 E: [email protected] Contact: Arjun Goyal 'HDOVLQERRNVDFURVVJHQUHVOLNHDUWFXLVLQHÀFWLRQHGXFDWLRQDOERRNVHWF
General Egyptian Book Organization HALL 1193, Cornich El Nile, Boulac, Cairo Egypt 7ABC T: +20225789316 M: +01001431276 STALL 16 E: [email protected] W: www.gebo.gov.eg Contact: Islam Bayoumy An autonomous corporation of Ministry of Culture, Government of Egypt, for printing, publishing and distribution, as well as organiser of Cairo International Book Fair and International Children’s Book Fair.
Genius Hive Publications HALL 204, Supreme Enclave, Mayur Vihar, Delhi - 110091 Delhi 7D, 7F-H M: 9810989818 STALL 176 E: [email protected] Contact: Rakesh Publishers of washable lifetime books.
Genius Interactive Aids HALL VHB Colony, Qt No B91, Shantinagar Housing Board, Shantinagar, 7D, 7F-H Nagpur - 440002 Maharashtra STALL 203-204 M: 9860083383 E: [email protected] W: geniusinteractiveaids.com Contact: Mukund Thombre G FAIR DIRECTORY 36
'HDOVLQHGXFDWLRQDOWHDFKLQJDLGVOLNHPDJQHWLFFODVVURRPFODVVURRPZDOOGHFRUÁDVK cards, 3D projector, touch lab, white board, chalk board, puzzles, magnetic wall, etc.
Genius Mind Mantra HALL Rajeev Nagar, Kandoli, Mayur Vihar Extn., Near Ambedker Boys Hostel, 8-11 Sahastradhara Road, Dehradun - 248001 Uttarakhand STALL 295 M: 7983004603 E: [email protected] W: www.geniusmindmantra.com Contact: Preet Sharma Distributors of books across genres.
*HUPDQ%RRN2IÀFH1HZ'HOKL HALL C/o Creative Currents Consulting, Avanta Business Centre, ITT, 7ABC Second Floor, E-Block, Nehru Place, New Delhi - 110019 Delhi STALL 8-9 T: 011-66172441 M: 8826526226 E: [email protected] W: www.newdelhi.gbo.org Contact: Angela Albert *HUPDQ%RRNRIÀFH1HZ'HOKLLVWKHFHQWUDOFRQWDFWDQGLQIRUPDWLRQFHQWUHIRUWKH German and Indian book industry. It serves as an ambassador for the German literary DQGSXEOLVKLQJZRUOGRQEHKDOIRIWKH)HGHUDO)RUHLJQ2IÀFH7KHRXWVWDQGLQJQHWZRUNLQJ of GBO, New Delhi in the publishing industries of both countries allows the expertise to relate to both the business interests and the cultural aspects of the market.
Ghalib Institute HALL Aiwan-E-Ghalib, Aiwan-E-Ghalib Marg, New Delhi - 110002 Delhi 12A T: 011-23232583 M: 9818568675 STALL 117 E: [email protected] Contact: Mushtaq Ahmad Publishers of books in Urdu language.
Gita Publishing House, Sadhu Vaswani Mission, Pune HALL Sadhu Vaswani Mission, 10 Sadhu Vaswani Path, Near GPO, Pune - 8-11 411001 Maharashtra STALL 109-110 M: 9822047161 E: [email protected] W: www.dadavaswanisbooks.org Contact: Gulshan Dudani Publishers of books on self-improvement, self-realization and self-knowledge with practical suggestions written by J.P. Vaswani. 37 NEW DELHI WORLD BOOK FAIR 2020 G
Goodwill Books International HALL G-2, Rattan Jyoti Building, 18 Rajendra Place, New Delhi - 8-11 110008 Delhi STALL 31-34 M: 9810742425 E: [email protected] W: www.goodwillpublishinghouse.com Contact: A S Chowdhry Publishers and exporters of books across genres like recreational and educational games, puzzles, maps, educational charts, school laboratory equipment, surgical equipment, etc.
Goodwill Publishing House HALL B-3, Rattan Jyoti Building, 18 Rajendra Place, New Delhi - 8-11 110008 Delhi STALL 31-34 M: 9810145559 E: [email protected] W: www.goodwillpublishinghouse.com Contact: Rajneesh Chowdhry Publishers of children’s and general books on a wide range of subjects, illustrated dictionaries, preschool and board books, wipe-clean, colouring and activity, word search, stories and fables, art and craft, number and alphabet writing, encyclopedia, English improvement, essays and comprehension, letter writing, management and success, public speaking, chess, sudoku, palmistry, astrology and numerology, health, foreign language learning, sports, etc.
Goodword Books HALL 1, Nizamuddin West Market, New Delhi - 110013 Delhi 8-11 M: 8588822672 STALL 44-45 E: [email protected] W: www.goodwordbooks.com Contact: Yaqoob Umri Publishers of Islamic books, Arabic learning books, children’s books, craft and activity books, games, etc.
Goyal Brothers Prakashan HALL D231, Sector 63 - 201301 Uttar Pradesh 7D, 7F-H M: 8826266668 STALL 104-111 E: [email protected] W: www.goyal-books.com Contact: Akhil Goyal Publishers and exporters of educational books, books on Hindi, English, mathematics, science, etc. G FAIR DIRECTORY 38
Gramin Pustak Bhandar HALL G-17A, First Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 9311196064 STALL 255-272 E: [email protected] Contact: Rakesh Sharma Publishers of literary books in Hindi language.
Granth Akademi HALL No. 19, First Floor, 2, Ansari Road, Daryaganj, New Delhi - 12A 110002 Delhi STALL 289-304 M: 011-23253233 E: [email protected] Contact: Kalpnath Prasad Publishers of books on library sciences, general knowledge, journalism, etc in Hindi language.
Grolier International Pvt. Ltd. HALL Unit No 10, U S Complex, 120 Mathura Road, Adjacent To Jasola Apollo 7D, 7F-H Hospital, New Delhi - 110076 Delhi STALL 32-51 M: 9716359999 E: [email protected] W: www.grolier-asia.com Contact: Prashant Bhattacharya Publishers of educational and reference products for children of all ages, executives, managers and scholars, both in print and on-line.
Gullybaba Publishing House Private Limited HALL 2525/193, Onkar Nagar, Tri Nagar, Delhi - 110035 Delhi 8-11 M: 9650278279 STALL 70-73 E: ÀQDQFH#JXOO\EDEDFRP W: www.gullybaba.com Contact: Mahesh Chand 3XEOLVKHUVRIÀFWLRQQRQÀFWLRQDQGJHQHUDOERRNV
Gyan Ganga HALL HALL 2/19, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 7D, 7F-H 12A M: 9899817777 STALL STALL 66-71 289-304 E: [email protected] Contact: Piyush Agrawal 39 NEW DELHI WORLD BOOK FAIR 2020 H
3XEOLVKHUVRIERRNVRQÀFWLRQGUDPDJUDPPHUVSRUWVFRRNHU\DUWDQGOLWHUDWXUHDV well as books for children in Hindi language.
Gyan Sagar HALL G-17A, First Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 011-22505853 STALL 255-272 E: [email protected] Contact: Ananya Maheshwari Publishers of Hindi literary books.
Gyan Vigyan Educare HALL HALL 3639, First Floor, Netaji Subhash Marg, Daryaganj, 7D, 7F-H 12A New Delhi - 110002 Delhi STALL STALL 66-71 289-304 M: 9650302602 E: [email protected] Contact: Sarvesh Kumar Publishers of textbooks in science stream.
Gyan Vigyan Prakashan HALL 1- B, Netaji Subhash Marg, Daryaganj, New Delhi - 110002 Delhi 12A M: 9311196012 STALL 255-272 E: [email protected] Contact: Prashant Publishers of literary books in Hindi language.
Gyandoot HALL H-601, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 9311196020 STALL 255-272 E: [email protected] Contact: Alind Maheshwari Publishers of literary books in Hindi language.
Hachette Book Publishing India Pvt. Ltd. HALL HALL Fourth Floor, Corporate Centre, Plot No 94, Sector 44, 8-11 7D, 7F-H Gurugram - 122003 Haryana STALL STALL 191-214 76-87 M: 9818449154 E: [email protected] W: www.hachetteindia.com H FAIR DIRECTORY 40
Contact: Kapil Agrawal Hachette India is the subsidiary of Hachette UK. It is the second largest publisher. Hachette has got more than 50 imprints. Key brands includes Asterix, Blyton, Nicholas Sparks, Stephen King, Grisham, Malala, Tendulkar, J K Rowling, Limca Book of Records, Mitch Albom, Brian Weiss.
Har Anand Publications Pvt. Ltd. HALL E-49/3, Okhla Industrial Area, Phase-II, New Delhi - 110020 Delhi 8-11 M: 9811310775 STALL 349-351 E: [email protected] W: www.haranandbooks.com Contact: Ashish Gosain Publishers of academic, general and children’s books.
Harbour Press International HALL 4715-16, 4697/5, 21-A, First Floor, Dayanand Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 91-94 M: 9326907520 E: [email protected] W: www.harbourpress.com Contact: Anshika Sharma Publishers of books by well-known authors, popularise regional languages and are facilitaters for foreign languages.
Harf Media Private Limited HALL Plot No 8, Old Palam Road, Near Dwarka Public School, 12A New Delhi - 110078 Delhi STALL 308 M: 9971072032 E: [email protected] Contact: Jalaj Kumar Anupam Offers services such as advertising, marketing, sales promotion and personal selling.
Harpercollins Publisher HALL HALL A 75, Sector 57, Noida - 201301 Uttar Pradesh 8-11 7D, 7F-H M: 9899256740 STALL STALL 436-455 52-61 E: [email protected] W: www.harpercollins.co.in Contact: Naveen Tewari 3XEOLVKHUVRIÀFWLRQQRQÀFWLRQSRHWU\DQGFKLOGUHQ·VERRNV 41 NEW DELHI WORLD BOOK FAIR 2020 H
Harsh Publications HALL 1-11848, Panchsheel Garden, Naveen Shahdara, Delhi - 110032 Delhi 12A M: 9599483886 STALL 143-146 E: [email protected] Contact: Shanti Swaroop Sharma Publishers of books in Hindi language.
Haryana Granth Akademi Panchkula HALL Akademi Bhawan, IP 16, Sector 14, Panchkula - 134113 Haryana 12A M: 9646361236 STALL 116 E: [email protected] Contact: Dinesh Kumar Publishers of university level books in Hindi language.
Helios Educore Pvt. Ltd. HALL Sunshine Business Park, Plot No 5A, Sector 94, Gautam Buddha Nagar, 8-11 Noida - 201301 Uttar Pradesh STALL 19 M: 8800014610 E: [email protected] W: www.helioseducore.com Contact: Ashish Kulshreshtha Publishers of educational books.
Himachal Academy of Arts, Culture and Languages HALL Shimla - 171001 Himachal Pradesh 12A M: 9816196067 STALL 57 E: [email protected] Contact: Dev Raj Sharma Publishers of books on art, culture, literature and languages of Himachal Pradesh.
Himalaya Publishing House Pvt. Ltd. HALL Ramdoot Dr Bhalerao Marg, Girgaon, Mumbai - 400004 Maharashtra 8-11 M: 9313061171 STALL 159-162 E: [email protected] W: www.himpub.com Contact: Vijay Singh Rawat Publishers of academic books, specializes in customised publishing, conference proceedings, doctoral thesis/ research fellowship works, and also offers ebooks for online digital platforms. H FAIR DIRECTORY 42
Hind Pocket Books HALL 6HYHQWK)ORRU,QÀQLW\7RZHU&&\EHU&LW\*XUXJUDP Haryana 12A T: 0124-4785600 M: 9899124141 STALL 166-169 E: [email protected] Contact: Sanjay Giri 3XEOLVKHUVRIERRNVRQOLWHUDWXUHÀFWLRQQRQÀFWLRQKLVWRU\P\WKRORJLHVDQG children’s books.
Hind Yugm HALL 201-B, Pocket A, Mayur Vihar, Phase 2, Delhi - 110091 Delhi 12A M: 9873734046 STALL 27-29 E: [email protected] W: www.hindyugm.com Contact: Shailesh Bharatwasi Publishers of books on Hindi literature and new age literature.
Hind Yugm Blue HALL 201-B, Pocket A, Mayur Vihar, Phase 2, Delhi - 110091 Delhi 12A M: 9968755908 STALL 27-29 E: [email protected] W: www.hindyugm.com Contact: Shailesh Bharatwasi Publishers of books in Hindi language.
Hindi Academy Delhi HALL Community Center, Padam Nagar, Kishanganj, New Delhi - 110007 12A Delhi STALL 312 M: 9818084043 E: [email protected] Contact: Ajay Kumar An organisation of Government of Delhi engaged in the promotion and publication of Hindi language, literature and culture.
Hindi Book Centre HALL 45 B, Asaf Ali Road, New Delhi - 110002 Delhi 12A M: 9810046283 STALL 30-31 E: [email protected] W: www.hindibook.com Contact: Anil Varma Distributors of books in Hindi and other regional languages. 43 NEW DELHI WORLD BOOK FAIR 2020 I
Holistic Business Enterprises HALL 343, North Civil Lines, Muzaffarnagar - 251001 Uttar Pradesh 8-11 M: 9456036638 STALL 250 E: [email protected] W: www.yogapath.in Contact: Pradeep Kumar Sharma Deals in books on Yoga.
Holy Faith International HALL Gulab Bhawan, 6 BSZ Marg, ITO, New Delhi - 110002 Delhi 7D, 7F-H M: 9311466623 STALL 146-161 E: [email protected] W: www.mbdgroup.com Contact: Praveen Singh Publishers of books for all classes (K-12) on all subjects of all boards in major Indian languages. Also offers services like educational apps, ict classrooms, adaptive testing, lMS, AR & VR.
IPD Alternatives HALL 44, Groud Floor, Shahpur Jat, New Delhi - 110049 Delhi 8-11 M: 9818667892 STALL 565 E: [email protected] Contact: Krishna Dutt Distributors of books across genres like art & architecture, children’s books, dalit VWXGLHVHFRQRPLFVÀOP PHGLDVWXGLHVKLVWRU\LQWHUQDWLRQDODIIDLUVSROLWLFDOWKHRU\ sociology and women’s studies.
IRH Press India Company Private Limited HALL 68 Filmcentre, C-34, Third Floor, J Dadaji Road, Tardeo, Mumbai - 12A 400034 Maharashtra STALL 85 M: 9873836008 E: [email protected] W: www.irhpress.co.jp Contact: Mahendra Kumar Publishers of books by Master Ryuho Okawa.
Imamia Charitable Trust HALL 117-556, P1 Block, Kakadeo, Kanpur - 208025 Uttar Pradesh 12A M: 9336100559 STALL 122 E: [email protected] W: www.imamiayouth.in I FAIR DIRECTORY 44
Contact: Ziaul Hasan Zaidi Dealers and publishers of books for children and general readers.
Indian Council of Agricultural Research HALL Room No. 522, Krishi Anusandhan Bhawan, Pusa Campus, New Delhi - 12 110012 Delhi STALL 83 T: 011-25843657 M: 9810314506 E: [email protected] W: www.icar.org.in Contact: Sunil Kumar Joshi The Indian Council of Agricultural Research (ICAR) is an autonomous organisation under the Department of Agricultural Research and Education (DARE), Ministry of Agriculture and Farmers Welfare, Government of India. The Council is the apex body for co-ordinating, guiding and managing research and education in agriculture LQFOXGLQJKRUWLFXOWXUHÀVKHULHVDQGDQLPDOVFLHQFHVLQWKHHQWLUHFRXQWU\:LWK ICAR institutes and 71 agricultural universities spread across the country, this is one of the largest national agricultural systems in the world.
Indian Council of Historical Research HALL 35 Ferozeshah Road, New Delhi - 110001 Delhi 12 T: 011-23382321 M: 9711041883 STALL 74 E: [email protected] W: www.ichrindia.org Contact: Naushad Ali 7KH,&+5LVHQJDJHGLQSURPRWLQJVFLHQWLÀFKLVWRULFDOUHVHDUFKSXEOLVKHVWKHÀQGLQJV of various research projects undertaken by it in the areas of ancient, medieval and modern history.
Indian Institute of Advanced Study HALL Rashtrapati Nivas, Shimla - 171005 Himachal Pradesh 12 T: 0177-2832930 STALL 77 E: [email protected] W: www.iias.ac.in Contact: Akhilesh Pathak The IIAS, Shimla was established on 20 October, 1965 and was registered under the Registration of Societies Act of 1860. The Institute has published over 500 books on diverse topics related to humanities and social sciences.
Indian Institute of Sindhology HALL Ward - 4A, P.O.Box No. 10, Adipur, Kutch - 370205 Gujarat 12A M: 9586422011 STALL 128 45 NEW DELHI WORLD BOOK FAIR 2020 I
E: [email protected] W: www.sindhology.org Contact: Sahib Bijani An organization devoted to the preservation and promotion of Sindhi language, literature, art, culture, and publishes a magazine, Sahit Ain Kala Ji Rachna , a newsletter Sindhology , books and literary treatises.
Indian Social Institute HALL 10, Institutional Area, Lodhi Road, New Delhi - 110003 Delhi 12 M: 9868111685 STALL 38 E: [email protected] W: www.isidelhi.org.in Contact: John Kullu Publishers of books on schedule castes and tribes, women, children, human rights, law, society and culture.
Indica Publishers and Distributors Private Limited HALL 7-31, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810121450 STALL 396-407 E: [email protected] W: www.ipdplbooks.com Contact: Prashant Jain Suppliers and distributors of foreign and Indian textbooks as well as reference books from all major publishers.
Indica Technologies and Services Pvt. Ltd. HALL 7-31, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810121450 STALL 396-407 E: [email protected] Contact: Prashant Jain Distributors of e-resources (books & journals) of all subjects from all major publishers across the world.
Ink Publication HALL 33311-K, Naya Pura Kareli, Allahabad - 211016 Uttar Pradesh 12A M: 9455400973 STALL 84 E: [email protected] Contact: Dinesh Kushwaha Publishers of books in Hindi language. I FAIR DIRECTORY 46
Institute for Defence Studies and Analyses HALL No.1, Development Enclave, Rao Tula Ram Marg, New Delhi - 110010 8-11 Delhi STALL 367 M: 9312375758 E: [email protected] W: www.idsa.org Contact: Pitamber Datt The Institute of Defence studies and Analyses (IDSA) is a non-partisan, autonomous body dedicated to objective research and policy studies on all aspects of defence and security. It also publishes books, monographs, journals, briefs and papers.
Instituto Cervantes - Embassy of Spain HALL 48, Hanuman Road, New Delhi - 110001 Delhi 7ABC T: 011-43681907 M: 9212013423 STALL 10 E: [email protected] W: www.nuevadelhi.cervantes.es Contact: Shilpi Singh $QRQSURÀWRUJDQLVDWLRQIRXQGHGE\WKH*RYHUQPHQWRI6SDLQWRSURPRWH6SDQLVK ODQJXDJHWHDFKLQJDQGFXOWXUHVRI6SDQLVKVSHDNLQJFRXQWULHV,WLVWKH2IÀFLDO Cultural Centre of Embassy of Spain in India.
Iran Cultural Fairs Institute (ICFI), Tehran HALL No. 1080, Enghelab Ave, Tehran Iran 7ABC T: +98-21-66415540 STALL 12-13 E: [email protected] W: ZZZLFÀLU Contact: Hamidreza Shojaee Iran Cultural Fairs Institutes has been commissioned to organise cultural events, particularly the annual Tehran International Book Fair, provincial book fair and cultural festivals at home and abroad, to promote and expand book reading.
IRIS Publication Pvt. Ltd. HALL 501, Bhikaji Cama Bhawan, Bhikaji Cama Place, New Delhi - 110066 12 Delhi STALL 26-27 M: 9015228830 E: [email protected] W: www.geographyandyou.com Contact: Deepa Kumar Sharma Publishers of fortnightly magazine, Geography and You in English as well as monthly magazine in Hindi, titled Bhugol aur Aap . Also publishes books on climate change, environment, population, bio-diversity, sustainable development, etc. 47 NEW DELHI WORLD BOOK FAIR 2020 J
IROPE HALL HALL B-59A, Second Floor, Zakir Nagar, Jamia Nagar, 8-11 12A New Delhi - 110025 Delhi STALL STALL 175 305 M: 8802552189 E: [email protected] Contact: Syed Badar Promoters and publishers of spiritual and cultural books based on Islamic beliefs.
Ishan Prakashan HALL 7/23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9311196011 STALL 255-272 E: [email protected] Contact: Narendra Prasad Nautiyal Publishers of literary books in Hindi language.
Islamic Information Centre HALL D 160, Abul Fazl Enclave, Jamia Nagar, Okhla - 110025 Delhi 12A M: 9310178364 STALL 82-83 E: [email protected] Contact: Nisar Ahmad Distributors of moral education books to bring awareness in the society especially among the youth.
Jadavpur University Press HALL First Floor, University Counter, Jadavpur University, 188 Raja SC Mallik 8-11 Road, Jadavpur, Kolkata - 700032 West Bengal STALL 293 M: 9830788349 E: [email protected] W: https://jadunivpress.com/ Contact: Devalina Mookerjee The publishing wing of Jadavpur University, Kolkata, JUP is a bilingual publisher in English and Bangla of original academic works, annotated editions of previously published works, translations and scholarly compilations, etc.
Jai Book House HALL Shop No 249, Raghuleela Megha Mall, Poisar Kandivali, West Mumbai - 8-11 400067 Maharashtra STALL 180 M: 8424004077 E: [email protected] J FAIR DIRECTORY 48
Contact: Jai Chand Thakur Deals in general books.
Jaico Publishing House HALL 4736-23 Ground Floor, Plot No.1 Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 275-281 M: 9312500198 E: [email protected] W: www.jaicobooks.com Contact: D K Kapoor Publishers of books on religion, philosophy, self-help, science, travel among others.
Janchetna Pustak Pratishthan Samiti HALL D 68, Nirala Nagar, Lucknow - 226020 Uttar Pradesh 12 M: 9873358124 STALL 5 E: [email protected] W: www.janchetnabooks.org Contact: Sunny Singh Publishers and distributors of books in Hindi and English languages, on Indian and world literature, history, political economy, media, education, social sciences, magazines, children’s literature, posters, Indian and world revolutionary movements.
Jawaharlal Nehru University HALL Baba Ganganath Marg, Munirka 110067 Delhi 12 M: 9911968886 STALL 81 E: [email protected] W: www.jnu.ac.in Contact: Manorama Tripathi Established by an Act of Parliament in 1966, the strength and energy of Jawaharlal 1HKUX8QLYHUVLW\UHVXOWIURPWKHYLVLRQWKDWLGHDVDUHDÀHOGIRUDGYHQWXUH experimentation and unceasing quest and diversity of opinions its chief premise. In the early 1970s, when JNU opened its doors to teachers and students, frontier disciplines and new perspectives on old disciplines were brought to the Indian university system.
Jiwan Books International Private Limited HALL 24, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 7D, 7F-H M: 9811053530 STALL 100-103 E: [email protected] W: www.jiwanbooks.com Contact: Bharat Rai Mediratta Publishers of educational, general and children’s books. 49 NEW DELHI WORLD BOOK FAIR 2020 K
Jiwan Publishing House Private Limited HALL 24, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 7D, 7F-H M: 9811032714 STALL 64-65 E: [email protected] Contact: Manoj Mediratta Publishers of educational books.
Jodo Gyan Shiksha HALL HALL No 32, G Block, DDA Market, Shakurpur, Delhi - 110034 7D, 7F-H 12A Delhi STALL STALL 173 93 M: 9873084472 E: [email protected] W: www.jodogyan.org Contact: K Ravi Suppliers of teaching learning materials (TLMS).
Jones and Bartlett India Private Limited HALL 4737, 23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810025810 STALL 384-395 E: [email protected] W: www.vivagroupindia.com Contact: Sangeeta Datta Publishers of books on computer science, life sciences, physical sciences, health education, PDWKHPDWLFVPHGLFLQHQXUVLQJHPHUJHQF\FDUHPHGLFDOVHUYLFHVDQGÀUHVHUYLFHV
Jyotsna Prakashan HALL Mohan Building, 162-B JSS Road, Girgaon, Mumbai - 400004 8-11 Maharashtra STALL 562 M: 9899366339 E: [email protected] W: www.jyotsnaprakashan.com Contact: Nalin Joshi Publishers of art books and children’s literature.
KBS Prakashan HALL 18-91A, East Moti Bagh, Sarai Rohilla, Delhi - 110007 Delhi 12A M: 9871932895 STALL 323 E: [email protected] Contact: Sanjay Kumar Publishers of books on Hindi literature. K FAIR DIRECTORY 50
K L Pachouri Prakashan HALL D-8, Indrapuri, Ghaziabad - 201102 Uttar Pradesh 12A M: 9818542830 STALL 2 E: [email protected] Contact: B D Pachauri Publishers and distributors of books.
Kadam Prakashan HALL H. No. 224, MCD Flats, Sector 20, Rohini, New Delhi - 110086 Delhi 12A M: 9212026999 STALL 333 E: [email protected] Contact: Kailash Chand Chauhan Publishers of books in Hindi language.
Kalamos Literary Services LLP HALL N51, Khasra No. 78, Hargovind Enclave Rajpur Extn., 12 New Delhi - 110068 Delhi STALL 93 M: 8285208289 E: [email protected] W: www.kalamos.co.in Contact: Anuj Kumar 3XEOLVKHUVRIERRNVZLWKEHVWRIÁLQHGLVWULEXWLRQDQGSULQWLQJTXDOLW\DQGPDUNHWLQJ support.
Kalyani Navyug Media Pvt. Ltd. HALL 101 C, Shiv House, Hari Nagar Ashram, New Delhi - 110014 Delhi 8-11 M: 9971444002 STALL 354-355 E: LQIR#FDPSÀUHFRLQ W: ZZZFDPSÀUHFRLQ Contact: Munendra Patanker Publishers of graphic novels, with over 100 titles in the classics-mythology- biographies-history-junior and learning categories.
Kalyani Shiksha Parishad HALL 3320-21, Jatwara, Daryaganj, New Delhi - 110002 Delhi 12A M: 9811607086 STALL 147-150 E: [email protected] Contact: Mahesh Kumar Bhardwaj Publishers of literary books in Hindi. 51 NEW DELHI WORLD BOOK FAIR 2020 K
Kamgar Prakashan HALL B 4838, Street No. 112, Santnagar, Burari, Delhi - 110084 Delhi 12A M: 9212504960 STALL 254 E: [email protected] W: www.kamgarprakashan.com Contact: Balram Sharma Publishers of progressive literature.
Kanishka Publishers, Distributors HALL 4697/5 - 21A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12 T: 011-23270497 M: 9654296751 STALL 41 E: [email protected] Contact: Chaitanya Sachdeva 3XEOLVKHUVDQGGLVWULEXWRUVRIERRNVRQVSHFLDOHGXFDWLRQPXVLFGDQFHÀQHDUWV tourism, media and mass communication, etc.
Kapoor and Sons HALL F-7/221, Sector-16, Rohini, Delhi - 110089 Delhi 12 M: 8800588818 STALL 91 E: [email protected] Contact: Rashmi Kapoor Deals in general books, comics, Urdu, Hindi and English literature.
Karadi Tales Company Pvt. Ltd. HALL 11, First Main Road, Gandhi Nagar, 3-A Dev Regency, Adyar, Chennai - 7D, 7F-H 600020 Tamil Nadu STALL 180 M: 9940566042 E: [email protected] W: www.karaditales.com Contact: Pradeep Prabhakaran Publishers of picture books and audio books for children.
Karuna Books HALL House No. 22, Pocket 3, Delhi - 110063 Delhi 12A M: 9818390161 STALL 217-222 E: [email protected] Contact: Kapil Swaroop Publishers of books on Buddhism. K FAIR DIRECTORY 52
Kavin Book Centre HALL No. 5 Surya Complex, VOC Ground Back Side, Palayamkottai, 12A Tirunelveli - 627002 Tamil Nadu STALL 326 T: 0462-4560022 M: 8144069997 E: [email protected] Contact: Jeba Singh 'LVWULEXWRUVRIERRNVRQOLWHUDWXUHÀFWLRQVFLHQFHDQGFKLOGUHQ·VERRNV
Kendriya Hindi Sansthan Agra HALL Hindi Sansthan Marg, Agra - 282005 Uttar Pradesh 12A M: 9953664448 STALL 78-79 E: [email protected] W: www.khsindia.org Contact: Akash Babu Jain Kendriya Hindi Sansthan is an autonomous organisation of MHRD, Government of India to promote Hindi as a second language at national and international level.
Khanna Publishers HALL B 35, 9 G T Karnal Road Industrial Area, Near Telephone Exchange, 8-11 Delhi - 110033 Delhi STALL 81-83 M: 9811541460 E: [email protected] W: www.khannapublishers.in Contact: Padmakar Gautam Publishers of engineering, technical textbooks and competitive books.
Kharidobecho Shopping HALL 276, New Patel Nagar, Orai Jalaun - 285001 Uttar Pradesh 12 M: 9450127878 STALL 4 E: [email protected] Contact: V N Dixit An online platform which deals in buying and selling of books.
Kiran Institute of Career and Excellence Pvt. Ltd. HALL Shop No 6, Building No 3601-3615, Shyam Bhawan, Near Golcha Cinema, 12A Netaji Subhash Marg, Daryaganj, New Delhi - 110002 Delhi STALL 178-179 M: 9315509950 E: [email protected] W: www.kiranprakashan.com Contact: Vishal Sharma Publishers of competitive exam books, monthly magazines and current affairs. 53 NEW DELHI WORLD BOOK FAIR 2020 K
Kitabghar Prakashan HALL 4855-56/24, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9818345537 STALL 207-212 E: [email protected] W: www.kgpbooks.com Contact: Rajiv Sharma Publishers of books on Hindi literature.
Kitabwale HALL 22-4735, Prakash Deep Building, Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 396-407 M: 9599041956 E: [email protected] W: www.kitabwale.com Contact: Sukun Bhatia Publishers of literary books in Hindi and English languages.
Kohli Book Distributors HALL 40 Vaishali, Lane No 1, Dabri Palam Road, New Delhi - 110045 Delhi 8-11 M: 9810358527 STALL 344-348 E: [email protected] W: www.kohlibooks.com Contact: Jaspreet Kohli 3XEOLVKHUVRIFKLOGUHQ·VERRNVJHQHUDOERRNVVWRU\ERRNVHQF\FORSHGLDÀFWLRQDQG QRQÀFWLRQ'HDOVLQH[SRUWDQGLPSRUWRIERRNVDVZHOO
Koral Books HALL 2286-87, Essel Mansion, Arya Samaj Road, Karol Bagh, 12A New Delhi - 110005 Delhi STALL 40 T: 011-42542211 M: 9811664272 E: [email protected] W: www.koralbooks.com Contact: Kamal Sehdev Publishers of school books and general books for children.
Krishna Enterprises HALL Magadh Colony, Chandauti, Gaya - 823001 Bihar 12A M: 9811261415 STALL 289-304 E: [email protected] Contact: Raghuveer Verma Suppliers of books and high-end school material all over India. L FAIR DIRECTORY 54
Krishnamurti Foundation India HALL Vasanta Vihar, 124 Green Ways Road, RA Puram - 600028 Tamil Nadu 12 M: 9444838544 STALL 62-63 E: SXEOLFDWLRQV#NÀRQOLQHRUJ W: ZZZNÀRQOLQHRUJ Contact: Annapurna GS Publishers of books on and by J Krishnamurti, a renowned philosoper.
Kurious Kind Media Private Limited HALL 503, Dakshinayan Aprts, Plot No 19, Sec 4, Dwarka, New Delhi - 110078 8-11 Delhi STALL 548 M: 9910648886 E: [email protected] W: www.books.readomania.com Contact: Dipankar Mukherjee 3XEOLVKHUVRIÀFWLRQDQGQRQÀFWLRQERRNV
Lalit Kala Akademi HALL Rabindra Bhawan, 35, Ferozshah Road, New Delhi - 110001 Delhi 12 M: 9810780699 STALL 80 E: [email protected] W: www.lalitkala.gov.in Contact: Dilip Kumar Roy Lalit Kala Akademi (National Academy of Arts) is an autonomous organisation of Ministry of Culture, Government of India. The Akademi is engaged in promotion and publication of literature on art including monographs, journals, etc.
Lalitya International Center for Arts and Culture HALL House No 679, Ward No 3, Mehrauli, New Delhi - 110030 Delhi 12A M: 9891039829 STALL 27-29 E: [email protected] W: www.kavitakosh.org Contact: Lalit Kumar Kavita Kosh is the largest online library of Indian literature developed by volunteers.
Laxmi Book Depot HALL HALL Block H, Pocket 1, Flat No 20, Sector 16, Rohini, 12 8-11 New Delhi - 110089 Delhi STALL STALL 86 174 M: 8920862834 E: [email protected] Contact: Dinesh Deals with sale of educational books. 55 NEW DELHI WORLD BOOK FAIR 2020 L
Laxmi Enterprises HALL H Block, Pocket 3, Flat No 350, Sector 16, Rohini, New Delhi - 110089 8-11 Delhi STALL 84 M: 7042421240 E: [email protected] Contact: Deepak Kumar Deals with sale of technical, medical, engineering, educational and general books.
Leading Trails Pvt. Ltd. HALL UG 59, Above Reliance Smart Cloud 9 Towers, Sector 1, Vaishali, 8-11 Ghaziabad - 201010 Uttar Pradesh STALL 263 M: 9001824953 E: [email protected] Contact: Sagar Azad The company focuses on book printing and publishing with special emphasis on distribution for both authors and other publishers from around the world.
Lekhshree Publication HALL 4695/21-A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 8588048658 STALL 233-252 E: [email protected] Contact: Damini Maheshwari Publishers of books in Hindi language.
Lexicon Books HALL 3439, Ground Floor, Delhi Chamber Building, Delhi Gate, 8-11 New Delhi - 110002 Delhi STALL 255-256 M: 9811891965 E: [email protected] Contact: Sufyan Khan Publishers and suppliers of books on fashion, interior design, architecture and general books.
/LÀ3XEOLFDWLRQV3YW/WG HALL 211, 2nd Floor, Gagandeep, 12 Rajendra Place, New Delhi - 110008 8-11 Delhi STALL 2-3 M: 9810121660 E: LQIR#OLÀSXEOLFDWLRQVFRP L FAIR DIRECTORY 56
Contact: Ankur Mittal 3XEOLVKHUVRIOLWHUDU\ÀFWLRQDFURVVJHQUHLQFOXGLQJVKRUWVWRULHV detective and mystery stories, fantasy, war stories, paranormal, romance stories, etc.
Little Books HALL 4695/21-A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9643331302 STALL 233-252 E: [email protected] Contact: Amit Kumar Jain Publishers of books in Hindi language.
Little Genius Agencies HALL Gaya Sadar, Gaya - 823001 Bihar 12A M: 9818660208 STALL 289-304 E: [email protected] Contact: Amit Suppliers of books to schools and colleges.
Little Genius Toys Pvt. Ltd. HALL Plot No. 58, Toy City, Udyog Kendra, Ecotech-III, Greater Noida, Distt. 12 Gautam Budh Nagar - 201306 Uttar Pradesh STALL 57-61 M: 9818813130 E: [email protected] W: www.littlegeniustoys.in Contact: Satish Kumar Gautam Manufacturers of wooden teaching learning materials like jigsaw puzzles, abacus, bulding blocks, etc.
Logic Soft Pvt. Ltd. HALL No 10, First Floor, Kasturi Estate Third Street, Chennai - 600086 8-11 Tamil Nadu STALL 8-9 M: 9840125170 E: [email protected] W: www.logicsoft.co.in Contact: R Rajagopal Provides software solutions to book publishers, distributors and retailers. 57 NEW DELHI WORLD BOOK FAIR 2020 M
Lokbharti Prakashan HALL First Floor, Darbari Building, MG Marg, Allahabad - 211001 12A Uttar Pradesh STALL 273-280 M: 7897055396 E: [email protected] Contact: Anjani Kumar Mishra Publishers of literary books in Hindi language.
Lord Bill Lall HALL 17, Star Broke Drive, Chigwell, 1G75QU United Kingdom 7ABC M: 9899560535 STALL 11 E: [email protected] Contact: Simran Kaur Publishers of books on culture of England.
Loyalty Square Analytic Solutions Private Limited HALL B4 1110, Spaze IT Park, Sector 49 Sohna Road - 122018 Haryana 7D, 7F-H M: 8800964447 STALL 184 E: [email protected] W: www.unicusolympiads.com Contact: Nitin Godawat 8QLFXV2O\PSLDGVLV,QGLD·VÀUVWVXPPHURO\PSLDGVWKDWIRFXVHVRQSUDFWLFDOEDVHG questions from previous class curriculum. These exams are designed by alumni from IIT Delhi, Stanford University, University of Chicago and University of Illinois.
M P Hindi Granth Academy HALL Ravindranath Tegor Marg, Banganga, Bhopal - 462003 12A Madhya Pradesh STALL 89-90 T: 7552553034 M: 9425093092 E: [email protected] Contact: Rajendra Giri Goswami M P Hindi Granth Academy was established in 1969, and publishes Hindi medium books for college and university students.
M R Publications HALL 10, Metropole Market 2724-25, FF Kucha Chelan, Daryaganj, 12A New Delhi - 110002 Delhi STALL 321 M: 9810784549 M FAIR DIRECTORY 58
E: [email protected] Contact: Abdus Samad Publishers and distributors of literary books on Urdu, Arabic and Persian languages.
MAC Printing Solutions HALL D36, DSIIDC Packaging Complex, Kirti Nagar, New Delhi - 110015 Delhi 8-11 M: 9999383088 STALL 248 E: [email protected] Contact: Sanchal Sharma Manufacturers and suppliers of MRP/revised MRP printing machine for book publishers.
MTG Learning Media Pvt. Ltd. HALL Plot No. 99, Sector-44, Gurugram - 122003 Haryana 8-11 M: 9810145206 STALL 163-166 E: [email protected] W: www.mtg.in Contact: Vikas Sharma Publishers of books on science, technology and e-books.
Madaan Book Collection HALL Shop No. 24, MP Market, Pitampura, New Delhi - 110088 Delhi 8-11 M: 9136343985 STALL 95-102 E: [email protected] Contact: Sandeep Madan Deals in general books.
Mahatma Gandhi Antarrashtriya Hindi Vishwavidyalaya HALL Gandhi Hills, Wardha - 442001 Maharashtra 12A M: 9404822608 STALL 174-175 E: [email protected] W: www.hindivishwa.org Contact: Manoj Kumar Rai A central university established through an Act of Parliament. The objectives of University is to promote Hindi language and literature in general. Provides instructional and research facilities in the relevant branches of learning, and for the advancement and dissemination of knowledge for furtherance of its objectives. 59 NEW DELHI WORLD BOOK FAIR 2020 M
Maheshwari Vani Prakashan Private Limited HALL 4695/21-A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9811053214 STALL 233-252 E: [email protected] Contact: Arun Maheshwari Publishers of Hindi books.
Maithili Machaan HALL BE-7B, DDA Flats, Munirka, New Delhi - 110067 Delhi 12A M: 9430585378 STALL 123-124 E: [email protected] W: www.csts.org.in Contact: Amit Anand An organisation devoted to the preservation and promotion of Maithili language and literature through book fairs, literature festivals, debates, discussions and seminars involving Maithil community from India and abroad.
Maitri Dharma HALL Plot No. 17, Sector 10, Vidhyadhar Nagar - 302039 Rajasthan 12A M: 9829595342 STALL 4 E: [email protected] W: www.maitridharma.org Contact: Himanshu Agarwal Publishers of religious books in Hindi, English and Nepali languages.
Malayala Manorama HALL Andhra Vanitha Mandali Building, No. 2, Azad Bhawn Road, ITO, New Delhi - 12A 110002 Delhi STALL 125 M: 9818673111 E: [email protected] W: www.manoramaonline.com Contact: Kush Mohan Joshi Publishers of newspapers, magazines and books.
Manav Bharti HALL G-72, Second Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 9350041681 STALL 255-272 E: [email protected] Contact: Upendranath Jha Publishers of literary books in Hindi. M FAIR DIRECTORY 60
Manav Utthan Sewa Samiti HALL 2/12, East Punjabi Bagh, New Delhi - 110026 Delhi 12A M: 8826899823 STALL 76-77 E: [email protected] W: www.manavdharam.org Contact: Mathura Prasad An association working primarily with an objective of performing social and charitable works and to impart spiritual education.
Mangrol Multimedia Limited HALL B-603, Sahyog Apartment, S V Road, Kandivali (West), Mumbai - 12A 400067 Maharashtra STALL 102 M: 9821066266 E: [email protected] W: www.mangrol.in Contact: Sanjay V Shah Provides media services like writing, translation, typesetting, transcription, graphic designing, web solutions, stage and audio visual production and related services.
Manish Book Agency HALL WA-67B, Shakarpur, Delhi - 110092 Delhi 8-11 M: 9899536474 STALL 557-558 E: PDQLVKRMKDÀYH#JPDLOFRP Contact: Manish Ojha Suppliers of general books.
Manju Books HALL KC-35A, Phase 1, Ashok Vihar, Delhi - 110052 Delhi 7D, 7F-H M: 9999599256 STALL 122 E: [email protected] Contact: Aman Publishers of children’s books, encyclopedias, reference books, library books and educational books.
Manjul Publishing House Pvt. Ltd. HALL Second Floor, Usha Preet Complex, 42, Malviya Nagar, Bhopal - 462003 8-11 Madya Pradesh STALL 308-313 M: 9958232447 E: [email protected] W: www.manjulindia.com 61 NEW DELHI WORLD BOOK FAIR 2020 M
Contact: Ravi Sethi 3XEOLVKHUVRIERRNVRQVHOIKHOSVSLULWXDOLW\UHOLJLRQSHUVRQDOÀQDQFHWUDQVODWLRQV etc.
Manjuli Prakashan HALL P4-Pillanji, Sarojini Nagar, Near Indira Niketan Women Hostel, 12A New Delhi - 110023 Delhi STALL 47 M: 7982270026 E: [email protected] Contact: Sumit Bhargava Publishers of books on military science, gallantry awards, research and literature in Hindi, English, Urdu and Punjabi languages.
Manohar Publishers and Distributors HALL 4753-23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810476622 STALL 51-52 E: [email protected] W: www.manoharbooks.com Contact: Ajay Kumar Jain Distributors and publishers of books an various subjects like history, political science, economics, sociology anthropology, performing arts, religion, etc.
Manoj Publications HALL HALL HALL 761, Main Road, Burari, New Delhi - 110084 12 8-11 7D, 7F-H Delhi STALL STALL STALL 9-10 188-190 197-198 M: 9810063049 E: [email protected] W: www.manojpublications.com Contact: Sawan Gupta Publishers of books across genre like novels, comics, etc.
Manpreet Parkashan HALL 16/16, First Floor, Geeta Colony, New Delhi - 110031 Delhi 12A M: 8383896066 STALL 113 E: [email protected] Contact: Manpreet Singh 3XEOLVKHUVDQGGLVWULEXWRUVRIERRNVRQFULWLFLVPÀFWLRQDVZHOODVFKLOGUHQ·VERRNVLQ Punjabi, Hindi and English languages. M FAIR DIRECTORY 62
Marina Publications Pvt. Ltd. HALL D53-83, Luxa Road, Varanasi - 221010 Uttar Pradesh 7D, 7F-H M: 8130191613 STALL 199 E: [email protected] W: www.marinapublications.com Contact: R B Mahto Publishers of educational books for children.
Masala Pav Venture HALL E-162, Kalkaji, New Delhi - 110019 Delhi 8-11 M: 9818306050 STALL 186 E: [email protected] W: www.cocomocokids.com Contact: Shitij Malhotra Publishers of children’s books and educational aids.
Megalogix HALL L-16, Lajpat Nagar, New Delhi - 110024 Delhi 8-11 M: 9873735888 STALL 28 E: [email protected] W: www.megalogix.org Contact: Gurmeet Singh 2IIHUVVHYHUDOVROXWLRQVWR.VFKRROVVXFKDV'WKHDWUHLQWHUDFWLYHÁRRU planetarium, maths kits, TV studio, etc.
Milind Prakashan HALL House No. 32, Pocket 3, Paschim Puri, Delhi - 110063 Delhi 12A M: 9891479080 STALL 217-222 E: [email protected] Contact: Kir Swaroopti Publishers of books on Dalit & OBC literature.
Mind Power Games HALL CN-2454, Street No. 12, Wazirabad, New Delhi - 110084 Delhi 7D, 7F-H M: 8010250328 STALL 116-117 E: [email protected] W: www.minpowergames.in Contact: Bharat Bhushan Deals in games like mind power games which enhance multiple intelligence, concentration, memory, creativity, patience and thinking skills. 63 NEW DELHI WORLD BOOK FAIR 2020 M
Mindfuels Publisher and Distributors HALL WZ-55 B, Sri Nagar, Gali No-1, New Delhi - 110034 Delhi 8-11 M: 9899923670 STALL 318 E: [email protected] Contact: Kirti Kumar Bansal Deals in children’s books and general books such as worksheets, calligraphy, poems, stories, writing, activity and colouring books.
Minhaj Publications India HALL First Floor, Isma Complex, Opposite Old Bus Stand, Tandalja Road, Tandalja, 12A Vadodara - 390012 Gujarat STALL 137-138 M: 8530747313 E: [email protected] W: www.minhajpublication.in Contact: Tausif Sheikh Publishers of theological, jurisprudential, political and spirtual books with special emphasis on the writings of Shaykh-ul-Islam Dr Muhammad Tahir-ul-Qadri.
Ministry of Education, Kingdom of Saudi Arabia HALL &XOWXUDO$WWDFKH·2IÀFH$9DVDQW9LKDU1HZ'HOKL Delhi 7ABC T: 011-46445502 M: 8588886656 STALL 20-37 E: [email protected] W: www.sacaindia.com Contact: Abdullah Saleh Al-Shetwi Modern Saudi state was established in 1932. It is located in southwest Asia of the Arabian Peninsula covering an area of 2.15 million km 2. It has a population of $UDELFLVWKHRIÀFLDOODQJXDJHEXW(QJOLVKLVZLGHO\VSRNHQ5L\DGKLV WKHFDSLWDOFLW\&XUUHQF\LV6DXGL5L\DO6DXGLÁDJZDVRIÀFLDOO\DGRSWHGLQ,W remains as one of the leading oil and gas producers. 23 September is the National Day of the Kingdom.
Mithaas Services HALL 136, Pocket-E, Mayur Vihar Phase II, Delhi - 110091 Delhi 8-11 M: 9826271548 STALL 20 E: [email protected] W: www.devanshisharma.in Contact: Devanshi Sharma Provides services to publishers and writers for content, designing, reviewing and training. M FAIR DIRECTORY 64
MMI Publishers HALL D-307, Abul Fazal Enclave, Jamia Nagar, Okhla, New Delhi - 110025 12A Delhi STALL 131 M: 7290092401 E: [email protected] W: www.mmipublishers.net Contact: Mohd Mustafa Publishers of Islamic literature, Quran, Hadith, biographies and textbooks in English, Hindi and Urdu languages.
Moonlight Books HALL 20, Ek Jot Apartment, Road No.44, Pitampura, New Delhi - 110034 12 Delhi STALL 68 M: 9811101449 E: [email protected] W: www.moonlightbooks.in Contact: Jyotsna Khandelwal Publishers of books on alternative medicine, ayurveda, Buddhism, children’s books, ÀFWLRQFXLVLQHSDUHQWLQJUHOLJLRQDQGVSLULWXDOLW\
Morfosis HALL D1-D2/32/1 Civil Lines, Doctor’s Colony Rudrapur, Udham Singh Nagar, 12 Rudrapur - 263153 Uttarakhand STALL 85 M: 9717010144 E: [email protected] W: www.morfosis.in Contact: Ankita Arora Publishers of self-help books.
Mountain Walker Private Limited HALL D-304, Bhaskara DSK Vishwa, Dhayari, Pune - 411068 Maharashtra 12 M: 7755911997 STALL 67 E: [email protected] W: https://themountainwalker.com Contact: Ameen Shaikh A social enterprise which focusses on life, living, culture and economic activity in the Himalayan mountains.
Mukesh Books HALL HALL N-210, Gali No. 11, Sadatpur Extn, Delhi - 110094 Delhi 8-11 8-11 M: 9205561997 STALL STALL 319 259-260 65 NEW DELHI WORLD BOOK FAIR 2020 N
E: [email protected] Contact: Mukesh Kumar Suppliers of general books.
Mukta Book Agency HALL 3483, Netaji Subhash Marg, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9313472353 STALL 242-243 E: [email protected] Contact: Hari Narayan Ojha Suppliers of generals books.
Munshiram Manoharlal Publishers Pvt. Ltd. HALL 54, Rani Jhansi Road, New Delhi - 110055 Delhi 8-11 M: 9312253394 STALL 111-112 E: [email protected] W: www.mrml.online Contact: Madhuri Jain Publishers of books on indology, social sciences, humanities, etc.
Nagraj Novelties HALL 330, Burari, Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] Contact: Ayush Gupta Publishers of educational and story books for children.
Nanda Overseas HALL HALL 545, Guru Ram Dass Nagar, Gali No.3, Laxmi Nagar, 12 8-11 Delhi - 110092 Delhi STALL STALL 14-15 316-317 M: 9811922030 E: [email protected] Contact: Gurdeep Raj Distributors and suppliers of ebooks across genres.
National Book Shop HALL 32-B, Pleasure Garden Market, Chandni Chowk, Delhi - 110006 Delhi 12A M: 9891996919 STALL 109 E: [email protected] N FAIR DIRECTORY 66
Contact: Manpreet Publishers and sellers of story books, poetry, novels, etc. in Punjabi language.
National Book Trust, India HALL HALL Nehru Bhawan, 5 Institutional Area, Phase II, Vasant Kunj, 8-11 7D, 7F-H New Delhi - 110070 Delhi STALL STALL 488-515 1-28 M: 9560922774 E: [email protected] W: www.nbtindia.gov.in Contact: Amit Kumar Singh An autonomous body under Ministry of HRD, Govt. of India, engaged in promotion of books and reading in the country. One of the biggest multilingual publishers, NBT publishes books for children, neo-literates and for general readers on various subjects in English, Hindi and other Indian languages.
National Council for Promotion of Sindhi Language HALL West Block, No-VIII, Wing No. 7, First Floor, R K Puram, 12A New Delhi - 110066 Delhi STALL 127 M: 9414003196 E: [email protected] W: www.ncpsl.gov.in Contact: Dr Pratap Pinjani An autonomous organisation under the Ministry of Human Resource Development with its aim to promote, develop, and propagate the Sindhi language.
National Council for Promotion of Urdu Language HALL FC-33-9, Institutional Area, Jasola, New Delhi - 110025 Delhi 12A M: 011-49539099 STALL 134-136 E: [email protected] W: www.urducouncil.nic.in Contact: Zakir Hussain National Council for Promotion of Urdu Langauage (NCPUL) is an autonomous body under the Ministry of Human Resource Development (HRD), Department of Secondary and Higher Education, Government of India, set up to promote, develop and propagate Urdu language.
National Council of Educational Research and Training HALL Publication Division, NCERT Shri Aurobindo Marg, New Delhi - 110016 8-11 Delhi STALL 119-132 M: 9911225580 E: [email protected] W: www.ncertbooks.ncert.gov.in 67 NEW DELHI WORLD BOOK FAIR 2020 N
Contact: Bhoopendra Singh The Government of India established the National Council of Educational Research and Training (NCERT) as an autonomous organisation to assist and advice the government at the Center and in States in the implementation of their policies for education, specially to bring about qualitative changes in school education and teacher preparation. Over the years, the Council has evolved into a unique organisation, ZLWKLWVLQFUHDVLQJUDQJHRIDFWLYLWLHVWKDWKDVLQÁXHQFHGVFKRROHGXFDWLRQLQ,QGLD NCERT, head quartered at Delhi, comprises of departments, divisions, cells and constituent units. apart from school textbooks, Publication Division of NCERT brings out supplementary reading materials for students, research reports, teachers guides and educational journals, etc.
National Council of Educational Reserach and Training HALL Division of Educational Kits, Sri Aurobindo Marg, New Delhi - 110016 8-11 Delhi STALL 119-132 M: 9818102115 E: [email protected] W: www.ncert.nic.in Contact: V B Patil The Division of Educational Kits (DEK) of NCERT designs, develops and produces/ supplies various types of educational school kits for effective learning through hand-on minds-on learning approaches.
National Institute of Open Schooling HALL A-24/25, Sector-62, Noida - 201309 Uttar Pradesh 12 M: 9716230645 STALL 64 E: [email protected] W: www.nios.ac.in Contact: Dr Sukanta Kumar Mahapatra The National Institute of Open Schooling (NIOS), is an autonomous organisation, functioning under the aegis of Ministry of HRD, Government of India. NIOS is one of the two national boards of secondary education providing education through open and distance learning. NIOS provides a number of vocational, life enrichment and community oriented courses, besides general and academic courses at secondary and senior secondary level. It also offers elementary level courses and conducts Diploma in Elementary Education.
National Library, Kolkata HALL 1, Belvedere Estate, Alipore, Kolkata - 700027 West Bengal 12 M: 9874540334 STALL 101 E: [email protected] W: www.nlindia.org N FAIR DIRECTORY 68
Contact: Krisanu Chattopadhyay The Library is under the Department of Culture, Government of India. It is the largest library in India by volume and India’s library of public record.
Navarun HALL C-303, Jansatta Apartments, Sector 9, Vasundhara, Ghaziabad - 201012 12A Uttar Pradesh STALL 12 M: 9811577426 E: [email protected] Contact: Sanjay Joshi Publishers of books in Hindi language.
Navjagran Prakashan HALL A3, Vikas Kunj Extn., Vikas Nagar, Uttam Nagar, New Delhi - 110059 12A Delhi STALL 331 M: 9718013757 E: [email protected] W: www.navjagran.in Contact: Raj Kumar Anuragi Publishers and distributors of books in Hindi language.
Navneet Education Ltd. HALL 2E/23, Second Floor, Jhandewalan Extn, New Delhi - 110055 Delhi 8-11 T: 011-23610170 M: 9953784577 STALL 58-61 E: [email protected] W: www.navneet.com Contact: Anil Kesar Publishers of eductional and children’s books.
Navodaya Sales HALL 4695/21-A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9717724951 STALL 233-252 E: [email protected] Contact: Kashyap Mahesh Publishers of books in Hindi language.
Navodaya Shiksha Sadan HALL G-72, Second Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 011-22505852 STALL 255-272 69 NEW DELHI WORLD BOOK FAIR 2020 N
E: [email protected] Contact: Rahul Parasar Publishers of literary books in Hindi language.
Navrang Printers HALL 14, Adani Chambers, Astodia, Ahmedabad - 380001 Gujarat 8-11 M: 8200395894 STALL 29 E: [email protected] Contact: Apurva Shah Provides printing services and customized book.
Navyug Publishers HALL K-24, Hauz Khas, New Delhi - 110016 Delhi 12A M: 9891220358 STALL 112 E: [email protected] Contact: Niranjan Kumar Publishers of books in Punjabi language.
Naya Sahitya HALL 1590, Madarsa Road, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9210829766 STALL 223-232 E: [email protected] W: rajpalpublishing.com Contact: Subhash Jedia Publishers of timeless Indian classics and reference books in Hindi language.
Nayee Kitab Prakashan HALL E-17, Panchsheel Garden, Navin Shahdara, Shahdara, Delhi - 110032 12A Delhi STALL 162-165 M: 9971895162 E: [email protected] Contact: Aditya Maheshwari Publishers of Hindi books.
Neelkamal Publications Pvt. Ltd. HALL 4764, Gali No. 23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9846028953 STALL 482-483 E: [email protected] W: www.neelkamalbooks.com N FAIR DIRECTORY 70
Contact: Suresh Chandra Sharma Publishers of books on psychology, English, reference books, encyclopaedias and journals titled Edutracks and Journal of Community Guidance and Research .
Neeraj Book Centre HALL C-32, Plot No. 91, Arya Nagar Apartments, IP Extension, Patparganj, 12A Delhi - 110092 Delhi STALL 42-43 M: 9312869947 E: [email protected] Contact: Neeraj Mittal 3XEOLVKHUVRIJHQHUDOERRNVOLWHUDWXUHQRQÀFWLRQHWFLQ+LQGLDQG(QJOLVKODQJXDJHV
New Book Corner HALL RC-188, Indira Garden, Near Shiv Mandir Ashram Chowk, Khora, 8-11 Ghaziabad - 201309 Uttar Pradesh STALL 10-11 M: 9312912540 E: [email protected] Contact: Surender Kumar Distributors and suppliers of general books.
New Century Book House (P) Ltd. HALL 41-B SIDCO Industrial Estate, Ambattur, Chennai - 600050 Tamil Nadu 12A M: 9444411904 STALL 98 E: [email protected] W: www.ncbhpublisher.in Contact: B Baskar Publishers of textbooks for universities and schools as well as books on Dr B R Ambedkar.
Newview Publication Pvt. Ltd. HALL 166, First Floor, Chatta Lal Miya, Asaf Ali Road, New Delhi - 110002 7D, 7F-H Delhi STALL 177 M: 9810093952 E: [email protected] W: www.newviewpublication.com Contact: Kashif Ahmed Publishers of educational books. It also offers end-to-end solutions and develops books on demand. 71 NEW DELHI WORLD BOOK FAIR 2020 N
Nielsen (India) Private Limited HALL Seventh Floor, 404-405, ILAB Info Technology Centre, Udyog Vihar, 8-11 Phase -3, Gurugram - 122016 Haryana STALL 8-9 M: 9953748082 E: [email protected] W: www.nielsen.com Contact: Deepika Vashisht 3URYLGHVDXQLTXHUDQJHRIVHUYLFHVHQDEOLQJEXVLQHVVFULWLFDOLPIRUPDWLRQWRÁRZ seamlessly through the book supply chain. The Nielsen bookscan data is accessed via the Internet, and uses powerful web-based data delivery and analysis systems to provide reliable information for, booksellers, publishers, libraries and the media around the world.
Nikhil Publishers and Distributors Agra HALL 37, Vishnu Colony, Shahganj, Agra - 282010 Uttar Pradesh 12A M: 9458009531 STALL 22-23 E: [email protected] W: www.nikhilbooks.in Contact: Mohan Murari Sharma Library suppliers and publishers of educational and reference books.
Nikita Book Forum HALL B-167, Basement, Lajpat Nagar Part-1, New Delhi - 110024 Delhi 8-11 M: 9810287275 STALL 297 E: [email protected] W: www.nikitabookforum.com Contact: Hemant Kumar Jain Publishers of management, spiritual, trade and technology books.
Niyogi Books Private Limited HALL D77, Okhla Industrial Area, Phase 1, New Delhi - 110020 Delhi 8-11 M: 9999501175 STALL 368-371 E: [email protected] W: www.niyogibooksindia.com Contact: Trisha De Niyogi Publishers of books on art, architecture, history and culture. It has launched four imprints namely Olive Turtle, Thornbird, Paper Missile and Bahuvachan.
Notion Press Media Pvt. Ltd. HALL 38/6, McNichols Rd, Chetpet, Chennai - 600031 Tamil Nadu 8-11 M: 9962587622 STALL 327-332 O FAIR DIRECTORY 72
E: [email protected] W: www.notionpress.com Contact: Janarthanan C Provides services to authors and publishers to create, publish and sell their books.
Ocean Books Pvt. Ltd. HALL HALL 4/19, Asaf Ali Road, New Delhi - 110002 Delhi 7D, 7F-H 12A M: 9711563388 STALL STALL 66-71 289-304 E: [email protected] W: www.oceanbooks.com Contact: Kalpnath Prasad Publishers of books on literature, biographies, environment, self-help, etc.
2IÀFHRIWKH5HJLVWUDU*HQHUDO,QGLD HALL First Floor, NDCC II, Jai Singh Road, New Delhi - 110001 Delhi 12 M: 9871688672 STALL 69-70 E: [email protected] W: www.censusindia.gov.in Contact: Sandeep Rai 2IÀFHRIWKH5HJLVWUDU*HQHUDO,QGLDLVUHVSRQVLEOHIRUFRQGXFWLQJ,QGLDQFHQVXV
Offshoot Books (A Division of Ratna Sagar) HALL Ratna Sagar, Virat Bhavan, Mukherjee Nagar, Delhi - 110009 Delhi 8-11 M: 9871650653 STALL 410-411 E: [email protected] W: www.offshootbooks.com Contact: Arti Makhija Publishers of books for children and young adults including activity books, story books, work books, etc.
Omsul Publishers HALL HALL 79A, Subhash Nagar, Mani Majra, Chandigarh - 160101 12 8-11 Chandigarh STALL STALL 39 23 M: 7889175846 E: [email protected] Contact: Parvesh Chandel Publishers, retailers and wholesellers of books.
Online Book Store Agra HALL 43 UK, 425-25, Street No. 3, Umakunj, Behind K K Nagar, Near Bankhandi 12A Mandir, Sikandra, Agra - 282007 Uttar Pradesh STALL 22-23 M: 9458009535 73 NEW DELHI WORLD BOOK FAIR 2020 O
E: [email protected] W: www.nikhilbooks.com Contact: Neeraj Sharma Distributors of general books.
Orient Blackswan Pvt. Ltd. HALL 3-6-752, Himayat Nagar, Hyderabad - 500029 Telangana 8-11 M: 9650026623 STALL 378-383 E: [email protected] W: www.orientblackswan.com Contact: Prashant Kumar Gunjan Publishers of monographs by leading scholars.
Osho Darshan HALL HALL C-65, Kiran Garden, Uttam Nagar, New Delhi - 110059 Delhi 8-11 12A M: 9868560981 STALL STALL 171 18-19 E: [email protected] Contact: Durgesh Kumar Publishers of books on Osho literature.
Osho Media International HALL 17, Koregaon Park, Lane - 1, Pune - 411001 Maharashtra 12 M: 9890177767 STALL 16-19 E: [email protected] W: www.osho.com Contact: Devendra Singh Dewal Publishers and distributors of books on Osho, audio talks and videos.
Oswaal Books HALL 1/11, Sahitya Kunj, MG Road, Agra - 282002 Uttar Pradesh 12 M: 9758099160 STALL 32-35 E: [email protected] W: www.oswaalbooks.com Contact: Rohit Baghel Publishers of CBSE and ICSE study material, question banks, sample question papers and worksheets.
Oswal Publishers HALL 1/12, Sahitya Kunj, MG Road, Agra - 282002 Uttar Pradesh 12 M: 7534077222 STALL 28-31 E: [email protected] W: www.oswalpublishers.com P FAIR DIRECTORY 74
Contact: Deepak Bhadauriya Publishers of academic books according to the various national and regional academic boards in India.
Overleaf Books LLP HALL Ground Floor, Chimes Tower, Vakil Market, Chakkarpur (Chandra Lok), 7D, 7F-H DLF Phase IV, Gurugram - 122002 Haryana STALL 113 M: 9711992872 E: [email protected] W: www.overleaf.co.in Contact: Ravi K Suppliers of books, e-resources, online learning tools and library resources.
Oxford University Press HALL World Trade Tower, Twelfth Floor, C 1, Sector 16, Main DND Road, 8-11 Rajnigandha Chowk, Noida - 201301 Uttar Pradesh STALL 412-423 M: 9999313643 E: [email protected] W: www.india.oup.com Contact: Anshuman Mishra A department of the University of Oxford, the Press, furthers the University’s objective of excellence in research, scholarship and education. The products range from school courses to higher education texts to academic and reference works, and are available in both print and digital formats.
PHI Learning Pvt. Ltd. HALL Rimjhim House, 111, Patparganj Industrial Area, Delhi - 110092 Delhi 8-11 M: 9313653324 STALL 325-326 E: [email protected] W: www.phindia.com Contact: V Balamurugan Publishers of books on engineering, sciences, management, computer science, IT, humanities, social sciences, business, economics, etc.
PM Publishers Pvt. Ltd. HALL C-55, Sector 65, Gautam Budh Nagar, Noida - 201301 Uttar Pradesh 7D, 7F-H M: 7838290501 STALL 205-208 E: [email protected] W: www.pmpublishers.in Contact: Deepak Dogra Publishers of books on computers, general knowledge, art & craft, English grammar, environment studies, atlas, children’s books in Hindi and English languages. 75 NEW DELHI WORLD BOOK FAIR 2020 P
Padam Book Company HALL HALL B-577/2, Ganesh Nagar 2, Shakarpur, Delhi - 110092 Delhi 12 8-11 M: 9810833574 STALL STALL 11-12 323-324 E: [email protected] Contact: Mahavir Jain 'HDOVLQERRNVDFURVVJHQUHVOLNHÀFWLRQQRQÀFWLRQFKLOGUHQ·VERRNVHWF
Pan Macmillan Publishing India Private Limited HALL 707, Kailash Building, 26, Kasturba Gandhi Marg, New Delhi - 110001 8-11 Delhi STALL 356-364 M: 9810444501 E: [email protected] W: www.panmacmillan.co.in Contact: Vijay Sharma 3XEOLVKHUVRIJHQHUDODQGWUDGHERRNVÀFWLRQQRQÀFWLRQDQGFKLOGUHQ·VERRNV Distributors of Seagull books, Sound True, etc. Imprints include Picador, Macmillan, Menry Holt, Bluebrid, etc.
Pankaj Joshi HALL Lane 3, Near Anil Nursery, Mata Mandir Road, Aman Vihar, Ajabpurkalan, 12 Dehradun - 248001 Uttarakhand STALL 88 M: 9756928903 E: [email protected] Contact: Pankaj Joshi Publishers of books on meditation.
Parampara Publication HALL D-602, Gali No-15, Bhajanpura, Delhi - 110053 Delhi 12A M: 9811663384 STALL 233-252 E: [email protected] Contact: Shrikant Awasthi Publishers of Hindi books.
Paropkarini Sabha Ajmer HALL Rishi Udyan Pushkar Road, Ajmer - 305001 Rajasthan 12A M: 8824147074 STALL 61 E: [email protected] W: www.paropkarinisabha.com Contact: Jyotsna Publishers of ancient Indian classical books. P FAIR DIRECTORY 76
Parragon Publishing India Pvt. Ltd. HALL B 38, Sector 5, Noida - 201301 Uttar Pradesh 7D, 7F-H T: 0120-4612900 M: 9953596034 STALL 162-169 E: [email protected] W: www.parragonpublishing.com Contact: Ganesh Singh Publishers of children’s books, reference books, board books, educational workbooks, activity books, picture books, craft kits, lifestyle books, etc.
Partap Publisher and Distributor HALL 366, Ram Nagar, Krishna Nagar, Delhi - 110051 Delhi 8-11 M: 9811006733 STALL 62-65 E: [email protected] Contact: Parveen Bhandari 'LVWULEXWRUVRIWH[WERRNVFODVVLFVQRYHOVÀFWLRQQRQÀFWLRQFKLOGUHQ·VERRNV encyclopedia, maps, charts, globe, etc.
Parul Prakashani Pvt. Ltd. HALL 8/3, Chintamani Das Lane, Kolkata - 700009 West Bengal 12A M: 9002487524 STALL 104 E: [email protected] W: www.parulprakashani.in Contact: Sudipta Chakraborty Provides services from designing and editorial to sales & marketing, to production and distribution.
Penguin Random House India HALL HALL 6HYHQWK)ORRU,QÀQW\7RZHU&&\EHU&LW\*XUXJUDP 7D, 7F-H 8-11 Haryana STALL STALL 88-99 215-238 T: 0124-4785600 M: 9899124141 E: [email protected] Contact: Sanjay Giri 3XEOLVKHUVRIERRNVRQOLWHUDWXUHÀFWLRQQRQÀFWLRQKLVWRU\P\WKRORJ\DQGFKLOGUHQ·V books.
Pixtrics Infocom HALL 538K/1607, Triveni Nagar II, Lucknow - 226020 Uttar Pradesh 12 M: 9457847478 STALL 100 E: [email protected] 77 NEW DELHI WORLD BOOK FAIR 2020 P
Contact: Rakesh Kumar Sharma Provides services for creating illustrations in a multitude of style.
Pooja Book Centre HALL D-500, Ajronda, Sector-15A, Faridabad - 121007 Haryana 12 M: 9810371096 STALL 84 E: [email protected] Contact: Mukhtyar Singh Distributors of Amar Chitra Katha books.
Pouranik Publication HALL 4695/21-A, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9811053214 STALL 233-252 E: [email protected] Contact: Shail Mahesh Publishers of books in Hindi language.
Prabha Publications HALL 105, Virat Bhawan, Dr Mukherjee Nagar, Near Batra Cinema, 12A Delhi - 110009 Delhi STALL 46 M: 9313650694 E: [email protected] W: www.prabhaics.com Contact: Atul Lohiya Publishers of books for competitive examinations like UPSC, state PCS, SSC and others.
Prabhat Paperbacks HALL 4/19, Asaf Ali Road, New Delhi - 110002 Delhi 12A M: 9811261415 STALL 289-304 E: [email protected] Contact: Dharamver Verma 3XEOLVKHUVRIERRNVRQÀFWLRQ\RJDSHUVRQDOLW\GHYHORSPHQWHWF
Prabhat Prakashan HALL HALL 4/19, Asaf Ali Road, New Delhi - 110002 Delhi 7D, 7F-H 12A M: 7827007777 STALL STALL 66-71 289-304 E: [email protected] W: www.prabhatbooks.com P FAIR DIRECTORY 78
Contact: Prabhat Kumar Publishers of books on environment, drama, satire, astrology, business, economics, ÀFWLRQHGXFDWLRQFRPSXWHUKHDOWKHWF
Prabhat Saraswati HALL 4/19, Asaf Ali Road, New Delhi - 110002 Delhi 12A M: 9811499777 STALL 289-304 E: [email protected] Contact: Rajendra Singh Chaudhary Publishers of books on Hindi literature.
Pragati Sahitya Sadan HALL G-72, Third Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 9311196021 STALL 255-272 E: [email protected] Contact: Manish Kumar Publishers of books on Hindi literature.
Pragati Sansthan HALL H-601, Friends Apartments, Patparganj, Delhi - 110092 Delhi 12A M: 7827172475 STALL 255-272 E: [email protected] Contact: Shruti Maheshwari Publishers of books on Hindi literature.
Pragya Publications HALL 171, Second Floor, Pocket 14, Sector-24, Rohini, Delhi - 110085 12A Delhi STALL 217-222 M: 9211600697 E: [email protected] Contact: Pramod Kumar Publishers of books on dalit literature.
Prakashan Sansthan HALL Ansari Road, New Delhi - 110002 Delhi 12A M: 8010343851 STALL 213-216 E: [email protected] 79 NEW DELHI WORLD BOOK FAIR 2020 P
Contact: Raman Kumar Choudhary Publishers of books on literature, travel, history, competitive exams, children’s books, etc.
Pratham Books HALL Block-A1, House No. 7, Basement, Safdarjung Enclave, 7D, 7F-H New Delhi - 110029 Delhi STALL 201 M: 9990607202 E: [email protected] W: www.prathambooks.org Contact: Abhishek Khanna Publishers of storybooks in multiple languages and formats for children.
Pratibha Pratishthan HALL HALL 694-B, (Near Ajay Market), Chawri Bazar, New Delhi - 110006 7D, 7F-H 12A Delhi STALL STALL 66-71 289-304 M: 9811499777 E: [email protected] Contact: Rajendra Singh Chaudhary Publishers of Hindi books.
Pratishruti Prakashan HALL 7A Bentinc Street, Kolkata - 700001 West Bengal 12A M: 9330010032 STALL 3 E: [email protected] Contact: Arindam Kedia Publishers of Hindi books across genres.
Pratiyogita Darpan HALL HALL 2/11 A, Swadeshi Bima Nagar, Agra - 282002 Uttar Pradesh 8-11 12A M: 9997055550 STALL STALL 133-142 34-37 E: [email protected] W: www.pdgroup.in Contact: Sumit Jain Publishers of monthly magazines for the aspirants of competitive examinations.
Prestel Publishing Limited HALL 1853/10, Govindpuri Extension, Kalkaji, New Delhi - 110019 Delhi 7D, 7F-H M: 9958683821 STALL 186 E: [email protected] W: www.prestel.com P FAIR DIRECTORY 80
Contact: Tapas Dutta Publishers of books on arts, artitecture, photography and designs.
Publications Division, Ministry of Information and HALL Broadcasting, Govt. of India 8-11 Room No. 667, Sixth Floor, Soochna Bhawan, CGO Complex, Lodhi Road, STALL New Delhi - 110003 Delhi 516-531 M: 7838344971 E: [email protected] W: www.publicationsdivision.nic.in Contact: Maruf Alam Publications Division is a repository of books and journals highlighting subjects of national importance and India’s rich cultural heritage. Established in 1941, Publications Division has emerged as a premier publishing house of the Government of India, enriching national knowledge repository in distinctive streams.
Publishers & Booksellers Association of Bengal HALL 93, Second Floor, M G Road, Kolkata - 700007 West Bengal 12A M: 9681215755 STALL 106 E: [email protected] Contact: Kuntal Kanti Sarkar A representative body of publishers and booksellers in West Bengal.
Publishers and Booksellers Guild HALL Guild House, 2-B, Jhamapukur Lane, Kolkata - 700009 West Bengal 12A M: 8274004588 STALL 327 E: [email protected] Contact: Robin Basuroy Publishers & Booksellers Guild organises International Kolkata Book Fair and also promotes books in India and abroad.
Punjabi Academy, Govt. of NCT of Delhi HALL DDA Community Centre Sadar Thana Road, Motia Khan, Paharganj, 12A New Delhi - 110055 Delhi STALL 97 M: 9810139681 E: [email protected] Contact: Harpreet Kaur Established under the Government of Delhi, the Academy promotes art, culture and languages of Punjab. 81 NEW DELHI WORLD BOOK FAIR 2020 R
Pustak Pratishthan HALL 4268-B/3, Basement, Ansari Road, Daryaganj, New Delhi - 110002 12A Delhi STALL 213-216 M: 9899345120 E: [email protected] Contact: Manoj Kumar Sharma Publishers and distributors of Hindi books.
Qirtasia Education Foundation HALL RTG-80, Royal Tower, Shipra Sub City, Indirapuram, Ghaziabad - 201014 12A Uttar Pradesh STALL 26 M: 9650241333 E: [email protected] Contact: Sanaul Hasan Zaidi Publishers and dealers of books for children and adults in regional languages.
R G Marketing Co. HALL A-52, Second Floor, Freedom Fighter Enclave, IGNOU Road, New Delhi - 12 110068 Delhi STALL 6 M: 9999456156 E: [email protected] Contact: Rajneesh Gupta Manufacturers of conceptual notebooks.
R S Paper HALL I-76, Site V, Surajpur Industrial Area, Kasna, Greater Noida - 201308 8-11 Uttar Pradesh STALL 240-241 M: 9873892794 E: [email protected] Contact: Yogendra Vashishtha Offers printing and packaging services.
Radha Soami Satsang Beas HALL 5, Guru Ravi Das Marg, Pusa Road, New Delhi - 110005 Delhi 12A M: 8800497894 STALL 71-72 E: [email protected] W: www.rssb.org Contact: Poonam Singh Karan R FAIR DIRECTORY 82
$UHJLVWHUHGQRQSURÀWDEOHVRFLHW\GHGLFDWHGWRWKHVFLHQFHRILQQHUGHYHORSPHQWEDVHG on the teachings of mystics from all regions. It has its headquarters at Beas, Punjab.
Radha Swami Satsang Dinod HALL Pocket G-29, H. No.178, Sector-3, Rohini, Delhi - 110085 Delhi 12A M: 9212157623 STALL 183 E: [email protected] W: www.radhaswamidinod.org Contact: Arjun Dass Publishers and distributors of religious books.
Radhakrishna Prakashan Pvt. Ltd. HALL 7/31, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9599910644 STALL 255-272 E: [email protected] Contact: Mukesh Kumar Publishers of books on Hindi literature.
Rais Zada Publications HALL 3871, Fourth Floor, Khirki, Tafazzul Husain Kalan Mahal, Daryaganj, 12A New Delhi - 110002 Delhi STALL 322 M: 8368305471 E: [email protected] Contact: Uzma Sultana Publishers and suppliers of literary and religious books in Arabic, Persian and Urdu languages.
Raj Pocket Books HALL 330, Main Road, Burari, New Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] Contact: Ayush Gupta Publishers of children’s educational and story books.
Raja Pocket Books HALL HALL 330, Main Road, Burari, New Delhi - 110084 Delhi 7D, 7F-H 12A M: 9873723789 STALL STALL 191 197-206 E: [email protected] 83 NEW DELHI WORLD BOOK FAIR 2020 R
Contact: Ayush Gupta Publishers of children’s educational and story books.
Rajasthani Granthagar HALL First Floor, Near Ganesh Temple, Outside Sojati Gate, Jodhpur - 342001 12A Rajasthan STALL 68 M: 9414100334 E: [email protected] W: www.rgbooks.net Contact: Manish Singhvi Publishers and distributors of books on Rajasthan’s and India’s history, culture, and literature in Hindi language.
Rajasthan Patrika HALL Rajasthan Patrika, Keshargarh, JLN Marg, Jaipur - 302001 Rajasthan 12A M: 9785587681 STALL 60 E: [email protected] Contact: Vinod Kumar Singh A Hindi-language daily newspaper.
Rajasthan Urdu Academy HALL J-15 Jhalana, Institutional Area, Jaipur - 302004 Rajasthan 12A T: 0141-2709771 M: 9828016152 STALL 130 E: [email protected] W: www.rajurduacademy.org Contact: Moazzam Ali The Academy was established for the development and enrichment of Urdu language and literature.
Rajesh Prakashan HALL G-62, Gali No. 5, Arjun Nagar, Delhi - 110051 Delhi 12A M: 9891793338 STALL 10 E: [email protected] Contact: Reetu Rajput Publishers of books in Hindi language.
Rajkamal Prakashan Pvt. Ltd. HALL 1- B, Netaji Subhash Marg, Daryaganj, New Delhi - 110002 Delhi 12A M: 9311196030 STALL 255-272 R FAIR DIRECTORY 84
E: [email protected] W: www.rajkamalprakashan.com Contact: Amod Maheshwari Publishers of books in Hindi language.
Rajpal and Sons HALL 1590, Madarsa Road, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9810964249 STALL 223-232 E: [email protected] W: www.rajpalpublishing.com Contact: C S Chaturvedi Publishers of Indian classics and other books.
Rajshri Prakashan HALL 330, Main Road, Burari, Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] Contact: Ayush Gupta Publishers of educational and story books for children.
Ram Stationery HALL HALL HALL Z-122, Shyam Enclave, Gopal Nagar, Najafgarh, 12 8-11 7D, 7F-H New Delhi - 110043 Delhi STALL STALL STALL 87 18 130 M: 9718479696 E: [email protected] Contact: Ram Singh Deals in stationery, general, trade and science books as well as ebooks.
Random Publications LLP HALL 4376-A, 4B, Gali Murari Lal, Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 484-485 M: 9811870007 E: [email protected] Contact: Atul Mehra Publishers of academic books, reference books on agriculture, life science, engineering, hotel management, computer science, sociology, tourism, etc. 85 NEW DELHI WORLD BOOK FAIR 2020 R
Rare Books Library HALL 1, Adhyapak Mitra Mandal Society, Polytechnic Road, Ambawadi, 7D, 7F-H Ahmedabad - 380015 Gujarat STALL 190 M: 9898258463 E: [email protected] Contact: Pavan Shah Suppliers of rare and imported books.
Raveena Prakashan (OPC) Private Limited HALL C-316, Street No. 11, Ganga Vihar, Delhi - 110094 Delhi 12A M: 9560380382 STALL 318 E: [email protected] Contact: Diksha 3XEOLVKHUVRIERRNVDFURVVJHQUHVOLNHSRHWU\DQGÀFWLRQ
Rawat Booksellers HALL Satyam Apartment, Sector 3, Jawahar Nagar, Jaipur - 302004 8-11 Rajasthan STALL 314-315 M: 9314503209 E: [email protected] W: www.rawatbooks.com Contact: Sachin Rawat Publishers of books on social sciences and humanities.
Readers Destination HALL Sector-7, Dwarka, New Delhi - 110075 Delhi 8-11 M: 9643645301 STALL 181 E: [email protected] Contact: Pankaj R Gambhir Publishers and distributors of books.
Redgrab Books Pvt. Ltd. HALL 942, Mutthiganj, Arya Kanya Chauraha, Allahabad - 211003 Uttar Pradesh 12A M: 8887621755 STALL 170-173 E: [email protected] W: www.redgrabbooks.com Contact: Venus Kumar Kesari Publishers of books in Hindi language. R FAIR DIRECTORY 86
Repro India Ltd HALL Eleventh Floor, Sun Paradise Business Plaza, B Wing, Senapati Bapat Marg, 12 Lower Parel, Mumbai - 400013 Maharashtra STALL 45-56 M: 9650003189 E: [email protected] W: www.repro.com Contact: Jayant Banerjee Provides comprehensive printing services.
Researchco Books and Periodicals Pvt. Ltd. HALL 4735/22, Second Floor, Prakash Deep Building, Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 1 M: 9312383220 E: [email protected] W: www.researchcoindia.com Contact: Bushan Kuchroo 6XSSOLHUVRIERRNVWRXQLYHUVLW\OLEUDULHVJRYHUQPHQWRUJDQLVDWLRQVLQWKHÀHOGRI natural science and science & technology.
River Publishing House HALL A-232, Brij Vihar, Surya Nagar, Ghaziabad - 201010 Uttar Pradesh 12A M: 9599483885 STALL 143-146 E: [email protected] Contact: Lokesh Kumar Publishers of books on various subjects.
Royal Collins Publishing Group HALL Room 607 B, Sixth Floor, Tower B, Fangheng Times Square, No. 10, 7ABC Wangjing steet, Chaoyang, Beijing China STALL 14-15 M: 9811173817 E: [email protected] W: www.royalcollins.com Contact: Mohan Kalsi Publishers and distributors of acadmic books, also deals in print-on-demand and digital services.
Royal Educational Book Depot HALL A-46, A1, DDA Flats, Naraina Vihar, New Delhi - 110028 Delhi 7D, 7F-H M: 9810415078 STALL 121 E: [email protected] 87 NEW DELHI WORLD BOOK FAIR 2020 S
Contact: Amit Anand Distributors of children’s books, encyclopedias, reference books and educational books.
Rtoonz Animation Studio Pvt. Ltd. HALL 330, Main Road, Burari, New Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] Contact: Ayush Gupta Publishers of educational and story books for children.
Rupantar Trust HALL 107, Sakshara Apartments, A-3 Paschim Vihar, New Delhi - 110063 12A Delhi STALL 75 M: 9818184806 E: [email protected] Contact: Ankit Upadhyaya Publishers of books on Hindi literature and criticism.
Saar Education (I) Pvt. Ltd. HALL B-66, Sector 80, Noida - 201306 Uttar Pradesh 7D, 7F-H M: 9350042191 STALL 128 E: [email protected] W: www.saareducation.com Contact: Abhishek Goel Publishers and distributors of books for children.
Sahitya Akademi HALL HALL 35, Rabindra Bhawan, Firozshah Road, New Delhi - 110001 8-11 12A Delhi STALL STALL 85-90 118-119 M: 9818769875 E: [email protected] W: www.sahitya-akademi.gov.in Contact: Baburajan S A National Akademi of letters, Sahitya Akademi is the centeral institution for literary dialogue and promotes Indian literature in India and abroad. Besides publishing original ZRUNVVHOHFWVWKHEHVWZRUNVLQÀFWLRQSRHWU\GUDPDDQGFULWLFLVPLQGLIIHUHQW languages for translation. Also publishes children’s literature and has a rare collection of tribal literature. S FAIR DIRECTORY 88
Sahitya Amrit HALL 4/19, Asaf Ali Road, New Delhi - 110002 Delhi 12A M: 9811261415 STALL 289-304 E: [email protected] Contact: Raghuveer Verma Publishers of monthly magazine, Sahitya Amrit in Hindi language.
Sahitya Pariwar HALL 1590 Madarsa Road, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9810964249 STALL 223-232 E: [email protected] W: www.rajpalpublishing.com Contact: C S Chaturvedi Publishers of literary and general books.
Sahitya Ratnakar HALL Ramalaya H. No. 15, First Floor, Siddhartha Nagar, Gooba Garden, 12A Kalyanpur, Kanpur - 208017 Uttar Pradesh STALL 24-25 M: 9044344050 E: [email protected] Contact: Rishabh Bajpai Publishers of Hindi literature.
Sahitya Sanchay HALL B-1050, Gali No 14, First Pusta, Sonia Vihar, Delhi - 110090 Delhi 12A M: 9871418244 STALL 324 E: [email protected] W: www.sahityasanchay.com Contact: Manoj Kumar Promotes Hindi literature and organises national and international seminars.
Sahitya Sanskriti HALL G-72, Second Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 9643597948 STALL 273-280 E: [email protected] Contact: Arti Kashyap Publishers of literary works in Hindi language. 89 NEW DELHI WORLD BOOK FAIR 2020 S
Sahitya Sarovar HALL 1/11052A, Subhash Park, Navin Shahdara, Delhi - 110032 Delhi 12A M: 7065470655 STALL 213-216 E: [email protected] Contact: Shiva Nand Upadhyay Publishers and distributors of books in Hindi language.
Sahu Jain Trust HALL 18, Institutional Area, Lodhi Road, New Delhi - 110003 Delhi 12A T: 011-24698417 STALL 91-92 E: [email protected] Contact: Hema The Trust is a philanthropic organisation offering scholarships for higher studies and professional disciplines like engineering, medicine, post-graduation and other courses.
Sakshara Prakashan HALL 4695/21-A, Ansari Road , Daryaganj, Delhi - 110002 Delhi 12A M: 8766388044 STALL 233-252 E: [email protected] Contact: Vijay Kumar Jha Publishers of books on various subjects in Hindi language.
Sakshi Prakashan HALL HALL S-16, Naveen Shahdara, Delhi - 110032 Delhi 8-11 12A M: 9810461412 STALL STALL 252 1 E: [email protected] W: www.vijaygoelpublishers.com Contact: Vijay Goel 3XEOLVKHUVRIERRNVRQVHOIKHOSÀFWLRQDQGQRQÀFWLRQHWFLQ(QJOLVKDQG+LQGL languages.
Samaj Shiksha Prakashan HALL 1590 Madarsa Road, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9210829766 STALL 223-232 E: [email protected] W: www.rajpalpublishing.com Contact: Subhash Jedia Publishers of educational and personal development books. S FAIR DIRECTORY 90
Samayantar HALL 79-A, Dilshad Garden, Delhi - 110095 Delhi 12A M: 9810636082 STALL 9 E: [email protected] Contact: Thakur Prasad Chaubey Publishers of books on social, political and cultural subjects.
Samayik Prakashan HALL 3320/21, Jatwara Netaji Subhash Marg, Daryaganj, New Delhi - 110002 12A Delhi STALL 147-150 M: 9868934715 E: [email protected] W: www.samayikprakashan.com Contact: Mahesh Kumar Bhardwaj 3XEOLVKHUVRIERRNVRQZRPHQVWXGLHVMRXUQDOLVPFULWLFLVPÀFWLRQQRQÀFWLRQLQ Hindi language.
Samdarshi Prakashan HALL 335, Dev Nagar, Modi Puram, Meerut - 250110 Uttar Pradesh 12A M: 9599323508 STALL 5 E: [email protected] W: www.samdarshiprakashan.com Contact: Yogesh Kumar Publishers of books in Hindi language.
Samvad Prakashan HALL I-Block, 499, Shastri Nagar, Meerut - 250004 Uttar Pradesh 12A M: 9610584000 STALL 139-142 E: [email protected] Contact: Alok Shrivastav Publishers of Hindi translations of world literature, history and other life science books.
Samyak Prakashan HALL House No. 32, Pocket No. 3, Paschim Puri, New Delhi - 110063 Delhi 12A M: 9810249452 STALL 217-222 E: [email protected] W: www.samyakprakashan.in Contact: Sundeep Shant Publishers of books on Buddhism, Ambedkar, dalit literature, etc. 91 NEW DELHI WORLD BOOK FAIR 2020 S
Sanatan Bharatiya Sanskruti Sanstha HALL HALL R. No. 103, Sanatan Sankul Post, ONGC Panvel, Raigad, 8-11 12A Panval - 410221 Maharashtra STALL STALL 268 66-67 M: 9818518198 E: [email protected] Contact: Priyanka Singh Publishers of books in Hindi and other religional languages.
Sangeeta Books HALL E-2/4, St No-A-1, Shani Bazar Chowk, 4½ Pusta, Sonia Vihar, Delhi - 8-11 110094 Delhi STALL 49-50 M: 9999997533 E: [email protected] Contact: A L Verma Distributors of antiquarian, rare and out of print books, both Indian & foreign on art, literature, history, archaeology, etc.
Sangeet Natak Akademi HALL Rabindra Bhavan, 35, Ferozeshah Road, New Delhi - 110001 Delhi 12 T: 011-23381833 M: 9868916947 STALL 82 E: [email protected] W: www.sangeetnatak.gov.in Contact: Rani Kain The Sangeet Natak Akademi is an autonomous body of Ministry of Culture, Govt. of India. The Akademi is engaged in teaching performing and promoting drama, dance and theatre. The Akademi also publishers literature on performing arts.
Sanskriti Prakashan HALL 501, I Block Shastri Nagar, Meerut - 250004 Uttar Pradesh 12A M: 9930819020 STALL 139-142 E: [email protected] Contact: Arun Lal Publishers of literary books in Hindi and translations of other Indian languages.
Sara Books Pvt. Ltd. HALL 302A, Vardaan House, 7/28, Ansari Road, Daryaganj, New Delhi - 110002 8-11 Delhi STALL 6-7 M: 9811040727 S FAIR DIRECTORY 92
E: [email protected] W: www.sarabooksindia.com Contact: Ravindra Kumar Saxena Represents foreign publishers, particularly from USA, UK and European countries in the Indian subcontinent.
Sarvodaya Bal Pustak Mandir HALL G-17A, Second Floor, Jagatpuri, Delhi - 110051 Delhi 12A M: 9266135919 STALL 273-280 E: [email protected] Contact: Brijesh Sharma Publishers of books on Hindi literature.
Sasta Sahitya Mandal HALL N-77, First Floor, Connaught Circus, New Delhi - 110001 Delhi 12A M: 9999088526 STALL 73-74 E: [email protected] W: www.sastasahityamandal.org Contact: Mahendra Singh Bisht Established by Mahatama Gandhi with the help of G.D.Birla and Jamna Lal Bajaj in 1925 with the sole purpose of disseminating India’s age old message of religious harmony.
Satluj Prakashan HALL SCF-267, Second Floor, Sector-16, Panchkula - 134113 Haryana 12A M: 9417267004 STALL 49-50 E: [email protected] W: www.satlujprakashan.com Contact: Chander Bhan Publishers and distributors of children’s books and literary works in Hindi language.
Satsahitya Prakashan HALL 694-A, (First Floor), Chawri Bazar, Delhi - 110006 Delhi 12A M: 9811022103 STALL 289-304 E: [email protected] Contact: Ajay Sharma Publishers of books in Hindi language.
Satsahitya Seva Kendra HALL D-2/126, Third Pushta, Gali No. 2, Sonia Vihar, Sabhapur, North East Delhi, 12A Delhi - 110094 Delhi STALL 38-39 93 NEW DELHI WORLD BOOK FAIR 2020 S
M: 9310232155 E: [email protected] W: www.ashram.org Contact: Kamlesh Tiwari Deals in books in Hindi language.
Saurabh Book Service HALL 105, First Floor, Taimoor Nagar, Near New Friends Colony, 8-11 New Delhi - 110065 Delhi STALL 251 M: 9871344046 E: [email protected] Contact: Saurabh Kumar Distributors of general books.
Sawan Kirpal Ruhani Mission HALL Kirpal Ashram, 2 Canal Road, Vijay Nagar, Sant Kirpal Singh Marg, 12A Delhi - 110009 Delhi STALL 86-87 T: 011-27117100 M: 9810893666 E: [email protected] W: www.sos.org Contact: Basant Kaur 3XEOLVKHUVRIERRNVRQSHDFHDQGVSLULWXDOLW\LQRYHUÀIW\ODQJXDJHV
Scholars Hub HALL C-154, Second Floor, East of Kailash, New Delhi - 110065 Delhi 7D, 7F-H M: 9811170218 STALL 181-183 E: [email protected] Contact: Vipin Bajaj Publishers and distributors of children’s books.
Scholastic India Pvt. Ltd. HALL HALL Ground Floor, Sigma Centre, A-27, Infocity-1 Sector-34, 8-11 7D, 7F-H Gurugram - 122001 Haryana STALL STALL 286-288 132-145 M: 9711161615 E: [email protected] W: www.scholasticindia.com Contact: Lakshay Sharma Publishers and distributors of children’s books. S FAIR DIRECTORY 94
Science Universe HALL Plot No. 79, Feel Good Homes, Street No. 3, Gandhamguda - 500009 12A Telangana STALL 101 M: 9618883579 E: [email protected] W: www.srisrisriguruviswasphoorthi.org Contact: Vinod Sambangi 6FLHQFHXQLYHUVHLVDVFLHQWLÀFDQGVSLULWXDOVWDOOHVWDEOLVKHGXQGHUWKHGLYLQHJXLGDQFH of Sri Sri Sri Guru Viswa Sphoorthi.
Setu Prakashan Pvt. Ltd. HALL 803, Amaltas Shipra Srishti, Ahinsa Khand 1, Indirapuram, Ghaziabad - 12A 201014 Uttar Pradesh STALL 44 M: 8130745954 E: [email protected] W: www.setuprakashan.com Contact: Amita Pandey Publishers of books in Hindi language.
Shabd Bharti HALL 7/23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9717308753 STALL 255-272 E: [email protected] Contact: Radha Kashyap Publishers of books on Hindi literature.
Sharjah Book Authority HALL Dept. of Cultural & Information, Govt. of Sharjah, P. O. Box: 73111, 7ABC Sharjah UAE STALL 40-41 T: 971 6 5140151 M: 971 50 3665490 E: [email protected] W: www.sibf.com Contact: Mohan Kumar Organisers of the Sharjah International Book Fair and Sharjah Children’s Reading Festival, the two major book fairs of Sharjah.
Sheel Books Mart HALL House No. 22, Pocket No. 3, Club Road, Paschim Puri, 12A New Delhi - 110063 Delhi STALL 217-222 M: 9650375047 95 NEW DELHI WORLD BOOK FAIR 2020 S
E: [email protected] Contact: Kiran Shant Publishers of books on dalit literature, Phule, Shahuji, Ambedkar and Buddhism.
Sheth Publishing House HALL G/12, Suyog Industrial Estate, LBS Marg, Vikhroli (West), 8-11 Mumbai - 400083 Maharashtra STALL 253-254 M: 9892230308 E: [email protected] Contact: Purvish Sheth Publishers and exporters of children’s and educational books, and teaching aids. Also provides outsourcing jobs for content and illustration for foreign clients.
Shiksha Bharati HALL 1590, Madarsa Road, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9910018896 STALL 223-232 E: [email protected] W: www.rajpalpublishing.com Contact: Pranav Johri Publishers of Indian classics and books by renowned authors.
Shiksha Prasad Kendra HALL G-72, Jagatpuri, Delhi - 110051 Delhi 12A T: 011-23240464 STALL 255-272 E: [email protected] Contact: Prashant Yadav Publishers of books in Hindi language.
Shiromani Gurdwara Parbandhak Committee HALL Teja Singh Samundri Hall, Sri Harmandir Sahib Complex, 12A Sri Amritsar - 143006 Punjab STALL 114-115 M: 9417839076 E: [email protected] W: www.sgpc.net Contact: Jasvir Singh Longowal SGPC is a religious organisation of Sikhs working towards the welfare of humanity. *ROGHQ7HPSOHLVWKHKHDGRIÀFHRIWKLVRUJDQLVDWLRQ S FAIR DIRECTORY 96
Shishyashram Charitable Trust HALL 305, DA Block, Sheeshmahal Apartment, Shalimar Bagh, 12A Delhi - 110088 Delhi STALL 95 M: 9312817676 E: [email protected] Contact: Devender Kumar Publishers of books on religion in different Indian languages.
Shiv Das and Sons HALL 9665, Islam Ganj, Azad Market, Delhi - 110006 Delhi 8-11 M: 9990040400 STALL 46-47 E: [email protected] W: www.shivdas.in Contact: Shiva Arora Publishers of educational books, self-help books, study material, question papers for CBSE and B.com students, etc.
Shivangi Book International HALL HALL B-577/2, Ganesh Nagar 2, Shakarpur, Delhi - 110092 Delhi 12 7D, 7F-H M: 9810833574 STALL STALL 24-25 114-115 E: [email protected] Contact: Mahavir Jain 'HDOVLQÀFWLRQQRQÀFWLRQEXVLQHVVVFLHQFHFKLOGUHQ·VKREELHVDQGRWKHUJHQHUDO books.
Shivna Prakashan HALL P C Lab Samrat Complex, Opp Bus Stand, Sehore, Madhya Pradesh - 12A 466001 Madhya Pradesh STALL 307 M: 9806162184 E: [email protected] W: www.shivnaprakashan.blogspot.in Contact: Shaharyar Amjad Khan Publishers of general books in Hindi language.
Shree Paramhans Swami Adgadanand Ji Ashram Trust HALL Shakteshgarh, Chunar- Rajgarh Road, Mirzapur - 231304 12A Uttar Pradesh STALL 181 M: 7738007161 97 NEW DELHI WORLD BOOK FAIR 2020 S
E: [email protected] W: www.yatharthgeeta.com Contact: Darshan Tiwari Publishers of religious books in Hindi language.
Shree Publishers and Distributors HALL 4735/22, Prakashdeep Building, Ansari Road, Daryaganj, New Delhi - 8-11 110002 Delhi STALL 396-407 M: 9818579904 E: [email protected] W: www.shreepublishers.com Contact: Ambuj Jain Publishers and distributors of higher education textbooks and reference books.
Shree Satyam Prakashan HALL Ward No. 38, Opp. Khadi Bhandar, Gandhi Chowk, Jhunjhunu - 333001 12A Rajasthan STALL 328 M: 9828882680 E: [email protected] W: www.shreesatyam.com Contact: Rishi Agarwal Publishers of books in Hindi language.
Shri Akhil Bharat Varshiya Sadhumargi Jain Sangh HALL 1003-C, Oberoi Garden, Thakur Gaon, Kandiwali (East), Mumbai - 12A 400401 Maharashtra STALL 314 M: 7231855008 E: [email protected] W: www.sadhumargi.com Contact: Lalit Bothra Publishers of books on the religious teachings of Jainism.
Shri Lal Bahadur Shastri Rashtriya Sanskrit Vidyapeetha HALL Qutub Institutional Area, New Delhi - 110016 Delhi 12A T: 011-46060502 M: 9818247813 STALL 100 E: [email protected] W: www.slbsrsv.ac.in Contact: Dr. Gyandhar Pathak The Vidyapeetha publishes books on Sanskrit literature for promotion of Sanskrit language and Indian culture both in India and abroad. S FAIR DIRECTORY 98
Shri Narayana Book Trust HALL 14E, Community Centre, Basant Lok, Vasant Vihar, New Delhi - 110057 12 Delhi STALL 73 M: 9873119887 E: [email protected] Contact: George V J Publishers of socio-spiritual books. Also promotes Sanskrit language and literature.
Shroff Publishers and Distributors Pvt. Ltd. HALL B-103, First Floor, Sanpada Railway Station Complex, Sanpada East, 8-11 Navi Mumbai - 400705 Maharashtra STALL 66-69 M: 9820180160 E: [email protected] W: www.shroffpublishers.com Contact: Vikas Kasalkar Publishers and distributors of books across genres like information technology and computing, hospitality management, etc.
Shubhda Prakashan HALL 1/11052A, Subhash Park, Delhi - 110 03 Delhi 12A M: 9811684808 STALL 213-216 E: [email protected] Contact: Rahul Sharma Publishers and distributors of books in Hindi language.
Siddharth Books HALL Dr Ambedkar Gate, Ramnagar Extention, Mandoli Road, 12A Shahdara - 110032 Delhi STALL 16-17 M: 9810123667 E: [email protected] W: www.gautambookcenter.com Contact: Anuj Kumar Publishers and distrbutors of books on Ambedkar, Buddha, saints, women, dalit and sociology.
Siddharth Books HALL 4648/21, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9990769676 STALL 266-267 E: [email protected] 99 NEW DELHI WORLD BOOK FAIR 2020 S
Contact: Manmohan Deals in Indian and foreign books.
Silver Glitter Creation HALL HALL 602, Kasana Tower, Commercial Belt, Alpha-1, Greater 8-11 7D, 7F-H Noida - 201308 Uttar Pradesh STALL STALL 296 200 M: 8448772893 E: [email protected] W: www.hablootoys.com Contact: Vijay Laxmi 'HDOVLQHGXFDWLRQDODQGVFLHQWLÀFDLGV
Simon and Schuster India HALL 163, Sixth Floor, Corenthum, A-41, Sector 62, Noida - 201301 8-11 Uttar Pradesh STALL 151-158 M: 9953596036 E: [email protected] W: www.simonandschuster.co.in Contact: Ranjit Singh 3XEOLVKHUVRIÀFWLRQQRQÀFWLRQDQGFKLOGUHQ·VERRNV
Sindhi Academy HALL CPO Building, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9891780108 STALL 126 E: [email protected] W: www.sindhiacademydelhi.com Contact: Praveen Anwani An autonomous body working under the Department of Art, Culture & Languages, Govt. of NCT., Sindhi Academy promotes Sindhi language and literature.
Sir Ganga Ram Hospital HALL Sarhadi Gandhi Marg, Old Rajinder Nagar, Rajinder Nagar, New Delhi - 8-11 110060 Delhi STALL 408-409 M: 9810207430 E: [email protected] W: www.sgrh.com Contact: Deepak Shaklya Provides comprehensive healthcare services in India. S FAIR DIRECTORY 100
Sirjan Prakashan HALL Chandra Metal Near Tiranga Chowk, Sector-2 Market, Meerut - 250004 12A Uttar Pradesh STALL 139-142 M: 9320016684 E: [email protected] Contact: Dinesh Kumar Malhotra Publishers of Hindi translations of world literature.
Somya Books HALL G-62, Gali No. 5, Arjun Nagar, Delhi - 110051 Delhi 12A M: 9891793338 STALL 11 E: [email protected] Contact: Reetu Rajput Publishers of Hindi literature.
Sooraj Pocket Books HALL 802, Genevia B, Casa Rio, Palava, Kalyan-Shil Road, Dombivli East, 12A Mumbai - 421204 Maharashtra STALL 182 M: 9167518007 E: [email protected] W: www.soorajbooks.com Contact: Anadi Subhanand 3XEOLVKHUVRIERRNVRQÀFWLRQLQ+LQGLODQJXDJH
Speaking Tiger Books LLP HALL 4381/4, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9910908274 STALL 103-107 E: [email protected] W: www.speakingtigerbooks.com Contact: Usha Jha 3XEOLVKHUVRIERRNVRQÀFWLRQDQGQRQÀFWLRQIURPDFURVVWKHZRUOG
Speaking Tiger Publishing Pvt. Ltd. HALL 4381/4, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9873355840 STALL 103-107 E: [email protected] W: www.feelbooks.in Contact: Dr Diplip Hazarika 3XEOLVKHUVDQGGLVWULEXWRUVRIÀFWLRQDQGQRQÀFWLRQERRNV 101 NEW DELHI WORLD BOOK FAIR 2020 S
Spring Time Software HALL G-27, First Floor, Sector-3, Noida - 201301 Uttar Pradesh 8-11 M: 9212460342 STALL 282-285 E: [email protected] W: www.springtimesoftware.net Contact: Sunil Dhingra Provides software services to publishers, distributors and booksellers.
Sri Kabir Gyan Prakashan Kendra HALL Shri Sant Kabir Gyan Marg, Sihodih, Sirsia, Giridih - 815302 Jharkhand 12A M: 9431453090 STALL 332 E: [email protected] Contact: Narayan Das Publishers of religious books in Hindi language.
Sri Lanka Book Publishers’ Association HALL 83, Parliament Road, Battaramulla Sri Lanka 7ABC T: +94112696821 M: +94777317400 STALL 18 E: [email protected] Contact: Vijitha Yapa SLBPA represents nearly 200 publishers and is the organiser of the Colombo International Book Fair and Kandy Book Fair and awards the highest literary prize to the best Sinhala novel annually.
Sri Vedmata Gayatri Trust (TMD) HALL 6KULUDP3XUDP*D\DWDUL1DJDU3RVW2IÀFH6KDQWLNXQM+DULGZDU 12A Uttarakhand STALL 281-288 M: 9258360853 E: [email protected] W: www.awgp.org Contact: Ram Naresh Singh Publishers of books on spirituality, health, life management, Indian culture, yoga, etc.
Star Publications Pvt. Ltd. HALL 4/5 B, Asaf Ali Road, New Delite Cinema, New Delhi - 110002 Delhi 12A M: 9810046283 STALL 30-31 E: [email protected] W: www.starpublic.com Contact: Anil Varma Publishers and distributors of all types of books in Hindi, English and other Indian languages. S FAIR DIRECTORY 102
Star View Traders HALL WZ-57, Plot No-111, Mangal Bazar, Vishnu Garden, New Delhi - 110018 8-11 Delhi STALL 187 M: 8929433640 E: [email protected] Contact: Gurpreet Jassi Manufacturers of college and school experiment kits.
Storyside India LLP HALL 215, Janki Centre, Off Veera Desai, Andheri West, Mumbai - 400058 12A Maharashtra STALL 53-54 M: 9818051950 E: [email protected] W: www.storytel.com Contact: Sukriti Sharma An audiobook and e-book streaming app service, offering unlimited listening and reading of books in English, Hindi, Marathi, Urdu, Bangla and Malayalam languages.
Student Book Centre HALL Z-19, West Patel Nagar, New Delhi - 110008 Delhi 8-11 M: 9868241777 STALL 264-265 E: [email protected] Contact: Sunil Wadhwa Distributors of all kinds of books.
Sukh HALL 306, Plot No-10, K.P. Block Commercial Complex, Pitampura, 12 New Delhi - 110034 Delhi STALL 90 M: 9811199049 E: [email protected] W: www.sukhpublishing.com Contact: Vivek Chaudhary Publishers of books in English and Hindi languages. Also provides translations in regional languages.
Sultan Chand and Sons HALL 4792/23, Daryaganj, New Delhi - 110002 Delhi 8-11 T: 011-23266105 M: 9810622267 STALL 41-42 E: [email protected] W: www.sultanchandandsons.com 103 NEW DELHI WORLD BOOK FAIR 2020 S
Contact: Gangadhar Choudhary Publishers of textbooks and educational books on management, economics, law, accountancy, mathematics, physics and chemistry.
Sumedha Publishing House HALL UG-1, Ansal Chamber-1, Bhikaji Cama Place, New Delhi - 110066 Delhi 8-11 M: 9891591329 STALL 249 E: [email protected] W: www.sumedhapublishinghouse.com Contact: Vijay Bangia 3XEOLVKHUVDQGVHOOHUVRIERRNVRQODZJHQHUDOÀQDQFLDOUXOHVHWF
Sunil Sahitya Sadan HALL 3320-21, Jatwara, Daryaganj, New Delhi - 110002 Delhi 12A M: 9868934715 STALL 147-150 E: [email protected] Contact: Mahesh Kumar Bhardwaj Publishers of books on Hindi literature.
Sunita Publications HALL S-1, SGM House, Nataniyo Ka Rasta, Choura Rasta, Jaipur - 302003 12A Rajasthan STALL 315 M: 9649499556 E: [email protected] W: www.sunitapublications.in Contact: Himanshu Sharma Publishers of competitive books, basic reasoning material, spoken English books, general education books, model question papers, English grammar books, etc.
Sunrise Publishers HALL 32/33-A, Street No. 9, Bhikam Singh Colony, Vishwas Nagar, Shahdara, 8-11 Delhi - 110032 Delhi STALL 15-16 M: 9312928199 E: [email protected] W: www.sunrisepublisher.com Contact: Rakesh Kumar Publishers and exporters of children’s books, story books, activity books, puzzles, board books, etc. T FAIR DIRECTORY 104
Superlike Educational Solutions Private Limited HALL 688, Street No. 7, Opposite Shiv Mandir, Sadarpur Colony, Sector-45, 12 Noida - 201303 Uttar Pradesh STALL 97 M: 7042123177 E: [email protected] W: www.superlikestudies.com Contact: Ashutosh Gupta 3URYLGHVVHUYLFHVLQWKHÀHOGRIVFKRROHGXFDWLRQ
Suruchi Prakashan HALL Keshav Kunj, Jhandewala, Deshbandhu Gupta Road, New Delhi - 110055 12A Delhi STALL 62-63 T: 011-23514672 M: 9425224445 E: [email protected] W: www.suruchiprakashan.in Contact: Rajendra Mohan Arora Publishers of books on literature, history, social sciences, economics, etc.
Sweet Chillies HALL C-307, Milton Apartments, 35A Juhu Tara Road, Santacruz West, 8-11 Mumbai - 400949 Maharashtra STALL 556 M: 9930674251 E: [email protected] Contact: Anirban Das Provides services to authors to showcase their works across different events and platforms.
Takshila Publication HALL C-404 (Basement), Defence Colony, New Delhi - 110024 Delhi 7D, 7F-H M: 9910581388 STALL 74-75 E: [email protected] W: www.takshila.net Contact: Shradha Publishers of books and periodicals on literature, science and arts.
Tat Baba Foundation HALL Gopeswar, Vrindavan, Mathura - 281121 Uttar Pradesh 12A M: 9873550973 STALL 330 E: [email protected] 105 NEW DELHI WORLD BOOK FAIR 2020 T
Contact: B.C. Dhiman Publishers and distributors of spiritual books in Hindi language.
Tathagat Book Agency HALL House No. 22, Pocket-3, Paschim Puri, Delhi - 110063 Delhi 12A M: 9818390161 STALL 217-222 E: [email protected] Contact: Kapil Swaroop Publishers of books on Buddhism.
The Asiatic Society HALL 1, Park Street, Kolkata - 700016 West Bengal 8-11 M: 9433172019 STALL 48 E: [email protected] W: www.asiaticsocietykolkata.org Contact: Nirmalendu Ghoshal Publishers of books on Indology and oriental studies.
The Book Line HALL 106, 4787/23 Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9810691567 STALL 552 E: [email protected] W: www.bookline.co.in Contact: Sunil Bhanot Publishers and distributors of general books in English and Hindi languages.
The Consultancy Group HALL 2188/6, Main Patel Road, South-Side of Metro Pillar No.224, 8-11 Near Shadipur Metro Station, New Delhi - 110008 Delhi STALL 183 M: 9811000781 E: [email protected] W: www.project-report.net Contact: Ratan Kumar Deals in preparation of reports such as project reports, loan bankable project reports, pollution approvals, etc.
The Energy and Resources Institute (TERI) HALL TERI Press, Darbari Seth Block, India Habitat Centre, Lodhi Road, 8-11 New Delhi - 110003 Delhi STALL 551 T FAIR DIRECTORY 106
M: 9810779178 E: [email protected] W: www.bookstore.teri.res.in Contact: Sanjeev Sharma Publishers, developers and distributors of higher education books and reference books on energy, environment and sustainable development, etc.
The Federation of Educational Publishers in India HALL X-39, Institutional Area, Karkardooma, Delhi - 110092 Delhi 12 T: 011-22377017 STALL 104 E: [email protected] Contact: Arvind Guleria The Federation of Educational Publishers in India is an apex and co-ordinating body of educational publishers in India. It has 300 leading publishers as its direct members DQGKDVDFFRUGHGDIÀOLDWLRQWRDVVRFLDWLRQVRIGLIIHUHQWVWDWHV
The Federation of Indian Publishers HALL 18/1-C, Institutional Area, Aruna Asaf Ali Marg, New Delhi - 110067 12 Delhi STALL 102 T: 011-26852263 M: 9811766188 E: ÀSSUHVLGHQW#JPDLOFRP W: ZZZÀSRQOLQHRUJ Contact: Anu Talwar The Federation of Indian Publishers is the apex body of publishers of all Indian languages representing more than 80 per cent of the publishing industry to which DUHIHGHUDWHGWKHYDULRXVODQJXDJHSXEOLVKHUV7KH)HGHUDWLRQLVDOVRDIÀOLDWHGWRWKH International Publishers Association (IPS), Geneva, and is the only representative body of Indian Publishers.
The Gideons International in India HALL P.O. Bag-2, Bank Colony, Jai Jawahar Nagar, Sainikpuri, 12A Secunderabad - 500087 Telangana STALL 306 M: 9899236257 E: [email protected] W: www.gideons.org Contact: Baboo Lal $QRQSURÀWDEOHRUJDQLVDWLRQ*LGHRQ·V,QWHUQDWLRQDOLVHQJDJHGLQWKHGLVWULEXWLRQDQG promotion of the Bible. 107 NEW DELHI WORLD BOOK FAIR 2020 T
The Institute of Company Secretaries of India HALL ICSI House, 22, Institutional Area, Lodhi Road, New Delhi - 110003 12 Delhi STALL 79 T: 011-45341022 E: [email protected] W: www.icsi.edu Contact: Preeti Kaushik Banerjee The Institute of Company Secretaries of India (ICSI) is a premier national professional body constituted under an Act of Parliament (The Company Secretaries Act, 1980) to regulate and develop the profession of Company Secretaries in India. ICSI functions under the jurisdiction of the Ministry of Corporate Affairs, Government of India. With LWVKHDGTXDUWHUVLQ1HZ'HOKL,&6,KDVIRXU5HJLRQDO2IÀFHVLQ1HZ'HOKL&KHQQDL .RONDWD0XPEDLDQG&KDSWHURIÀFHVDFURVV,QGLD7KH,QVWLWXWHSURYLGHVTXDOLW\ education to the students of Company Secretaries course and has been contributing to the initiatives of Government of India that have potential to excel the social- economic growth of India.
The Times of India HALL Bennett Coleman Co. Ltd., The Times of India, TGB, 6, Bahadurshah Zafar 12 Marg, New Delhi - 110002 Delhi STALL 42 T: 011-40738254 M: 9810013209 E: [email protected] Contact: Neeraj Bharti Publishers of books across genres in different languages.
Tinny Educational Aids HALL R Z/B-2, Suraj Vihar, Kakrola, Dwarka Mor, Dwarka, New Delhi - 110078 7D, 7F-H Delhi STALL 172 M: 7011171728 E: [email protected] W: www.tinnyeduactionalaids.com Contact: Upendra Thakur Deals in educational toys for children.
Tirumala Softwares HALL 189, First Floor, Pratap Nagar, Mayur Vihar - 1, Delhi - 110091 Delhi 8-11 M: 9810989818 STALL 366 E: [email protected] Contact: Rakesh Developers of smart class, catering to all types of e-learning projects to the publishers. T FAIR DIRECTORY 108
Trans Infopreneur Inc. HALL 445/1, Outpost Police Station Road, Off Kodigehalli Main Rd, 8-11 Sahakaranagar, Bangalore - 560092 Karnataka STALL 269-273 M: 9980809933 E: [email protected] W: transinfopreneur.com Contact: Sinish Distributors of general books.
Tribal Research & Cultural Institute HALL St Corporation Building, Second Floor, Krishnanagar, Agartala - 799001 12 Tripura STALL 95 T: 0381-2324389 M: 9436195274 E: [email protected] W: www.trci.tripura.gov.in Contact: Biswajit Das Tribal Research & Cultural Institute, Government of Tripura, publishes books on tribes of Tripura.
Tricolor Books HALL 330, Main Road Burari, New Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] Contact: Ayush Gupta Publishers of educational and story books for children.
Trishala Learning System Private Limited HALL Plot No. 316, Sector-24, Faridabad - 121005 Haryana 7D, 7F-H M: 9643104727 STALL 202 E: [email protected] W: www.key2practice.com Contact: Vishal Arora Publishers of worksheets and educational books for children.
Tulika Publishers HALL 305, Manickam Avenue, TTK Road, Alwarpet, Chennai - 600018 7D, 7F-H Tamil Nadu STALL 129 M: 9818374402 E: [email protected] Contact: Ravinder Kumar 109 NEW DELHI WORLD BOOK FAIR 2020 U
Publishers of children’s books in English, Hindi, Tamil, Malayalam, Kannada, Telugu, Marathi and Bangla languages.
Ultimate Science World HALL H. No. N18, Brahampuri, Delhi - 110053 Delhi 8-11 M: 7011255161 STALL 43 E: [email protected] Contact: Naeem Ahmad 'HDOVLQHGXFDWLRQDODQGVFLHQWLÀFDLGV
Unicorn Books Pvt. Ltd. HALL F2-16, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A T: 011-23250704 M: 9971194141 STALL 58-59 E: [email protected] W: www.unicornbooks.in Contact: Tarun Gupta Publishers of general and trade books in English and Hindi languages.
Unicorn Digital Publishing LLP HALL F2-16, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A T: 011-23275434 M: 9971194141 STALL 58-59 E: [email protected] W: www.unicornbooks.in Contact: Tarun Gupta Distributors of educational books in English and Hindi languages.
University Publication HALL 22/4735, Prakash Deep Building, Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 396-407 M: 9313642005 E: [email protected] W: www.universitypublication.com Contact: Avnish Jain Publishers of textbooks and reference books.
Upkar Prakashan HALL HALL 2/11 A, Swadeshi Bima Nagar, Agra - 282002 Uttar Pradesh 8-11 12A M: 9997055550 STALL STALL 133-142 34-37 E: [email protected] W: www.upkar.in U FAIR DIRECTORY 110
Contact: Sumit Jain Publishers of general books and books for competitive exams in Hindi and English languages.
Upkar Stationary Pvt. Ltd. HALL 638, Bypass Road, Opp. Hanuman Mandir, Artoni, Agra - 282007 8-11 Uttar Pradesh STALL 133-142 M: 9997055550 E: [email protected] W: www.tajwhite.in Contact: Sumit Jain Manufacturers of stationery products like scrap books, note-pads, registers, etc.
Urdu Academy Delhi HALL CPO Building, Kashmere Gate, Delhi - 110006 Delhi 12A M: 9891954430 STALL 132 E: [email protected] W: www.urduacademydelhi.com Contact: Uzair Hasan Publishers of books in Urdu language, concerning society, culture, language and literature.
Urdu Book Review HALL 1739/3 (Basement), New Kohinoor Hotel, Pataudi House, Daryaganj, 12A New Delhi - 110002 Delhi STALL 129 M: 9953067664 E: [email protected] Contact: Nadeem Arif Publishers of magazine Urdu Book Review and also promotes the habit of reading.
Uttar Pradesh Hindi Sansthan HALL 6, Mahatma Gandhi Marg, Hazratganj, Lucknow - 226001 12A Uttar Pradesh STALL 177 M: 8009151888 E: [email protected] W: www.uphindisansthan.in Contact: Shivraj Publishers of books in Hindi language. 111 NEW DELHI WORLD BOOK FAIR 2020 V
VDK Publications Pvt. Ltd. HALL 641, First Floor, Mukherjee Nagar, Opp Signature View Apartment, 12A New Delhi - 110009 Delhi STALL 185-196 M: 8130392355 E: [email protected] W: www.drishtiias.com Contact: Ajay Karakoti Provides complete Hindi & English medium coaching classes, books, notes, lectures for UPSC civil services aspirants and state service aspirants (distance education).
Vagdevi Prakashan, Bikaner HALL Vinayak Shikhar, Near Polytechnic College, Shivbari Road, 12A Bikaner - 334003 Rajasthan STALL 253 M: 9252051675 E: [email protected] W: www.vagdeviprakashan.com Contact: Makabul Khan 3XEOLVKHUVRIERRNVRQOLWHUDWXUHVRFLDOVFLHQFHKLVWRU\ÀFWLRQSKLORVRSK\HWFLQ Hindi language.
Vak HALL 21A, Ansari Road Daryaganj, New Delhi - 110002 Delhi 12A M: 9999578418 STALL 233-252 E: [email protected] Contact: Aditi Maheshwari Goyal Publishers of books in Hindi language.
Vani Prakashan HALL 4695/21-A, Daryaganj, Ansari Road - 110002 Delhi 12A M: 9899593214 STALL 233-252 E: [email protected] W: www.vaniprakashan.in Contact: Ameeta Maheshwari Publishers of books in Hindi language.
Vanikaa Publications HALL NA-168, Gali No. 6, Vishnu Garden, New Delhi - 110018 Delhi 12A M: 9412713640 STALL 325 E: [email protected] V FAIR DIRECTORY 112
Contact: Niraj Sharma Publishers of books in Hindi language.
Vasu Prakashan HALL 330, Main Road, Burari, New Delhi - 110084 Delhi 12A M: 9873723789 STALL 197-206 E: [email protected] Contact: Ayush Gupta Publishers of educational and story books for children.
Ved Mandir Prakashan HALL 16, Paschimi Marg, Vasant Vihar, New Delhi - 110057 Delhi 12A M: 9811871976 STALL 319 E: [email protected] W: www.vedmandir.com Contact: Kapil Rampal Publishers of books on vedas, written by Swami Ramswarupji Yogacharya.
Versatile Publications HALL 429-4A, First Floor, Street No 1, Friends Colony, Shahdara, 7D, 7F-H Delhi - 110095 Delhi STALL 118 T: 011-22131463 M: 9625567989 E: [email protected] W: www.versatilepublications.in Contact: Deepak Dabral Publishers of educational books, specially for KG to 8 classes, according to the policies of NCF and NCERT.
Vidhi Book Centre HALL 104-B, Manali Apartment, Ahmedabad - 380004 Gujarat 8-11 M: 9724959770 STALL 27 E: [email protected] Contact: Sanjay Jain Distributors of general books in English language.
Vidya Bharti Sanskriti Shiksha Sanasthan HALL Sanskriti Bhawan, Gita Niketan Campus, Kurukshetra - 136118 Haryana 12A M: 9416035903 STALL 52 E: [email protected] W: www.samskritisansthan.org 113 NEW DELHI WORLD BOOK FAIR 2020 V
Contact: Ramendra Singh An organisation working towards the promotion of Indian culture.
Vidya Vihar HALL HALL 19, Sant Vihar, First Floor, Street No. 2, Ansari Road, 7D, 7F-H 12A New Delhi - 110002 Delhi STALL STALL 66-71 289-304 M: 9811022103 E: [email protected] Contact: Ajay Sharma Publishers of books on various subjects in Hindi language.
Vidya Vikas Academy HALL 3637, First Floor, Netaji Subhash Marg, Daryaganj, New Delhi - 110002 12A Delhi STALL 289-304 M: 8700863156 E: [email protected] Contact: Jagdish Publishers of Hindi books.
Vigyan Bharti HALL 1590, Madarsa Road, Kashmere Gate, New Delhi - 110006 Delhi 12A M: 9210829766 STALL 223-232 E: [email protected] W: www.rajpalpublishing.com Contact: Subhash Jedia Publishers of Indian classics and books by renowned authors.
Vigyan Prasar HALL A50, Sector 62, Noida - 201309 Uttar Pradesh 12 M: 9871439594 STALL 43 E: [email protected] W: www.vigyanprasar.gov.in Contact: Dr Arvind C Ranade Vigyan Prasar, an autonomous organisation under Department of Science and Technology, Government of India, was established in 1989. Vigyan Prasar has published over 300 titles in last 30 years with many other S & T popular content in audio-video form. V FAIR DIRECTORY 114
Vijaya Books HALL 1/10753, Sreet No. 3, Subhash Park, Naveen Shahdara, Delhi - 110032 12A Delhi STALL 96 M: 9810189445 E: [email protected] Contact: Rajeev Sharma Publishers and distributors of art and litreature books in Hindi, Sanskrit & English languages.
Vishv Books Private Limited HALL B-1/E-7, Mohan Co-Operative Industrial Estate, Badarpur, 8-11 New Delhi - 110044 Delhi STALL 143-150 M: 9899888203 E: [email protected] W: www.vishvbook.com Contact: P S Chauhan Publishers of school curriculum books from Kindergarten to class 8, children’s books and JHQHUDOERRNVDFURVVJHQUHVOLNHELRJUDSKLHVHQF\FORSHGLDVÀFWLRQQRQÀFWLRQHWF
Vishwa Granthmala HALL D-51, Shastri Nagar, Meerut - 250004 Uttar Pradesh 12A M: 8847782614 STALL 139-142 E: [email protected] Contact: Adarsh Pathak Publishers of world classics in Hindi language.
Vishwakarma Publications HALL Suyog Center, Seventh Floor, Gultekadi Marketyard Road, Giridhar Bhawan 12 Chowk, Pune - 411037 Maharashtra STALL 3 M: 9168682200 E: [email protected] W: www.vishwakarmapublications.com Contact: Vishal Soni 3XEOLVKHUVRIÀFWLRQDQGQRQÀFWLRQERRNV
Visva Bharati HALL 6, Acharya Jagadish Chandra Bose Road, Kolkata - 700017 12A West Bengal STALL 103 M: 9432862434 115 NEW DELHI WORLD BOOK FAIR 2020 W
E: [email protected] W: www.visvabharati.ac.in Contact: Apurba Prokash Majumder Publishers of the works of India’s national poet Gurudev Rabindranath Tagore. Besides, brings out several research publications in both Bangla and English languages.
Viva Books Private Limited HALL 4737/23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9971548282 STALL 384-395 E: [email protected] W: www.vivagroupindia.com Contact: Jitendra Singh Yadav Publishers and distributors of books on science, management, humanities, social sciences, engineering and children’s books.
Warsaw Book Fair HALL UL. Deblinska 6, 04-187, Warsaw Poland 7ABC T: +48-22-8296696 STALL 7 E: [email protected] W: www.book-expo.pl Contact: Agnieszka Ziemianska Warsaw Book Fair - the biggest Polish International book fair organized annually in 0D\:%)LQÀJXUHVH[KLELWRUVIURPFRXQWULHVDXWKRUV events, 80400 visitors in 4 days. Next edition: 21-24 May 2020, National Stadium, Warsaw, Poland. The Czech Republic will be the guest of honour.
West Bengal Urdu Academy HALL $5DÀ$KPHG.LGZDL5RDG1HDU*RO7DODE+DML0RKVLQ6TXDUH 12A Kolkata - 700016 West Bengal STALL 120-121 M: 9903081439 E: [email protected] W: www.wbua.org Contact: Md Haroon Ansari The West Bengal Urdu Academy was established as an autonomous body, with the objective to promote, advance and encourage the study of Urdu language and literature in the state and above all to advice and assist the state government in the formulation and implementation of its policies toward promotion, propagation and development of Urdu.
White Falcon Publishing Solutions LLP HALL 335, RCS-CPS Enclave, Sector-48A, Chandigarh - 160047 Chandigarh 8-11 M: 8283843446 STALL 476 W FAIR DIRECTORY 116
E: [email protected] Contact: Navsangeet Kaur 3XEOLVKHUVRIÀFWLRQQRQÀFWLRQDUWVFLHQFH WHFKQRORJ\ERRNV$OVRSURYLGHVSULQW on-demand platform for publishing books.
White Lotus Book Shop HALL Hanumansthan, Kupondole Marg, Lalitpur, Kathmadu - 10032 Nepal 7ABC M: 9953726773 STALL 42 E: [email protected] W: www.niralapublications.com Contact: R D Sharma 3XEOLVKHUVDQGGLVWULEXWRUVRIERRNVRQ1HSDO+LPDOD\DQFXOWXUHDQGSROLW\ÀFWLRQ poetry, etc.
Wiley India HALL 1402, Fourteeth Floor, World Trade Tower, Plot No. C-1, Sector - 16, 8-11 Noida - 201301 Uttar Pradesh STALL 320-322 M: 7290012190 E: [email protected] W: www.wileyindia.com Contact: Mohit Pabby 3URYLGHVGLJLWDOHGXFDWLRQOHDUQLQJDVVHVVPHQWDQGFHUWLÀFDWLRQVROXWLRQVWR universities, businesses and individuals.
Wisdom Tree HALL 4779/23, Ansari Road, Daryaganj, New Delhi - 110002 Delhi 8-11 M: 9871973850 STALL 78-80 E: [email protected] W: www.wisdomtreeindia.com Contact: Rakesh Sharma Publishers of books on art and culture, defence, diplomacy, as well as inspirational and children’s book.
Woodhead Publishing India Pvt. Ltd. HALL 303, Vardaan House, 7/28, Ansari Road, Daryaganj, New Delhi - 110002 8-11 Delhi STALL 6-7 M: 9811040727 E: [email protected] W: www.woodheadpublishingindia.com Contact: Ravindra Kumar Saxena Publishers of books in the areas of food science and nutrition, textile technology, IDVKLRQDQGDSSDUHOVPDWHULDOVHQYLURQPHQWDQGHQHUJ\ÀQDQFHHWF 117 NEW DELHI WORLD BOOK FAIR 2020 X
Work Charitable Trust HALL Shams Naved Hall, Bazar Nasrullah Khan, Rampur - 244901 12A Uttar Pradesh STALL 80-81 M: 9871977138 E: [email protected] Contact: Mubashshir Husain An organisation working towards the promotion of interfaith understanding by encouraging people of defferent faiths to know about each other’s beliefs.
World Constitution and Parliament Association Global HALL Block No. 3, H. No. 13, West Patel Nagar, New Delhi - 110008 12A Delhi STALL 311 M: 9999251257 E: [email protected] W: www.wcpaglobal.org Contact: Amit Paul Publishers of book / materials for global peace, world constitution, research studies, etc.
Wow Publishing Pvt. Ltd. HALL 252, Narayan Peth, Near Vijay Theater, Laxmi Road, Pune - 411030 12A Maharashtra STALL 88 M: 9011013202 E: [email protected] W: www.gethappythoughts.org Contact: Durgesh Bang Publishers and distributors of general books.
WT E-Books Private Limited HALL 4735/22, Prakash Deep Building, Ansari Road, Daryaganj, 8-11 New Delhi - 110002 Delhi STALL 396-407 M: 9810089095 E: [email protected] W: ebooks.wtbooks.com Contact: Surya Mittal Publishers of international level research e-books.
Xlmymind Learning LLP HALL G-21, Second Floor, Lajpat Nagar-3, New Delhi - 110024 Delhi 7D, 7F-H M: 8130738068 STALL 112 E: [email protected] W: www.xlmymind.com Y FAIR DIRECTORY 118
Contact: Rahul Malhotra Publishers of children’s books.
Yash Publications HALL 1/10753, Subhash Park, Naveen Shahdara, Delhi - 110032 Delhi 12A M: 9599483888 STALL 143-146 E: [email protected] W: www.yashpublications.com Contact: Rahul Bhardwaj Publishers of books on social science, culture, health, literature, etc.
Yash Publishers and Distributors Pvt. Ltd. HALL 4806/24 Ansari Road, Daryaganj, New Delhi - 110002 Delhi 12A M: 9599483887 STALL 143-146 E: [email protected] W: www.yashpublications.com Contact: Jatin Bhardwaj 3XEOLVKHUVRIÀFWLRQDXWRELRJUDSKLHVDQGELRJUDSKLHVPRWLYDWLRQDOUHIHUHQFHDQG literature books.
Yashika Enterprises HALL C-5/141, Keshav Puram, Delhi - 110035 Delhi 8-11 M: 9910715955 STALL 21-22 E: [email protected] Contact: Karan Nayyar Deals in books across genres.
Yogiraj Shyamacharan Mission HALL 41, Amit Tata EMP CHS, Murari Ghag Marg, Prabhadevi, 12 Mumbai - 400025 Maharashtra STALL 40 M: 9833658167 E: [email protected] Contact: Keyur Majmudar Publishers of books on Yogiraj Shyamacharan, kriyayog and spiriturality. 119 NEW DELHI WORLD BOOK FAIR 2020
Young Learner Publications HALL G-1A, Rattan Jyoti Building, 18 Rajendra Place, New Delhi - 110008 Delhi 8-11 M: 9810852700 STALL 31-34 E: [email protected] W: www.goodwillpublishinghouse.com Contact: Payal Chowdhry Publishers of children’s and general books including illustrated dictionaries, colouring and activity books, stories and fables, astrology, palmistry, management, public speaking, health, etc.