<<

ISSN 0001-5555 ActaDV Volume 97 2017 SEPTEMBER, No. 8

Advances in and Venereology

A Non-profit International Journal for Interdisciplinary Skin Research, Clinical and Experimental Dermatology and Sexually Transmitted Diseases

Abstracts from the 9th World Congress on October 15–17, 2017

Official Journal of - European Society for Dermatology and Wroclaw, Poland Psychiatry

Affiliated with - The International Forum for the Study of Itch

Immediate Open Access

Acta Dermato-Venereologica

www.medicaljournals.se/adv

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Journal Compilation ©2017ActaDermato-Venereologica. www.medicaljournals.se/acta and Allergology, Wroclaw MedicalUniversity, Wroclaw, Poland Staff membersoftheDepartmentDermatology, Venereology IFSI Vice President: IFSI President:EarlCarstens(Davis,USA) Congress Secretary:EdytaLelonek(Wroclaw, Poland) Congress SecretaryGeneral:AdamReich(Rzeszów, Poland) Congress President:JacekCSzepietowski(Wroclaw, Poland) Organizing Committee Abstracts from the9 Elke Weisshaar (Heidelberg, Germany) Author Index 1059 Poster Abstracts Lecture Abstracts Abstracts: Program Contents ofthis Abstract book th World Congress onItch Gil Yosipovitch (Miami,USA) Elke Weisshaar (Heidelberg, Germany) Kenji Takamori (Tokyo, Japan) Jacek C.Szepietowski(Wroclaw, Poland) Sonja Ständer(Münster, Germany) Martin Schmelz(Mannheim,Germany) Thomas Mettang(Wiesbaden, Germany) Ethan Lerner(Boston,USA) Ichiro Katayama (Osaka,Japan) Alan Fleischer(Lexington,USA) Toshiya Ebata(Tokyo, Japan) Earl Carstens(Davis,USA) Jeffrey D.Bernhard (Massachusetts,USA) Scientific Committee 1035 1008 1000 Acta DermVenereol 2017;97: 999–1060 doi: 10.2340/00015555-2773 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta 1000 6:20-6:50 PM 5:50-6:20 PM 5:20-5:50 PM 5:20-7:00 PM 5:10-5:20 PM 5:00-5:10 PM 5:00-5:20 PM 1:30-3:30 PM Sunday, October15,2017 10:15-10:30 AM 10:00-10:15 AM 9:45-10:00 AM 9:25-09:45 AM 9:05-09:25 AM 9:05-10:30 AM 8:50-9:00 AM 8:40-8:50 AM 8:30-8:40 AM 8:30-9:00 AM Monday, October 16,2017 AM 9 th WorldCongressofItch Naito, FumiyukiYamakura, Yasushi Suga,Yasuhiro Tomooka, KenjiTakamori Mitsutoshi Tominaga (Japan),FumiyaKusube, Kotaro Honda,NobuakiTakahashi, Hisashi Sulfated CCK8inducesalloknesis viaspinalCCK2receptorinmice Behrang Sharif(Canada), Ariel Ase, Alfredo Ribeiro daSilva, PhilippeSéguéla C-afferents Itch asabasicconstituentofsomatosensation: Evidenceformulti-modalcapacityofprimary Amanda HKlein,Timothy V Hartke,Matthew Wooten, GangWu, MatthiasRingkamp(USA) following intradermalinjectionofβ-alanineandbovinemedullary protein8-22 Preferential activationofsubtypespolymodalnociceptiveC-fibers inpigtailmonkey Ian McDonald(Ireland), Attila Szöllősi,Imre SzabóLőrinc,MartinSteinhoff peripheral itchsensitisation How scratchingcantakeits“Toll” onitch,newinsightsintoinnateimmunemechanismsof Nagamine T. Follansbee,IodiCarstens(USA),EarlCarstens,T. Akiyama, M.Fujii, A. Davoodi,M. cells Effects ofpruritogensandalgogensonrostralventromedialmedullary(RVM) ONandOFF Chairs: MartinSteinhoff(Ireland); MatthiasRingkamp(USA); Neurobiology ofItch Plenary Session Michellie Young (UK),MelanieBurke,DonnaLloyd Attentional biastoitch-relatedimagesinaclinicalitchpopulation Natalie Plewig(Germany),RobertOfenloch,ThomasMettang,ElkeWeisshaar Hemodialysis-Itch Study) Chronic itchinhemodialysispatients: A follow-upstudyofGEHIS(GermanEpidemiological Ohnuma, ChikaoMorimoto Yasushi Suga,UtakoKimura,Taketo Yamada, MitsutoshiTominaga, KenjiTakamori, Kei Eriko Komiya-Suyama(Japan),Ryo Hatano,HarunaOtsuka,Takumi Itoh,Hiroto Yamazaki, The regulationofpruritusinpsoriasisandatopicdermatitis–apossibleroleforCD26/DPPIV Chairs: HermannHandwerker(Germany); Adam Reich(Poland) Hot off thebench:Latestnewsby young investigators Morning session Mohammad Jafferany(USA) Itch andpsyche Neisser Lecture Martin Schmelz(Germany) Specificity orpattern:implicationsforclinicalitch Kuraishi Lecture Jacek C.Szepietowski(Poland) Itchy dermatosesinthecollectionof Wroclaw moulages Bernhard Lecture Chairs: EarlCarstens(USA);ElkeWeisshaar (Germany) Plenary Session Earl Carstens(USA) IFSI: A successfulsocietyforthefuture Opening remarks Jacek C.Szepietowski(Poland) Opening remarks OPENING CEREMONY IFSI Boardmeeting Abstract # OP10 OP11 OP3 OP2 OP1 OP9 OP8 OP7 OP6 OP5 OP4 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV 2:00-3:30 PM 12:30-2:00 PM 12:15-12:30 PM 12:00-12:15 PM PM 11:45 AM-12:00 11:30-11:45 AM 11:15-11:30 AM 11:00-11:15 AM PM 11:00 AM-12:30 12:15-12:30 PM 12:00-12:15 PM PM 11:45 AM-12:00 11:30-11:45 AM 11:15-11:30 AM 11:00-11:15 AM 2:30-2:45 PM 2:15-2:30 PM 2:00-2:15 PM PM 11:00 AM-12:30 Chairs: ElkeWeisshaar (Germany),GilYosipovitch (USA) Lunch andposter viewingI Tominaga, KenjiTakamori Yayoi Kamata(Japan),Yoshie Umehara, Azumi Sakaguchi,Yasushi Suga,Mitsutoshi epidermal keratinocytes Sema3A expressionisregulatedbycalcium/PKC/MAPK/AP-1signalingaxisinnormalhuman Karin Loser(Germany) Stefan Tran, Verena Kupas,KristianHolz,Marcus Maurer, Thomas A. Luger, SonjaStänder, Cutaneous 4-1BB/4-1BBL signalinginducessevere skininflammationandchronicitch Jessica Wei, Natalie Kelava Kucirek, KarstenGronert, Greg Barton,DianaBautista Carolyn Walsh (USA),JamieSchwendinger-Schreck, JacquesDeguine,EmilyBrock, RoseHill, Neutrophil-somatosensory neuroncrosstalkdrivesacuteandchronicitch Akira Matsumoto(Japan),Hiroyuki Murota, MikaTerao, Ichiro Katayama atopic dermatitisviaaberrantarteminproduction Attenuated activationofendogenousglucocorticoidsinkeratinocytesinducesalloknesis Arendt-Nielsen Hjalte Holm Andersen (Denmark),JesperElberling,Henrik Sølvsten,GilYosipovitch, Lars atopic Intra- andextra-lesionalsensitizationfornon-histaminergic andmechanically-evokeditchin Matthieu Talagas, OlivierMignen, Richard Lewis,RaphaeleLeGarrec Killian L’Herondelle (France),Laurent Misery, ChristelleLeGall-Ianotto,RéginaldPhilippe, New insightsintothepathophysiologyofitchduringciguaterafishpoisoning Chairs: BrianKim(USA);Laurent Misery(France) Skin, inflammationanditch Concurrent II Discussion Thomas Mettang(Germany),JacekC.Szepietowski,Laurent Misery, ElkeWeisshaar SIG Uremicitch Gil Yosipovitch Elke Weisshaar (Germany),ThomasMettang,SonjaStänder, FrankBrennan, HongLiangTey, SIG Paraneoplasticitch Furue, HidehisaSaeki, Andrea Evers,GilYosipovitch Elke Weisshaar (Germany),Jörg Kupfer, Antoinette vanLaarhoven, UweGieler, Masutaka SIG Questionnaires Sonja Ständer(Germany),Matthias Augustin, JacekC.Szepietowski SIG Scoringitchinclinicaltrials Joachim Fluhr, EnzoBerardesca, ElkeWeisshaar Wallengren, Andrea W.M. Evers,KenjiTakamori, EmilieBrenaut, ChristelleLeGal-Ianotto, Laurent Misery(France),SonjaStänder, JacekC.Szepietowski, Adam Reich,Joanna SIG SensitiveSkin Chairs: ThomasMettang(Germany);JacekC.Szepietowski(Poland) Special InterestGroups(SIGs) Concurrent I Chairs: SonjaStänder(Germany); Alan Fleischer(USA) New antipruritictreatments Plenary session Kristen Sanders(USA),KentoSakai, GilYosipovitch, Tasuku Akiyama Recovery ofpeptidergic epidermalnervefiberdensityby Tofacitinib inamouse modelof Edward F. Schnipper, Xiaoming Zhang,JeanY. Tang, Thomas A. Luger, MartinSteinhoff Gil Yospovitch (USA), SonjaStänder, MatthewB.Kerby, JamesW. Larrick, Andrew J.Perlman, blind, placebo-controlledphase2 clinicaltrial Serlopitant fortreatmentofchronicpruritus:resultsarandomized, multicenter, double- Sonja Ständer(Germany),PaulKwon,Thomas A. Luger multiple measuresofpruritusinpatientswithprurigonodularis Randomized, double-blind,placebo-controlledphase2clinicaltrial ofserlopitanteffects on Acta DermVenereol 2017 Program OP22 OP21 OP20 OP19 OP18 OP17 OP16 OP15 OP14 OP13 OP12 OP25 OP24 OP23 1001 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta 1002 6:30-7:00 PM 5:30-6:30 PM 5.00-5.20 PM 4.45-5.00 PM 4.30-4.45 PM 4.15-4.30 PM 4.00-4.15 PM 4.00-5.00 PM 5.20-5.30 PM 5.10-5.20 PM 4.55-5.10 PM 4.40-4.55 PM 4.20-4.40 PM 4.00-4.20 PM 4.00-5.30 PM 3:20-3:30 PM 3:10-3:20 PM 3:00-3:10 PM 2:45-3:00 PM 9 th WorldCongressofItch IFSI BoardMeeting Meeting General Assembly Landon KOetjen(USA) Methods initchresearch(experimental) Kenshiro Matsuda(Japan),ShuichiYanai, ShogoEndo, Akane Tanaka, Hiroshi Matsuda Depressive behaviormanifestedinNC/Tndmicesuffering fromatopicdermatitis Tsugunobu Andoh (Japan),ShikaiLi,Takahito Maki,DaisukeUta,Yasushi Kuraishi associated pruritus Pharmacological andhistochemicalcharacterizationofamousemodel ofchronicrenalfailure- Laurent Misery Nicolas Lebonvallet(France),ChristelleLeGall-Ianotto,Cecilia Brun,ThierryOddos, Re-innervated humanskinexplantasamodelfor Roman Rukwied(Germany) Methods inexperimentalitchresearch–anintroduction Chairs: GlennGiesler(USA);RomanRukwied(Germany) Methods initchresearch(experimental) Concurrent II Koga, Toshihiko Mashino,Yuichi Kurihara,MasutakaFurue Makiko Kido-Nakahara(Japan),Yumi Yasukochi, Takeshi Nakahara,RieKuroki, Tetsuya dermatitis patients Clinical bandingsofPatient-OrientedEczemaMeasure(POEM)scoresamongJapaneseatopic Adam Reich(Poland), Agnieszka Bożek,KatarzynaJaniszewska,JacekC.Szepietowski 12-Item PruritusSeverityScale:developmentandvalidationofnewitchseverityquestionnaire Ardeleanu,Gadkari Radin, Abhijit Allen Gil Yosipovitch (USA),MatthewReaney, Laurent Eckert,Lauren Nelson,Marci Clark,Marius dupilumab inadultpatientswithmoderate-to-severeatopicdermatitis Validation ofthepeakpruritusnumericalratingscale:resultsfromclinicalstudies Suephy Chen(USA) Grace Lee,SandyFrançois,ShelbySmith,CaitlinHaydek,JamesRoberts,Kuang-HoChen, parent’s abilitytobeproxies? Measuring pediatricitchseverity:Doespersonalexperiencewithchronicpruritusinfluence Joerg Kupfer (Germany),UweGieler, StephanieKiupel,ChristinaSchut Methods initchresearch: Arguments toimprovestandardizationofresearchmethods. Andrea Evers(TheNetherlands) How toalterplaceboandnoceboeffects inpatientswithchronicitch? Chairs: Andrea Evers(TheNetherlands);Jörg Kupfer(Germany) Methods initchresearch(clinical) Concurrent I Barnali Mitra(India),BijuVasudevan, ReemaSolanki,DebdeepMitra population. omalizumab inthemanagementofprurituschronicspontaneousurticariapediatric Randomized, double-blind,placebo-controlledstudyofmonoclonalanti-IgEantibody Emilie Brenaut (France),ChloéThéréné,ThomasBarnetsche,Laurent Misery analysis Efficacy ofsystemictreatmentspsoriasisonpruritus: A systemicliteraturereviewandmeta- Madan Kwatra Shawn Kwatra(USA),CoryNanni,Yevgeniy Semenov, CallieRoberts,MadisonKrischak, induced-pruritus activation ofEGFRsignalinginhumankeratinocytesasamechanismforreducingerlotinib New insightsintotheanti-pruriticactivityofneurokinin-1antagonist Aprepitant: partial Emma Guttman-Yasky, GilYosipovitch (USA),DedeeMurrell, JonHanifin with mildormoderateatopicdermatitis Crisaborole ointmentprovidesearlyreliefofpruritusintwophase3clinicaltrialspatients in vitro studiesonpruritus OP40 OP39 OP38 OP37 OP36 OP35 OP34 OP33 OP32 OP31 OP30 OP29 OP28 OP27 OP26 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV 12:15-12:30 PM 12:00-12:15 PM PM 11:45 AM-12:00 11:30-11:45 AM 11:15-11:30 AM 11:15-12:45 PM 10:20-10:30 AM 10:10-10:20 AM 10:00-10:10 AM 9:50-10:00 AM 9:35-9:50 AM 9:20-9:35 AM 9:05-9:20 AM 9:05-10:30 8:50-9:00 AM 8:40-8:50 AM 8:30-8:40 AM 8:30-9:00 AM Tuesday, October17,2017 Ian McDonald(Ireland), Imre Szabó Lőrinc, Attila Szöllősi, MartinSteinhoff associated morbidityandtreatment outcomesinacohortofpatientswithchronicpruritus. The burdenofchronicitch-aquestionnaire basedevaluationofclinicalcharacteristics, Berdeaux, Marie Auges, Valerie Mengeaud,Laurent Misery (France) Jennifer Theunis,ClementineNordon, YlanaChalem, MassimilianoOrri,JesusCuervo,Gilles impact onhealth-relatedquality of life A qualitativestudytounderstandpatients’ perceptionoftheseveritychronicpruritusandits van Laarhoven, JanDeHouwer, Andrea Evers Stefanie Meeuwis(TheNetherlands),HenriëtvanMiddendorp,Judy Veldhuijzen, Antoinette label verbalsuggestionsonitch Do placeboeffects workwhensubjectsknowthattheyreceiveaplacebo?Effects ofopen- Gieler, ChristophZick,Jörg Kupfer Christina Schut(Germany),KerryMontgomery, KjellLüßmann, Andrew Thompson,Uwe results ofacross-sectionalstudyinpatientswithatopicdermatitis High levelsofactingwithawarenessgoalonglow itchcatastrophizing:First Christian Apfelbacher (Germany),PaulineNelson Patient-reported outcomes:anintroduction Chairs: Christian Apfelbacher (Germany); LidiaRudnicka(Poland) Patients’ perspectivesandpatientreportedoutcomes Concurrent I Szepietowski Lukasz Matusiak(Poland),JustynaSzczęch,Karolina Kaaz,EdytaLelonek,JacekC. Clinical characteristicsofpruritusinhidradenitissuppurativapatients. Szepietowski Edyta Lelonek(Poland),ŁukaszMatusiak,Tomasz Wróbel, JacekKwiatkowski, JacekC. Clinical characteristicsofaquagenicpruritusinpolycythemiavera Takaharu Ikeda, Zygmunt Adamski, JacekC.Szepietowski,Victoria Werth, Adam Reich Hashizume, MohammadRafiqulMowla, AminulIslam,MinoruHasegawa,Laurent Misery, Dańczak-Pazdrowska, Adriana Polańska,FukumiFurukawa,Carolyn Kushner, Hideo Dominik Samotij(Poland),JustynaSzczęch,Emiliano Antiga, FrançoisChasset, Aleksandra erythematosus Prevalence andclinicalcharacteristicsofpruritusinpatientswithcutaneouslupus Laurent Misery, Jean-ChristopheIanotto Christelle LeGall-Ianotto(France),RonanCalloch, Aurélie Chauveau,EricLippert, biological profileatthediagnosisandahighmorbidityduringfollow-up. Essential thrombocythemiawithaquagenicpruritus:anentitymoreagressiveclinicaland Tabi Leslie(UK) Urticaria anditch Thomas Mettang(Germany),ElkeWeisshaar, Jörg Kupfer Pruritus inpatientswithkidneytransplants Kenji Takamori (Japan),NobuakiTakahashi, MitsutoshiTominaga An overviewoftreatmentforopioid-induceditch Chairs: KenjiTakamori (Japan);GilYosipovitch (USA) The widerangeofclinicalpresentationsitch Plenary Session Leigh Nattkemper(USA) Prolonged antipruriticeffect ofbotulinumtoxintype A oncowhage-induceditch Tanaka Yosuke Amagai (Japan),Tetsuyoshi Hamasaki,Yoshihiro Nomura,Hiroshi Matsuda, Akane contained indistilled Alpinia intermediaGagnepextracts Amelioration ofatopic-itchsensationinNC/Tndmicebybeta-pinene,themajorcomponent Leiden University, KayaPeerdeman, RogierDonders,PetervandeKerkhof, Andrea Evers Danielle Bartels(TheNetherlands), Antoinette vanLaarhoven, MichielStroo, KimHijne Reversing noceboeffects onitchbyconditioningwithverbalsuggestion Chairs: Toshi Ebata(Japan); Andreas Kremer (Germany) Hot off thebench:Latestnewsbyyounginvestigators Morning session Acta DermVenereol 2017 Program OP55 OP54 OP53 OP52 OP51 OP50 OP49 OP48 OP47 OP46 OP45 OP44 OP43 OP42 OP41 1003 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta 1004 2:30-2:45 PM 2:15-2:30 PM 2:00-2:15 PM 2:00-3:30 PM 3:15-3:30 PM 3:00-3:15 PM 2:45-3:00 PM 2:30-2:45 PM 2:15-2:30 PM 2:00-2:15 PM 2:00-3:30 PM 2:00 PM 12:45 PM- PM 12:30 AM-12:45 12:15-12:30 PM PM 11:55 AM-12:15 11:35-11:55 AM 11:15-11:35 AM 11:15-12:45 PM 12:30-12:45 PM 9 th WorldCongressofItch (France) Christelle LeGall-Ianotto,Virginie Buhé,LucLefeuvre, Laurent Misery, NicolasLebonvallet Olivier Gouin,KillianL’herondelle, RaphaeleLeGarrec, PaulBuscaglia,OlivierMignen, production indifferentiated keratinocytes TRPV1 regulatesPAR-2-evoked intracellularCa2+releaseandinflammatorymediators Yan GangSun(China) A centralfeedbackneuralcircuitgatesitch-scratchingcycle Ethan Lerner(USA),Tuanlian Luo,Ehsan Azimi, Vemuri Reddy, SarinaElmariah atopic dermatitis Neural recruitmentandMrgpr activityarerequiredforthedevelopment ofamousemodel Chairs: EthanLerner(USA);Yang-Gang Sun(China) New receptors,channelsandpathwaysforitch Concurrent II Ständer Manuel Pedro Pereira (Germany),Konstantin Agelopoulos, EstherPogatzki-Zahn,Sonja Neurophysiological studiesonchronicprurigo Loser, SonjaStänder Konstantin Agelopoulos (Germany),FalkRülander, JuliaDangelmaier, Tobias Lotts,Karin Peripheral effects oftargeting theneurokinin1receptorinchronicprurigo Peter Wolf Franz J.Legat(Austria), Alexandra Gruber-Wackernagel, Angelika Hofer, KlaraWaltner, resolution ofskinlesionsinapatientwithchronicprurigo Aprepitant, aNK1-antagonist,administeredfor16weeksreduceditchandsupported Manuel Pedro Pereira (Germany),SabineSteinke,SonjaStänder Novel definition,classificationandterminologyofchronicprurigo Jacek C.Szepietowski(Poland) Psoriatic itch2017 Joanna Wallengren (Sweden) andotherpruriticskindiseases. Chairs: Jeffrey Bernhard (USA);JoannaWallengren (Sweden) Prurigo andotherpruriticskindiseases Concurrent I Chairs: ElkeWeisshaar (Germany), GilYosipovitch (USA) Lunch andposter viewingII Karolina Kaaz(Poland),ŁukaszMatusiak,JacekC.Szepetowski patients Itch andpaininfluenceonqualityoflifesleepdisturbanceshidradenitissuppurativa Taqee Ansari Mohammed(India) Acupuncture forpainmanagementinevidence-basedmedicine Glenn Giesler(USA),Brett Lipshetz,HaiTruong, Sergey Khasabov, DonaldSimone Responses singlethalamicunitstopruriceptiveandnociceptivestimuliintherat. Earl Carstens(USA),IodiCarstens,T. Akiyama, A. Davoodi,M.Nagamine Opposing effects ofcervicalspinalcoldblockonitchandpaintransmission Hendrik Wildner, UweRudolph,ClaudeFavrot, HannsUlrichZeilhofer(Switzerland) William T. Ralvenius,ElenaNeumann,Mario A. Acuña, MartinaPagani,DietmarBenke, Spinal GABA-A receptorsubtypescontrollingitch Chairs: SarahRoss(USA);UliZeilhofer(Switzerland) Itch andpain Concurrent II Michael Storck, MartinDugas,SonjaStänder Claudia Zeidler(Germany),PhilippBruland,Riepe,InakiSoto,SabineSteinke, in Europe validation ofinstrumentsforitchintensityitch-impairedqualitylifeinpruriticdermatoses European EADV networkonassessmentofseverityandburdenPruritus(PruNet): OP70 OP69 OP68 OP67 OP66 OP65 OP64 OP63 OP62 OP61 OP60 OP59 OP58 OP57 OP56 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV 6:15-6:30 PM 6:00-6:15 PM 6:00-6:30 PM 5:40-6:00 PM 5:20-5:40 PM 5:20-6:30 PM 5:05-5:15 PM 4:55-5:05 PM 4:45-4:55 PM 4:30-4:45 PM 4:15-4:30 PM 4:00-4:15 PM 4:00-5:15 PM 3:15-3:30 PM 3:00-3:15 PM 2:45-3:00 PM 4:00-5:15 PM 5:00-5:15 PM 4:45-5:00 PM 4:30-4:45 PM 4:15-4:30 PM 4:00-4:15 PM Jacek C.Szepietowski(Poland), Earl Carstens(USA) Closing remarks Handwerker Prize,posterprizes CLOSING CEREMONY Xingzhong Dong(USA) Future perspectivesinbasicresearchofitch:Mrgpr receptorsandthebiologyofitch Sonja Ständer(Germany) Future perspectivesintreatmentofitch Ichiro Katayama(Japan), Akira Matsumoto,SaoriOchi,MikaTerao, Hiroyuki Murota Keratinocyte derivedcortisolregulatesitchevoked-allergic cutaneousinflammation Michellie Young (UK),MelanieBurke,DonnaLloyd Changes intactilesensitivityafterviewingitch-relatedimages Akihiko Ikoma(Japan),KimitoshiTakemura, DidierLeClercq, Toshiya Ebata nocturnal scratching Itch Tracker: An applicationsoftwareturningwearablesmartdevicesintoatooltomeasure Andreas Kremer (Germany),Theresa Buchwald,Marcel Vetter, Arnd Dörfler, ClemensForster Functional connectivityrevealsalteredactivationofbrainareasinchroniccholestaticpruritus Hong LiangTey (Singapore) skin Three dimensionalanalysisofcutaneousnervoussysteminpruriticatopicdermatitisand Clemens Forster(Germany) New methodsinbrainimagingtechniques Chairs: ClemensForster(Germany);Ichiro Katayama(Japan) New imagingtechniquesandotheraspectsofitch Concurrent II Chairs: SupheyChen(USA); Epidemiology ofitchandqualitylife Concurrent I Chairs: EarlCarstens(USA);ElkeWeisshaar (Germany) Future perspectives Plenary Session Suga, KenjiTakamori Nobuaki Takahashi (Japan),MitsutoshiTominaga, Ryohei Kosaka,Hironori Matsuda,Yasushi Possible roleofsatelliteglialcellderivedlipocalin-2inthepathogenesisatopicdermatitis Kent Sakai(USA),KristenSanders,GilYosipovitch, Tasuku Akiyama Effects ofburnsizeonpost-burnitchandepidermalnerveinnervationinmice Martina Pagani(Switzerland) activation ofGRP receptor(GRPR)-positiveneurons Spinal releaseofgastrinreleasingpeptide(GRP)isrequiredforsuprathresholdsynaptic Weller, Sabine Altrichter, UlrichReidel,Marcus Maurer, MartinMetz Tomasz Hawro (Germany),KatarzynaPrzybylowicz, André Ellrich,MaxSpindler, Karsten Prevalence, characteristicsandburdenofpruritusinchronicdermatoses Katarzyna Grochulska (Germany),RobertOfenloch,ThomasMettang,ElkeWeisshaar Epidemiological Hemodialysis-ItchStudy)onincidenceandmortalityofpatientswithCI Chronic itch(CI)inhemodialysispatients: A follow-upstudyofGEHIS(German Berdeaux, Marie Auges, Valerie Mengeaud,Laurent Misery(France) Jennifer Theunis,ClementineNordon, YlanaChalem,MassimilianoOrri,JesusCuervo,Gilles Quality oflifeinpatientswithchronicpruritus:fromtheconceptualmodeltoitemsgeneration Suephy Chen(USA) Shelby Smith,GraceLee,SandyFrançois, Alix Pijeaux,Kuang-HoChen,JamesRoberts, Pitfalls inpediatricself-reportedpruritusseverityandqualityoflifeimpact Kimitoshi Takemura, DidierLeClercq, JoelleVaglio, MichelPoncet, Akihiko Ikoma Toshiya Ebata(Japan),LefkosMiddleton,Ryoko Fukuda,Yoshimasa Takase, NaoTaniguchi, Epidemiological studyontheprevalenceofitchinJapanesedementiapatients Andrey Lvov(Russia) Acta DermVenereol 2017 Program OP86 OP85 OP84 OP83 OP82 OP81 OP80 OP79 OP73 OP72 OP71 OP78 OP77 OP76 OP75 OP74 1005 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta PP3: The effects oftheNK-1receptorantagonistnetupitantonitchmo PP2: Histamineisinvolvedinperipheralnerveelongationintoepidermis PP1: Myeloid GTP-Cyclohydrolase controls itch. Caroline Fischer, Katja 1006 PP21: PP20: Descendinginhibitionofitchandpain inhumans–experimental PP19: Assessment ofpruritusamongpatientswithviralhepatitisBand PP18: Isitchasymptomofcutaneousleishmaniasis? Tizita Yosef Kidane PPI7: Prevalenceandmagnitudeofitchinadolescentatopicdermatitis. PP16: Itchasaccompanyingsymptominvitiligo.ElkhamKaraev PP15: The use of a dermocosmeticto manage pruritus related to skin PP14: Measuring scratching and sleeping behavior besides pruritus inten PP13: forhistaminergic ofitchsensitization PP12: Modeling andnon-hista PP11: Pharmacologicalevidencefortheinvolvementof ATP-sensitive PP10: RoleofcysteinylleukotrienesandtheCysltr2receptorinpruri Konstantin nodularis. prurigo in profiling expression gene Global PP9: PP8: Resistancetoserotonin-induceditchincholestaticmice.Sattar cultured in influx calcium in involved subtypes receptor Serotonin PP7: PP6: Effect of[Leu11]-HK-1-derived peptidesonscratchingbehaviorin PP5: TRPV channelsandpost-burnpruritus.HyeOneKim, Yong Won PP4: Optogeneticactivationofserotonergic (5-HT)neuronsintherostral Sato, HiroshiOhtsu, Yosuke Mano, Yasushi Kuraishi, Tsugunobu Andoh of micewithitchinginducedbysurfactant. Yoshihiro Inami, Atsushi Zschiebsch, Annett Häussler, Katrin Watschinger, Irmgard Tegeder Nielsen Andersen, Antoinette vanLaarhoven,JesperElberling,Lars Arendt- paradigms for assessing endogenous itch inhibition efficacy. Hjalte Holm C. Anna Biernacka,DawidNiżyński,MałgorzataInglot, Adam Reich Takihara Mayuko Tahara, HiroyukiMurota,IchiroKatayama,Keiko Yamauchi- Okuda, students. Yosuke university first-year of survey Retrospective doutaud, CharlèneEydieux,JulieRiviere,MichèleSayag diseases. anobservationalstudy. Sandrine Virassamynaik, BernardCha Blome, ClaudiaZeidler, Matthias Augustin, SonjaStänder Frederik Braun,Kirstin Menne, NaniOsada,Laurie Burke, Christine – the“Itch-Controlled-DaysScore”.SabineSteinke,Henk Wassmann, sity. developmentofanew, all-encompassingpruritussymptomsscore Adam Reich,JacekC.Szepietowski Gajda, Mariusz Hołysz, Marcin Kupczyk, Piotr itch. of transmission in sis. interplaysbetweenaxonalnerveterminalssndepidermalkeratinocytes Lo Vecchio, HjalteH. Andersen, JesperElberling,Lars Arendt-Nielsen increase pain,butnotitch,elicitedbyhistamineandcowhage.Silvia minergic itch?–Both UVB-andNGF-inducedsensitizationselectively Dehpour Nazgol-Sadat Haddadi,SattarOstadhadi, Arash Foroutan, Ahmad-Reza potassium channels inchloroquine-induced scratching behavior in mice. Austen, IsaacM.Chiu ception. Tiphaine Voisin, Amelie Bouvier, Yoshihide Kanaoka,K.Frank Agelopoulos, Tobias Lotts,Heike Conrad,MartinDugas,SonjaStänder Dehpour Elmariah,, Ahmad-Reza Ostadhadi, Nazgol-SadatHaddadi, Arash Foroutan,Ehsan Azimi, Sarina Carstens, MirelaIodi Alexandru Babes rat dorsalrootganglionneurons.DanDomocos, Tudor Selescu,Earl Ishida Tsukamoto, RumiNakayama-Naono, Toshikazu Nishimori, Yasushi mice withchronicitch.HidekiFunahashi, Yu Miyahara, Ayaka Haruta- Choi, JeeHeeSon, Yong SeJo,Bo Young Jung,Chun Wook Park Yuma Yasui, SusumuOhya,MirelaIodiCarstens,EarlCarstens induced chronicdryskinmousemodel.MasanoriFujii, Taylor Follansbee, ventromedial medulla (RVM) facilitates touch-evoked scratching in a diet- dels inmice.GirolamoCalo’, Anna Rizzi,ChiaraRuzza,ClaudioPietra Expression Ofubiquitin C-terminal hydrolase L1/PGP9.5 in psoria Pruritus in patients hospitalized in the Department of Dermatology, 9 th WorldCongressofItch LIST OF POSTERS ------PP29: The needforlinguistically andculturallyadaptedstandardques PP28: Evaluationoftheclinicalcharacteristicspruritusinpatientswith PP27: Relationshipbetweenpruritusandserumlipocalin-2inpatientswith PP26: Itchinpsoriasis–isageanimportantfactor?RadomirReszke, PP25: A Ugandangirlwhohadtoendurethirteenyearsofitchyrashes PP24: Evaluationoftheclinicalcharacteristicspruritusinpatientswith PP23: Validity andreliabilityofvariousinstrumentsforitchintensity inflammatory with patients among problems skin of Assessment PP22: PP37: Defining a Responder on the Peak Pruritus Numerical Rating Scale PP36: Sumatriptan, the anti-migranous drug, suppresses serotonin-induced PP35: The relationshipbetweenstressanditchinGermanuniversity PP34: Doespre-scratchingreducetheitchtransmission?RaviChandra inpruritusqualityoflifepediatric PP33: Investigatingracialdisparities PP32: Differences infactors thatdrivepruritusqualityoflifebetween PP31: Validation of Japanese version of ItchyQoL in chronic pruritus PP30: DetectionofpresenceIgG1-IgG4,IgE,IgA,IgM,C3c,C1qand Jagiellonian University Medical College -atherapeutic approach. Magda Hidemi Nakagawa Inokuchi, Yozo Ishiuji, Norie Aizawa, Koichi Yanaba, Toshiya Ebata, dermatomyositis usingtheJapaneseversionof5-Ditchscale.Sanae Tominaga, Kenji Takamori, HidemiNakagawa Yoshinori Umezawa, Akihiko Asahina, Nobuaki Takahashi, Mitsutoshi psoriasis. Norie Aizawa, Yozo Ishiuji,SanaeInokuchi,Koichi Yanaba, Rafał Białynicki-Birula,JacekC.Szepietowski Skin ClinicinKabale,Uganda.LeoOdongo without seeingadermatologist. A casereportfromthenewGeroldJäger Koichi Yanaba, Toshiya Ebata,HidemiNakagawa Yoshinori Umezawa,Norie Aizawa, SanaeInokuchi, Akihiko Asahina, psoriasis usingtheJapaneseversionof5-Ditchscale. Yozo Ishiuji, Seong JinKim,Do Won Kim Jang, KyungDuckPark,EunJinDoh,DongHunLee, Yang Won Lee, Kap-sok Li,ChangOokPark,HyeOneKim,HeiSungMinSoo study inKorea. Yong HyunJang,Gyeong-HunPark,Byung-SooKim, multicenter chronicpruritus.aprospective, with measurement inpatients Marta Laskowska,KatarzynaNeubauer, Adam Reich bowel disease. is pruritus a major finding? Marta Idzior, Beata Jastrząb, Anna Wojas-Pelc lena Spałkowska, Agata Radko, Maciej Nowak, Małgorzata Werynowska, Abbé, Michael Andria Abbé, Gadkari, LaurentEckert,Matthew Reaney, Marius Ardeleanu, Adeline fromrandomized trialsofdupilumab.EricSimpson, analysis Abhijit (NRS) inPatients With Moderate-to-severeatopicdermatitis. detailed Afshari, MaryamDaneshpazhooh, Ahmad-Reza Dehpour Haddadi, Arash Foroutan,SattarOstadhadi,SaeedShakiba,Khashayar itch. The possibleinvolvement ofopioidergic system.Nazgol-Sadat Gil Yosipovich, ChristinaSchut students. StephanieKiupel,Joerg Kupfer, UweGieler, SophiaKottlors, Kopparaju, Chih-ChengChen Ho Chen,SuephyChen patients. Alix Pijeaux, Grace Lee, Shelby Smith, Sandy Francois, Kuang- Sarah Chisolm,MD,SeemaKini,MSCR,SuephyChen,MS ang-Ho Chen, PhD, Glenda Wrenn, MD, MSHP, Cassandra Quave, PhD, Asian Americans andotherraces.KevinLuk,BS, Alix Pijeaux, BS,Ku Suephy C.Chen patients. Toshiya Ebata, Yuko Hayakawa, Akishi Momose, Yuko Higaki, Waldemar Placek zarczyk-Saczonek, Joanna Czerwińska, Martyna Bieniek-Kobuszewska, patients withpruriticdermatoses.NataliaZdanowska, Agnieszka Owc Fibrinogen deposits under direct immunofluorescence staining in eldery Kim-Dufor, Adèle Poulaliou,LaurentMisery tionnaires toassessitch.Preliminarystudyandperspectives.Deok-Hee - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV PP38: Significance of IL-31 expression inskin and in serum in patomecha PP57: Itchassociatedwith hyperplasticpapillomatousskinlesions compli pemphigoid. bullous a of finding the masks prurigo Chronic PP56: PP55: Treatment ofsevere atopic dermatitis with omalizumab. Experience PP54: The BibliometricsofItch.2017Update.MelissaMcEnery-Stone PP53: Pilot study of venous itch. analysis of fluid and serum. PP52: A multinationalcross-sectionalstudy on theprevalenceandclinical PP51: BrachioradialpruritusinayoungCaucasianwomanassymptom PP50: Morphological and molecular evolutional analyses of itch focused PP49: Secondarygeneralizedbrachioradialpruritussuccessfullytreated PP48: effect of thermal grill illusion on histamine-evoked ofimiquimod- microgliainthepathogenesis PP47: Involvementofspinal PP46: Functionalchangesinthecerebralnetworksforitchandburning PP45: The fatal course of chronic itch (CI). Generalized CI as a first sign PP44: pruritus. associated ofchronickidneydisease What are pruritogens PP43: The problemoftheitchinsurgical oncology-doweknoweveryth PP42: Angiolymphoid hyperplasia with eosinophilia –a case ofpersistent PP41: Lysophosphatidic acidinducesitchandpaininhumansdepending PP40: ReductionofpruritusinoncologicalpatientsreceivingEGFRI PP39: Sumatriptan attenuates CQ-induced scratching through NO- Caroline-Donata Forner, JanEhrchen,ClaudiaZeidler, SonjaStänder Pedro, ManuelPereira-Barbosa des, Ana Célia,FátimaDuarte,Estrella Alonso, Amélia Spínola,Elisa of aPortugueseImmunoallergology Department .Rita Aquiar, Ana Men lake, M.D.,Jeffrey D.Bernhard,M.D. Julia Paul,StewartGraham VictoriaWerth,Reich Adam dra Lesiak,Zygmunt Adamski, JacekC.Szepietowski,Daisuke Tsuruta, Adriana Polańska, Laurent Misery, Mohammad Rafiqul Mowla, Aleksan Carolyn Kushner, Takaharu Ikeda,MinoruHasegawa,HideoHashizume, Islam, Aminul Furukawa, Fukumi Dańczak-Pazdrowska, Aleksandra Emiliano Szczęch, Justyna Samotij, Dominik Chasset, François Antiga, presentation ofpruritusincutaneouslupuserythematosus.anoverview. of cervicalradiculopathy. JustynaSzczęch, Adam Reich Keita Satoh,KazuyoshiMurata, Tatsuya Sakamoto,HirotakaSakamoto on thegastrin-releasingpeptidesysteminmammals.Keiko Takanami, Dorothée Nashan,HartmutStänder Ständer,Dücker,Sonja von Laura Małek, Małgorzata gabapentin. with Arendt-Nielsen, ParisaGazerani Lindby Nørgaard Hansen, HjalteHolm Andersen, LauraPetrini,Lars Rusteikaitè, JanneDjernisChristensen,MiaBirkholmLausten, Anders itch inhumans.DanieleRiccio,MarkBrendstrupBødker, Justina Chiharu Nishiyama,Kenji Takamori Tominaga, Nobuaki Takahashi, HironoriMatsuda, Yasuhiro Tomooka, induced psoriasis-like dermatitis model mice. Ryohei Kosaka, Mitsutoshi mann O.Handwerker pain. ClemensForster, Verena Vierow, MiriamRank,RalfRingler, Her naya Beigi,MichaelHaeberle, Andreas Gschwendtner, Elke Weisshaar of malignancyresemblingparaneoplasticsensomotoricneuropathy. Mi Yasauo Shiraiwa, Tomomi Kusumi,HirokiMizukami Akishi Momose,Michihiro Yabe, ShigetoshiChiba,KenjirouKumakawa, Nowacki, Maciej Wojciech Ragin,BarbaraZegarska Dominika Zegarski, ing abouttheprevention,diagnosisandtreatment?KatarzynaNowacka, Mariusz Sikora,MałgorzataJabłońska pruritus of the scalp. Patrycja Gajda, Adriana Rakowska, Joanna Czuwara, Andreas E.Kremer Ries, MartinaStengel,Peter W. J.Fischer, Reeh,Michael BarbaraNamer, on themodeofapplication.Margareta MiriamDüll,Lina Wurm, Vivien therapy. DominikaRagin,KatarzynaNowacka,BarbaraZegarska Saeed Shakiba, Arash Foroutan, Ahmad-Reza Dehpour pathway. Khashayar Afshari, Nazgol-SadatHaddadi,SattarOstadhadi, Sokołowska– Wojdyło Małgorzata Nowicki, Roman Lange, Magdalena Gleń, Jolanta Malek, nism of pruritus in CTCLs. Berenika Olszewska, Anton Żawrocki, Marta ------PP65: Endocannabinoid receptor 1gene polymorphisms have noassocia PP64: The burdenofaquagenicpruritusinpolycythemiavera.Edyta PP76: PP75: ItchyQolassessmentinpsoriasisvulgaris.Correlationanalysisof PP74: Bothnarrowband-UVBandbroadband-UVBareequallyeffective in PP73: GenderDisparityinthePsychosocialEffect ofChronicItchon PP72: Itchinnon-melanomaskincancers.IwonaChlebicka,JacekC. PP70: PP69: PP68: Pruritus in patients with acute heart failure. Malgorzata Ponikowska, PP67: Occupationalaspectsofscabies.MichaelHäberle, Arno Rütten PP66: as the cause of unspecified itching for 4 years. PP63: PP62: NovelMicroneedle Treatment forKeloids.Effects onlesional PP61. A studyofpruritusinpatientswithpsoriasisattendingdermatology PP60: Differentiated resistancetrainingandexercisetreatmentforneu PP59: Expression of IL-31 in uraemic pruritus. Marta Pelc, Maria Kozioł, PP58: Properties of pruritus and related factors among elderly residents PP79: Early onset ofantipruritic effects with serlopitant forchronic PP78: A newtoolformodellingstingingtestinvitro . acomparative PP77: «Pseudoallergic» reactionsonskinandmucousmembrane.isita PP71: C. Szepietowski TomaszMatusiak, Łukasz Jacek Lelonek, Kwiatkowski, Wróbel, Jacek Hartmut Ständer, SonjaStänder Dermatological PracticeinGermany–PossibilitiesandLimitations. A. Luger Sonja Ständer, Karin Loser, Dieter Metze, Jürgen Zimmermann, Thomas patient baselinedatafromarandomizedcontrolledtrial(PSORITUS). Peter Wolf Alexandra Gruber-Wackernagel, Franz Quehenberger, Klara Waltner, Legat, FranzJ. patients. reducing itchinchronicpruritus Hofer,Angelika Ho Chen,JamesRoberts,SuephyChen Children. Sandy François, Grace Lee, Shelby Smith, Alix Pijeaux, Kuang- Szepietowski Stepien, DorotaZarebska-Michaluk,BeataKrecisz successfully treated with rifampin and sertraline. Piotr Parcheta, Piotr Blicharz, ZbigniewSamochocki,PaulinaUsarek atopic dermatitispatients–istherealinkwithitchpathogenesis?Leszek Jan Biegus,RobertZymlinski,JacekC.Szepietowski mova, IrinaSergeeva Anastasiia Titenko, YuliaKrinitsina, Viktoria Onipchenko, Vera Paho Reich, JacekC.Szepietowski Adam Łaczmański, Łukasz Heisig, Monika pruritus. uremic with tion Volume, PainandItch.HongLiang Tey, Colin Weixuan Tan OPD ofatertiarycarehospital. Asit Mittal,ManjuMeena ropathic itch-apreliminarystudy. MatthiasFischer, Elke Weisshaar Jacek C.Szepietowski Takeo Minematsu, Mikako Yoshida, Abe Masatoshi,HiromiSanada of Panti Werdha, publicnursinghomesinIndonesia.Dianis Wulan Sari, zewska, LidiaRudnicka Ols TomaszMałgorzata Demkow,Waśkiel,Rakowska, Anna Adriana cated bysquamouscellcarcinomainapatientwithNethertonsyndrome. Joe Hirman,Paul Kwon placebo-controlled phase2clinicaltrial: SonjaStänder, Gil Yosipovitch, pruritus: posthocanalysisresults fromarandomized,multicenter, Jean-Luc Carré,LaurentMisery, NicolasLebonvallet lian L’herondelle, Jean-LucPhilbé,Florent Yvergnaux, Thibaut Saguet, Sakka, Raphael Leschiera, ChristelleLeGall-Ianotto,Olivier Gouin, Kil evaluation withinvivoresultsusingabacterialpolysaccharide.Mehdi Tereshenko, SvetlanaBobko psychosomatic phenomenon?. Andrey Lvov, DmitryRomanov, Anastasia ritus outcomes.SuephyChen,JamesRoberts riasis patients. Karolina Kaaz, Łukasz Matusiak, Jacek C. Szepietowski Itch and pain influence on quality of life of atopic dermatitis and pso Nodular prurigo as first manifestation of primary biliary cholangitis Medical Care of Patients with Chronic Pruritus in the Private Imperviousness togender cartoon annotation in selfreported pru Colonization ofskinandmucousmembranesbyS.aureusin Lecture abstracts Acta DermVenereol 2017 1007 ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta found in rodents based on the specificity of itch (“labeled line”). (“labeled itch of specificity the on based rodents in found been have itch for mediators Specific NaV1.7. as such subtypes and pruriceptorssuchasNK1antagonists orevensodiumchannel nociceptors for common targets also are the there theory specificity of lines the along approaches itch-specific of basis the on While mostofthesepotentialanti-pruritic targets weredeveloped processing (B-typenatriureticpeptide,gastrinreleasingpeptide). itch for specific transmitters central and S) Cathepsin TSLP, that arelinkedtotheitchsensation(IL13,IL31,autotaxin,LPA, MrgC11, MrgD) andman(MrgX1, MrgD), peripheral mediators for primarypruriceptiveafferent neuronsinrodents(MrgA1, histaminergic itch were made. These include functional markers discoveries in the field of specific major mediators and new receptors Recently, of non- mediators. itch specific of identification chronic itchhasbeenalackofpathophysiologicconceptsand The mainproblemforthedevelopmentoftargeted therapyfor Heidelberg, Mannheim,Germany Department of Anesthesiology and Intensive Care Medicine, University of Martin Schmelz CLINICAL ITCH SPECIFICITY ORPATTERN: IMPLICATIONS FOR OP2 and otherdisorders:,Reclinghausendisease,skincancers. disease, blistering autoimmune dermatoses: psoriasis; neurodermatitis, lichensimplex,atopicdermatitis,planus, eczema, diseases: inflammatory pyodermiae; pruriens , ses inwhichitchisaanimportantsymptom:infections:tinea, contains of 323 exhibits. Among them there are sevaral dermato of usingpoorerqualitywax. The currentcollectionof moulages result be to seemed which tint, yellowish the was flaw only The by Alfons Krönerwere considered the bestthankstoaccuracy. last moulagewasmade Wroclaw in1937. The moulagesmade Alfons KrönerwhojoinedtheNeisser’s departmentin1897. The vast majorityofcurrentcollectionmoulageswasproducedby brought thetechnologyofmoulagesto Wroclaw (Breslau). The a Japanesephysicianstudingdermatologyin Vienna, probably Dohi, (1882–1916). Keizo ofDermatology head oftheDepartment Wroclaw moulagesdatesthetimesof Albert Neisser, thefamous by casting.Colourwastheonlysubjectivepart. The historyof exactlyreproduced constructing themoulageskinlesionswere for betterqualityledtotheuseofbeewaxmixture.Inprocess moulds, probablybecauseoftheirlowercost,butintimetheneed dermatological moulageswereproducedwiththeuseofplaster ses hasalong-lastingtraditiondating to ancienttimes.Initially collection willbepresented. The useofwaxforpracticalpurpo skin diseasesdocumentedasmoulagesoftheabovementioned During thisprestigiousBernhardLecturesomeexamplesofitchy is famousbecauseofitscollectiondermatologicalmoulages. Dermatology of Department inflammatory. Wroclaw as well as could be find in many skin diseases, including infectious diseases Itch isregardedasthemostcommonsymptomindermatology. It Medical University, Wroclaw, Poland Department ofDermatoology, Venereology and Allergology, Wroclaw Jacek C.Szepietowski WROCLAW MOULAGES ITCHY DERMATOSES IN THE COLLECTIONOF OP1 1008 9 th WorldCongressofItch BERNHARD LECTURE KURAISHI LECTURE INVITED LECTURES - - psychodermatological conditions.Comorbidpsychiatriccondi sensation responsible for decreased quality of life in a variety of tion, provokingthedesiretoscratch.Itisanunpleasantsubjective Itch, alsoreferredaspruritusisanunpleasantcutaneoussensa Central MichiganUniversity, Saginaw, Michigan,USA Mohammad Jafferany, MD,FAPA PSYCHE ITCH AND OP3 patterns ofactivityinnociceptorsistheunderlyingmechanism. is the question whether activity in specific pruriceptors or certain processing. Thus, a key problem to be solved in chronic itch patient suggest common pathophysiological mechanisms of pain and itch their concurrentoccurrenceinpatientsisunexpectedandmay pain andneuropathicitchconditions. As painsuppressespruritus, tients report combined itch and pain sensations both in neuropathic itch behavior in animals can be differentiated operationally, pa primarily in nociceptors or in specific pruriceptors. While pain and tion whethertherapeutictargets inhumansshouldbeinvestigated treat­ skin inflammatory diseases frequentlyaccompanied byitching.Becauseoflimited chronic are dermatitis atopic and Psoriasis stitute forEnvironmental andGender SpecificMedicine,Japan Development andInnovationforImmune Disorders andCancers,In- Juntendo University GraduateSchoolofMedicine, Department ofTherapy Itoh, Eriko Komiya-Suyama FOR CD26/DPPIV AND ATOPIC DERMATITIS - A POSSIBLEROLE THE REGULATION OF PRURITUSINPSORIASIS OP4 worker, isvitalinaddressingmultifacetedaspectsofpruritus. consisting ofdermatologist,psychiatrist,psychologist,andsocial psychosocial components. An integratedmultidisciplinaryteam and somatosensoryaspectsbutalsothecognitive,emotional and adoptingaholisticapproachtoaddressnotonlydermatologic with psychosomaticcomponentisdirectedatunderlyingcause pain and itch also play a major role. Management of itch associated interaction betweenkeratinocytesandnerveendingsmodulating receptor potentialreceptors,opioids,andcannabinoids. The close histamine, interleukins,protease-activatedreceptors,transient in mostcircumstancesandinvolvesvarioussubstancesincluding disorders causingpruritus.Itchandpainmodulationgotogether ritic diseasesaggravatedbypsychosocialfactorsandpsychiatric three headings:pruriticdiseaseswithpsychosocialsequel,pru The connection betweenitchandpsych can begrouped under itch-related neuronalpathwaysandcentralprocessingofitch. mediators, specific of complexity the involves itch of robiology ship betweenpsychanditchhasbeenwidelystudied. The neu with itchandscratchcycle. The reciprocalandintricaterelation tions includingdepressionandanxietyarefrequentlyassociated (“pattern theory”). Human studies are required to answer the ques However, alsonociceptorshaveapotentialroleingeneratingitch Morimoto mada, HOT OFF THE BENCH:LATEST NEWSBY ment optionsforthistroublesome symptom, Hiroto Yamazaki, Mitsutoshi Tominaga, Kenji Takamori, KeiOhnuma,Chikao YOUNG INVESTIGATORS NEISSER LECTURE Yasushi Suga,Utako Kimura, Taketo Ya- , Ryo Hatano,HarunaOtsuka,Takumi

the development the development ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV matology, University Hospital Heidelberg, haar ( monstrate a significant impairment in those still suffering from CI 11.9 years).Firstanalysesincluding HRQOL andItchyQolde were stillsuffering fromCIhavingameanageof66.5years (SD died inthemeantime.Ofremaining 25patients,52.4%(n following resultsreferto46patients. 45.7%(n not ondialysistreatment anymore due to transplantation). The because theyhadmovedtoanotherplaceorwere reported CI (n HD patientsbeingaddressedsofar. Ofthosewhohadpreviously results arepreliminaryandreferto9dialysisunitscontaining212 lity oflife(ItchyQoL)wereassessed. As thisisanongoingstudy, scale, VAS). HRQOL (SF-12questionnaire) and itch-related qua vious CI(duringthelast3years),severityof(visualanalogue sessed withthesamepatientquestionnaireaboutcurrentandpre the persistence,courseandcharacteristicsofCI.Itchingwasas follow-up studyandcontactedallCIpatientsagaintoinvestigate current chronicitch(CI).Fouryearslater, in2017weperformeda We recentlyshowed25.1%(n 860 hemodialysis(HD)patientsin25dialysisunitsGermany. representative cross-sectionalcohortstartedin2013andincluding GEHIS (GermanEpidemiologicalHemodialysisItchStudy)isa 1 Natalie Plewig STUDY) EPIDEMIOLOGICAL HEMODIALYSIS-ITCH A FOLLOW-UP STUDY OF GEHIS(GERMAN CHRONIC ITCHINHEMODIALYSIS PATIENTS: OP5 ment optionforpatientssuffer frompruritus. and thatregulationofDPPIV enzymemayprovideamoretreat activity playsanimportantroleinpruritusviatruncationofSP, together, ourpresentresultsstudysuggeststhatDPPIV enzyme cantly decreasedwithadministrationofaDPPIV inhibitor. Taken overexpressing-mice, meanwhile scratching behavior was signifi DPPIV in increased significantly was behavior scratching model, duced psoriasis model and mite extract-induced atopic dermatitis treatment ofaDPPIV inhibitor. Finally, utilizingImiquimod-in with decreased significantly was behavior scratching injection, Furthermore, utilizingpruritusmodelinducedbySP intradermal patients. both in increased significantly was DPPIV by cleaved matitis. Moreover, wefoundthattruncatedformofSP (SP5-11) der atopic and psoriasis of sera in increase significant showing ding substance-P (SP),whichisasubstrateforDPPIV enzyme, next evaluated levels of itch-transmittingneuropeptidesinclu and atopic dermatitiscomparedtothoseofhealthynormaladults. We with psoriasis in patients increased significantly were sera wich ELISA.LevelsofsCD26andDPPIV enzymeactivityin enzyme activityinseraofpatients,utilizingahouse-madesand dermatitis. We DPPIV and protein sCD26 of levels analyzed first of DPPIV enzyme activityinpatientswithpruritusofpsoriasisandatopic mechanisms molecular the and significance clinical yet beenelucidated. The aimofthisstudywastoevaluatethe increased. However, a mechanistic role of DPPIV enzyme has not expression levelsofDPPIV inkeratinocytesofpsoriaticskinare enzyme activity (sCD26orsDPPIV).Ithas been reported that a solubleformispresentinserawithconservationDPPIV portant rolein T cellbiology. Inadditiontocellsurfaceantigen, main. CD26 is a costimulatory moleculeand plays anim known dipeptidylpeptidaseIV (DPPIV)initsextracellulardo CD26 isa110-kDa, typeIItransmembraneglycoproteinwith of moreeffective lios Klinik,Wiesbaden, Germany Dept. of Clinical Social Medicine, Environmental and Occupational Der n =13). We comparedthisgrouptothosewhonewlyacquiredCI, 1 =54), 14.8% (n 1 , Robert Ofenloch treatment for pruritus iscriticallyimportant. =217) ofHDpatientstosuffer from =8) could not be interviewed (e.g. =8) could not be interviewed (e.g. 1 , Thomas Mettang 2 Dept. ofNephrology, DKDHe- =21) of those had =21) ofthosehad 2 , Elke Weiss- =13) =13) ------

Understanding thesedifferences willhelptoelucidatehowpsy bottom-up effect withlittle earlyprocessingoftheitchcontent. creation of VEI inhealthyparticipants maybemorereliantona may drawuponatop-downattentionalmechanism,whereasthe propensity toexperienceitch,theresponseviewingitchimages the healthy population. In clinical participants with a pre-existing that VEI provokingimagesaffect clinicalgroupsdifferently to etc.)comparedtoimagesfeaturingirritants. This indicates be primarily drivenbyimagesfeaturing skin damage(scratching, first saccade on each trial to the itch image. These effects appear to spent longerlookingatthem,andweremorelikelytomaketheir the clinicalgroupmademoresaccadestowardsitchimages, directed towardstheitchimages.Eyetrackingalsorevealedthat ded fasteroncongruenttrials,indicatingthattheirattentionwas the clinicalbutnothealthygroup;participantsrespon the itchimage. We foundanattentionalbiasinreactiontimesfor as well asthedirection, number, andduration ofsaccades towards with theitchimage.Participants’ reactiontimesweremeasured, of anarrowprobepresentedeithercongruentlyorincongruently and non-itchimagesfor2000msthenreportedthedirection task combinedwitheyetracking.Participantsviewedpairsofitch 30 healthy control participants, using an arrowprobe reaction time clinical itch participants (self-reported eczema, psoriasis, etc.) and reflected in an attentional bias towards itch images. We tested 30 latter group. This studyinvestigatedwhetherthesedifferences are differences inhowtheeffect manifestshavebeenfound forthe Itch (VEI)inbothhealthyandchronicitchpopulations,although Itch-related imageshavebeenshowntoinduce Visually Evoked University ofLeeds,UK Michellie Young, MelanieBurke, IN A CLINICAL ITCHPOPULATION ATTENTIONAL BIAS TO ITCH-RELATED IMAGES OP6 tom inhemodialysispatients. hindpaw injectionsite.Mostunits wereunresponsivetoidinjec units alsoresponded to a scratch stimulus appliedadjacenttothe histamine, 50% by id chloroquine, and 76% by id capsaicin. All RVM ON cells, 86% (24/28) were excited by intradermal (id) to nocifensivehindlimbwithdrawal elicitedbypawpinch.Of prior just occurred that firing in decrease or increase respective their by identified cells OFF and ON RVMfrom in made were naling. Inpentobarbital-anesthetized mice, single-unit recordings how they contributetodescendingmodulationof spinal itch sig unknown how ON and OFF cells respond to pruritic stimuli or spinal nociceptivetransmission,respectively. However, itis RVM ON-andOFFcellsarethoughttofacilitate andinhibit 2 1 Mirela Iodi Carstens ON AND OFF CELLS ROSTRAL VENTROMEDIAL MEDULLARY (RVM) EFFECTS OF PRURITOGENS AND ALGOGENS ON OP7 and perpetuatetheitch-scratchcycle. chological triggerscanaffect people withitchyskinconditions These new data confirm CI to be a persistent and impairing symp compared tothosewhonewlyacquiredCI(VAS 3.32vs.2.88). CI from suffering still those in scores higher significantly show SF-12 (27.9vs.37.9)weredetected.Firstanalysesoftheseverity lower scoresindicatingHRQOL inthephysicalsubscaleof Akiyama Univ. ofMiami,USA Neurobiology, Physiology & Behavior, Univ. of California, Davis CA; 2 , MasanoriFujii NEUROBIOLOGY OF ITCH 1 , Taylor Follansbee 1 , A. Davoodi Donna Lloyd 1 , M.Nagamine Lecture abstracts Acta DermVenereol 2017 1 , Earl Carstens 1 1 , Tasuku 1009 - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta nell UniversityWatar, Doha,Qatar of Dermatology, HamadMedical Corporation, Qatar University, Weil Cor brecen, Debrecen, Hungary, skin ofnodularprurigo. Therefore TLR3, aninnatebiosensormay also found significantly increased expression of TLR3 in lesional lesional skin of nodular prurigo patients (Kido et al 2014). We of non histaminergic itch in humans known to be increased in NHEKs resultsinthereleaseof ET-1. This importantmediator Conclusions: We havedemonstratedthatactivation of TLR3 in red withperilesional(non-scratched)andhealthycontrolskin. of patientswithnodularprurigo(mean VAS score7.5),compa skin lesional the in TLR3 of expression increased significantly showed skin of Immunofluoresence treatment. following ET-1 1). RT-PCR showedincreasedmRNA levelsof TLR3, TSLP and Poly (I:C)resultedinthereleaseofIL-6andEndothelin-1(ET- using immunofluorescence. lesional, perilesionalandhealthycontrolskinwasperformed from treatedcells. The expressionandquantitationof TLR3 in tative RT PCR was preformed to analyse mRNA expression analysis wasperformedat4and24hoursusingELISA.Quanti ligand of TLR3, Poly(I:C) at different concentrations. Secretome epidermal keratinocytes(NHEKs)weretreatedwiththesynthetic skin ofpatientswithnodularprurigo.Methods:Normalhuman of 2) Evaluatetheexpression TLR3 inchronicallyscratched ators releasedfromkeratinocytesfollowingactivationof TLR3. of TLR3. activation contributes totheperipheralsensitizationofitchinhumansvia to epidermaldamageandthereleaseofRNA fromkeratinocytes mal keratinocytes. We hypothesisethatscratching,whichleads molecular patternsincludingRNA releasedfrominjuredepider pathogens, butalsorespondstoendogenousdamageassociated double strandedRNA, TLR3 actsasaninnatebiosensorofviral regulation of itch signaling in mice (Liu et al 2012). A detector of the in significant be to found was TLR3 Recently threats. nous molecular dangersignalsassociatedwithexogenousorendoge torecognize designed arecellularsensors (TLRs) receptors derstanding of itch however is still far from complete. Toll-like un morbidity. Our psychological and physical significant with Itch isthemostcommonsymptomindermatologyassociated 1 McDonald Ian SENSITISATION IMMUNE MECHANISMSOF PERIPHERAL ITCH ON ITCH,NEW INSIGHTSINTO INNATE HOW SCRATCHING CAN TAKE ITS“TOLL” OP8 cells andexcitationofONcells). that counteracts descending facilitation (byinhibition ofOFF include descendinginhibition(byexcitationofsomeOFFcells) modulatory effect onspinalpruriceptivetransmissionthatmay pruritogens onOFFcellssuggestsamorecomplexdescending facilitate spinalnociceptivetransmission. The mixedeffects of OFF cellsisconsistentwithdecreaseddescendinginhibitionto pain transmission. The mainlyinhibitoryeffect ofcapsaicin on ON cells toinitiate descending facilitation ofspinalitch and indicate thatascendingpruriceptivesignalsmayactivateRVM exciting 14% and having no effect in the remainder. These results inhibiting 23%.Idcapsaicinandscratchinginhibited64%while Id chloroquine was ineffective in 62% whileexciting15%and excited 50%while inhibiting orhaving noeffect in the remainder. effects wereobservedwithOFFcells.Idhistamineandscratching tion ofvehicle,butstillrespondedtoscratching.Morevariable 1010 and hoff Vincents University Hospital, Dublin,Ireland, UCD Charles Institute of Dermatology, Department of Dermatology St 4 3 Department of Dermatology, Faculty of Medicine, University of De- 9 th WorldCongressofItch 1 , Attila Szöllősi Objective: Aim: 1) Identify key itch medi 4 UCD CharlesInstitute of Dermatology, Dept Results: 2 , Imre Szabó Lőrinc Stimulation of NHEKs with 2 Department ofPhysiology, 3 , Martin Stein ------a slow response (SCs), and that QC-fibers are preferentially acti preferentially are QC-fibers that and (SCs), response slow a to asteppedheatstimulus(49°C,3s):quickresponse(QCs)or exposed are (RF) fields receptive their when C-fibers nociceptive two typesofheatresponsesareobservedincutaneouspolymodal MrgprC11 andhumanMrgprX1. Previously, wehaveshownthat by ALA, an MrgprD agonist, and BAM8-22, an agonist for murine known what types of cutaneous afferents in primate are activated the MrgA-C subfamilies described in mice. Currently, it is not ers, designated as MrgX1-4, cannot be clearly assigned to any of orthologous genesforsomeMrgs exist(MrgD-G), whereasoth of mas-relatedGprotein-coupledreceptors(Mrgprs). Inprimate, populations ofmurineDRGneuronsthatdiffer intheirexpression sensation ofitch. These pruritogensactivatenon-overlapping bovine adrenalmedullaryprotein8-22(BAM8-22)causethe and (ALA) β-alanine of administration intradermal human, In Dept of Neurosurgery, School of Medicine, Johns HopkinsUniversity, USA Matthias Ringkamp Amanda HKlein,Timothy V Hartke,MatthewWooten, GangWu, MEDULLARY PROTEIN8-22 INJECTION OF Β-ALANINE AND BOVINE PIGTAIL MONKEY FOLLOWINGINTRADERMAL OF POLYMODAL NOCICEPTIVEC-FIBERSIN PREFERENTIAL ACTIVATION OF SUBTYPES OP9 inflammatory (IL-6). pression andtriggeringitchthroughET-1, TSLP andotherpro pruriception and nociception, the underlying neurophysiological pruriception and nociception, the underlying neurophysiological behavior. Despite significant anatomical and behavioral overlap of an unpleasantsensationwiththe distinction ofelicitingwithdrawal sation thatleadstoscratchingbehavior, painisalsodescribableas somatosensation. While itch can be described as an unpleasant sen Undoubtedly, itch and pain are among the closest modalities of Department ofPhysiology, McGillUniversity, Montreal, Quebec,Canada guéla Behrang Sharif, CAPACITY OF PRIMARY C-AFFERENTS SENSATION: EVIDENCE FORMULTI-MODAL ITCH AS A BASICCONSTITUENT OF SOMATO ­ OP10 likely contributestoencodesensationsproducedbyBAM8-22. encode ALA –inducedsensations, whereasactivityinQCsandSCs activated by ALA and BAM8-22, respectively, and suggest that QCs BAM8-22. These results show that QCsand SCs are preferentially QCs, responsesto ALA wereabout2-foldlarger thanresponsesto were about20-foldhigherthanthoseinducedby ALA, whereasin about 10-fold larger than in SCs. In SCs, responses to BAM8-22 SCs but23/24QCsrespondedto ALA, andQC-responseswere responses wereabout3-foldlarger inSCsthanQCs.Only4/21 C fibers. All of 21SCs and 17/24 QCs responded to BAM8-22, but at least 5minutes following each injection. We studied atotal of45 followed byBAM8-22(1µg).Neuronalactivitywasrecordedfor another blockofBAM8-18(theinactivetruncatedpeptide,1µg) extracellular fluid (ECF, the ) followed by ALA (90 µg) and administered inrandomorderattheRF:oneblockconsistedof under study, two blocks of intradermal injections (each 10 µl) were techniques. After assessing receptive properties of teased-fiber the afferentstandard fiber using nemestrina) (Macaca primates male innervating thehairyskinwasrecordedinanaesthetizednonhuman is currently not known. Neuronal activity of unmyelinated C fibers BAM8-22 and whether any fibersubclass is preferentially activated vated by ALA. Whether polymodal nociceptorsareactivatedby to injured,scratchedepidermalkeratinocytes,increasingitsex act asanimportantreceptorintheitch-scratch-cycle,responding Ariel Ase, Alfredo Ribeiro daSilva, Philippe Sé-

- - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Takahashi International Liberal Arts, International Science, Japan nology, Faculty of IndustrialScience and Technology, Tokyo University of pathway maybeapromisingcandidate foranti-alloknesistreatment. induced alloknesisviaspinalCCK2R. Thus, theCCK8S-CCK2R CCK8S that suggest not. findings did These antagonist CCK1R a whereas alloknesis, CCK8S-induced the attenuated significantly injection ofL-365,260,aCCK2 receptor(CCK2R)antagonist, mice comparedtocontrolmice. Pharmacologically, intrathecal injection ofCCK8Sresultedinincreasedalloknesisscorestreated touch-evoked itch using innocuous von Frey filaments. Intrathecal next tested whetherspinal CCK8Sinducedalloknesis, namely CCK8S didnotinducescratchingboutsinC57BL/6Jmice. We behavior inmice.Inbehavioralanalyses,intrathecalinjection of effects ofintrathecal injection ofCCK8Sonitch-related scratching of CCK8Sinspinalitchtransmission.Initially, weexaminedthe the CNS. Therefore, this study was performed to investigate the role also shown that sulfated CCK8 (CCK8S) is distributed widely in compared with that in non-AD control mice. Previous studies have ganglia ofNC/Ngamicewithatopicdermatitis(AD)-likesymptoms increased expression of CCK mRNA was found in thedorsal root itch transmission remains unclear. Inourgeneexpression analysis, allodynia. However, therelationshipbetweenCCKandspinal neuromodulator incircumstancessuchasanxiety, feedingand cystokinin (CCK)isknowntoactasaneurotransmitterand/or In thecentralnervoussystem(CNS),neuropeptidechole 1 Mitsutoshi Tominaga SPINAL CCK2RECEPTOR INMICE SULFATED CCK8INDUCES ALLOKNESIS VIA OP11 in themammaliannervoussystem. for novelmodelstoexplainhowitchandpainaredistinctlycoded itch sensationincertainconditionsandpainothers. This calls vivo a single genetically-defined population of C-fibers can convey avoidance behaviorsratherthanscratching.Ourresultsshowthatin neurons throughChR2predominantlyinducespainresponsesand rather thanpainresponses.Surprisingly, optical activationofthese netic activationoftheseneuronsevokesstereotypicalitchbehavior previously reporteddata,ourbehavioralstudiesshowthatchemoge (DRG) andtrigeminalganglia(TG)neurons.Inaccordancewith validation oftheheterologousactuatorsindorsalrootganglia neurons. Behavioralexperimentswereperformedaftercomplete actuators, selectivelyexpressedonthesurfaceoftheseMrgprA3+ took advantageofCre-dependentoptogeneticandchemogenetic evaluate theeffects ofawidevarietyactivationconditions,we for theitch-inducingcompoundchloroquine.Inordertobeable of primary C-fiber pruriceptors that expressMrgprA3, the receptor line theory for itch, we took advantage of a described subpopulation studying somatosensorysystems. To testthevalidityoflabeled discrimination frompain,iscurrentlydebatedamongthescientists dality. Whether thistheorycanexplainallaspects ofitchandits for detection,transmissionandperceptionofeachsensorymo system, from the periphery to the brain, are specifically specialized cording tothistheory, dedicatedcomponentsofthesomatosensory in the past decade, is the “labeled line” or “specificity” theory. Ac for thisdiscriminationprocessandoneofthemostpopularones, remains tobesolved. There havebeenseveraltheoriesproposed behaviors flight or fight distinct triggers and sensations pain and the enigma of how the somatosensory system differentiates itch basis of itch and its relation to pain is still unclear. More specifically, Science & Medicine, Juntendo University, Yasuhiro Tomooka University Graduate School of Medicine, Institute for Environmental and Gender Specific Medicine, Juntendo Medicine, Specific Gender and Environmental for Institute 1 , Hisashi Naito 4 , KenjiTakamori 1 , Fumiya Kusube 4 Department ofBiological Science and Tech- 2 , Fumiyuki Yamakura 1 3 2 Juntendo University Faculty of Institute of Health and Sports 1 , Kotaro Honda 3 , Yasushi Suga 1 , Nobuaki 1 - - - - , ri Dermatology, Wroclaw, Poland Allergology, Wroclaw Medical University, Poland, Dermatological Institute,Rome,Italy, of Neurosciences of Brest, University of Western Brittany, Brest, France, Leiden University, Leiden, The Netherlands, partment of Health, Medical and Neuropsychology, Institute of Psychology, Eppendorf Hamburg, Germany, ters forHealth Services Research inDermatology(CVderm)University tology and Venereology, University Hospital of Lund,Sweden, lergology, Charité-Universitätsmedizin Berlin, Germany, not provoke such sensations. These unpleasant sensations can tingling sensations)inresponsetostimulithatnormallyshould of unpleasantsensations(stinging, burning, pain, pruritus, and occurrence the by defined syndrome “a as skin sensitive fined The IFSIspecialinterestgroup(SIG)onsensitiveskinhasde 3 1 Laurent Misery SIG SENSITIVESKIN OP12 remains ongoing. monitoring cutaneousscratchsymptoms orscratchmovements, this, thesearchforobjectivemarkers, suchasanapproachto been usedinmanytrialsandprovide reliabledata.Inspiteof ders, anxiety, depressionandimpairmenttoqualityoflifehave questionnaires onreactiveconditionsrangingfromsleepdisor and validatedtoassessothervariousparameter. Patientreported Days (ICD) and Patient Benefit Index (PBI) have been developed sion ofChange(DynamicPruritusScore;DPS),ItchControlled com). Novelinstruments,includingthePatientGlobalImpres validated in an electronic form via the ItchApp (provider: arone. for boththe VAS andNRS. These instrumentshavealsobeen mal clinicallyimportantdifference (MCID)hasbeencalculated already beenmadeavailableforuseinclinicaltrials. The mini categorization, distribution,qualitiesandcourseovertimehave sing theitchintensity(includingItchyQuantforchildren), assessment of its various dimensions. Several instruments asses order todevelopandvalidateinstrumentsusedmakeareliable Itch inClinical Trials (seeitchforum.net)wasfounded in2008 Scoring SIG assess. The to difficult is that symptom debilitating Chronic pruritusisasubjective,multidimensionalandhighly 1 Sonja Ständer ITCH INCLINICAL TRIALS SPECIAL INTEREST GROUP (SIG):SCORING OP13 reviews willbethenextsteps. and assessmentsofinstrumentsmeasurementaswellnew definition. Translations consensual international first the is This Sensitive skin can affect all body locations, especially the face”. The skincanappearnormalorbeaccompaniedbyerythema. not beexplainedbylesionsattributabletoanyskindisease. Hospital, Urayasu,Chiba,Japan, Medicine, of School Graduate University Juntendo Medicine, Specific Gender and Heidelberg, Germany Occupational and Environmental Dermatology, University of Heidelberg, Enzo Berardesca pital ofMünster, Germany, Reich Department ofDermatology, CenterforChronic Pruritus,UniversityHos- Department ofDermatology, University Hospital ofBrest, Center for Chronic Pruritus, University Hospital Münster, 7,8 , SPECIAL INTEREST GROUPS(SIGS) Emilie Brenaut 4 , Joanna Wallengren 8 Department ofDermatology, Juntendo UniversityUrayasu 1 , Matthias Augustin , 1,2 10 , , ElkeWeisshaar Sonja Ständer 1,2 , Christelle Le Gall-Ianotto 4 Department ofDermatology, Venereology and 5 , Andrea W.M. Evers 3 University of Medicine Department of 9 Department ofDermatologyand Al- 3 , 2 11 11 , JacekC.Szepietowski Jacek C. Szepietowski Department ofSocialMedicine, Lecture abstracts 7 Acta DermVenereol 2017 Institute for Environmental 5 Department ofDerma- 2 , 6 , Joachim Fluhr Kenji Takamo- 10 San Gallicano 2 German Cen- 2 Laboratory 4 3 , Adam 1011 6 De- 9 ------,

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta sipovitch University ofMiamiHospital,Miami,USA Giessen, Germany, Neuropsychology, LeidenUniversity, Netherlands, matology, Itch Center, UniversityofMiamiHospital,Miami,USA many, of Dermatology, Center forChronic Pruritus,University of Münster, Ger tology, KyushuUniversity, Kyushu, Medical School, Tokyo, Japan, itch without concomitant skin changes has recently been shown to itch withoutconcomitantskinchanges hasrecentlybeenshownto overall prevalenceandincidence is still unclear, however, chronic with both, haematological andsolid tumour malignancies. The neoplastic itch(PI)”. This termisusedtodescribe itchinpatients and aimed to define what can be summarized under the term “para A position paper publishedin2015reviewedthecurrentknowledge searchers withaspecialinterestinparaneoplasticitchwasfounded. In 2012,aninterdisciplinaryinterestgroupofphysiciansandre 2 1 Elke Weisshaar FORUM FOR THE STUDY OF ITCH(IFSI) NEOPLASTIC ITCH”OF THE INTERNATIONAL THE SPECIAL INTEREST GROUP (SIG)“PARA­ OP15 clinical practiceaswellmedicalandhealthresearch. questionnaire shouldserveasameasurementinstrumentusedfor population-specific questionnaire validation. In the long-term the on theunderlyingdisease.Futurestudiestakeaimatdisease-and in different arrangements and modular configurations depending available and providing a template for questionnaires for future use ofinstruments properties comparing thecontentandmeasurement better assessCIandguidetherapy. The SIGiscurrentlyworkingon the expectationsandunmetneedsofusingitchquestionnairesto greatest utility in the evaluation of CI. A consensus paper addressed various psychometricpropertiesofitchquestionnairesoffer the from different disciplines.One goalistodeterminewhichofthe Itch (IFSI)asaninterdisciplinaryteamtointegrateknowledge experts andmembersoftheInternationalForumforStudy on questionnairestoassesschronicitchwasfoundedbyseveral sive assessmentofCI.In2011, aSpecialInterestGroup(SIG) measurement instrumentthatallowsanadequateandcomprehen rent statusofresearchandclinicalexperiencesthereisnosingle and itssensoryaffective dimensions. According tothecur structured questionnairesfor evaluation and measurement of itch common complaint,therearefewstudiesdescribingtheuseof constantly growingduringthelastyears.Despiteitchbeinga in itchmanagement. The numberofinstruments utilized hasbeen its associatedeffects isanimportanttoolofdailyclinicalpractice bur densome topatientssuffering fromCI. The assessmentofCIand and measure to difficult complex, is It well-being. their including patient’s life of aspects all on impact significant a has Chronic itch(CI)isaglobaldiseaseaffecting manypatientsand 1 Elke Weisshaar STUDY OF ITCH(IFSI) OF THE INTERNATIONAL FORUMON THE “QUESTIONNAIRES TO ASSESS CHRONICITCH” THE SPECIAL INTEREST GROUP (SIG) OP14 1012 Sydney, Australia, Dermatology, University Hospital Heidelberg, Ruprecht-Karls-University, Heidelberg, Dermatology, UniversityHospitalHeidelberg, Ruprecht-Karls University, nan Gieler Department ofNephrology, DKDHeliosClinic, Wiesbaden, Department ofClinical Social Medicine, Environmental andOccupational Department ofClinical Social Medicine, Environmental andOccupational 4 , HongLiangTey 4 Palliative Care, DepartmentofRenal Medicine, St. Georg Hospital, 2 , Masutaka Furue 9 6 th WorldCongressofItch 2 Institute of Medical Psychology, Justus-Liebig-University, 1 1 , 5 , National Skin Center, Singapore, Thomas Mettang 3 Jörg Kupfer Institute of Psychology, Unit Health, Medical and 5 , GilYosipovitch 4 , Hidehisa Saeki 6 Department ofDermatology, ItchCenter, 2 , 5 Antoinette van Laarhoven Department ofDermatology, Nippon 2 , Sonja Ständer 6 5 , Andrea Evers 4 Department ofDerma- 6 Department of Der 3 , Frank Bren- 3 Department 3 , Gil Yo- 3 , Uwe ------to of patientswithsevereUP worldwide.Bothstudiesalsodemon to the updated DOPPS data there is a decline in the prevalence prevalence ofUP islowerthanformerstudiesreported. According using different prevalenceestimates, incontrast,showedthatthe study in German patients on hemodialysis, a representative study young patients are afflicted than assumed before. Data of the GEHIS on theprevalenceofUP inchildrenondialysisshowingthatmore the pathogenesisandtherapyofUP. There arenewdataavailable Since then, only a few new papers have appeared shedding light on (ESRD). renaldisease orend-stage progressed with in patients founded to improve knowledge and therapeutic options on pruritus In 2013,the special interest group“” (UP)was 2 1 Thomas Mettang FOR THE STUDY OF ITCH(IFSI) PRURITUS” OF THE INTERNATIONAL FORUM THE SPECIAL INTEREST GROUP (SIG)“UREMIC OP16 to identifypossibleriskfactorsfordevelopingPI. more knowledgeonPIasaprecedingsymptomofmalignancyand gain to markers, serum possible search to beneficial be would It miological data,clinicalcharacteristicsandtreatmentmodalities. gain more knowledge about PIin terms ofpathophysiology, epide a lackofdiagnostictestsforPI.Forthefuture,weshouldtryto caused bylittleawarenessofphysicianstowardsthissymptomand and doesnotreceiveenoughattentionbyphysicians. This maybe hysiology ofmalignantdiseases.PIisfrequentlynotrecognized 1 Killian L’Herondelle OF ITCHDURINGCIGUATERA FISHPOISONING NEW INSIGHTSINTO THE PATHOPHYSIOLOGY OP17 multifactorial originofpruritusinHDpatients. dialysis patients. All this should encouragetoconsider a possible salt loweringstrategiesmayleadtoloweroccurrenceofitchin needs tobeinvestigated,assomestudieshavegivenhintsthat in HDpatients. The impactofskinsaltcontentinuremicpruritus possible neuropathic component most likely caused byneuropathy without UP according to GEHIS. Further data ofthis study hint to a CRP wasnotincreasedinpatientswithUP comparedtopatients UP. in role a play might inflammation whether debate on still is With regardtopathogenesisonlylittlenewdatahasemerged. It clear whethertheaetiologyofpruritusissimilartothatinuraemia. relevant numberofpatientssuffer frompruritus,althoughitisnot conflicting data have been reported. After kidney transplantation,a UP isreportedtobelowerthaninhemodialysispatients,although underutilized. Inpatientsonperitonealdialysis,theincidenceof strated thateffective therapieswith gabapentinorpregabalinare Weisshaar research ishamperedbythediverse,multipleandcomplexpathop the Western countriesthistopicis of increasinginterest.However, malignancies. Duetotheriseofmalignantdiseasesespeciallyin be a risk factor forhaving undiagnosed hematologic and bile duct cupational Dermatology, UniversityHospital Heidelberg, Germany France, hard Lewis University ofQueensland,St.Lucia, Australia cal University, Poland, of Western Brittany, Brest, France, Department of Dermatology,Venerologyof Department AllergologyWrocławand Medi- Department of Nephrology, DKDHeliosClinic, Wiesbaden, Germany, Laboratory ofInteractionsNeuronsKeratinocytes (EA4685),University 1 , Réginald Philippe SKIN, INFLAMMATION AND ITCH 4 Department ofClinical Social Medicine, Environmental andOc- 4 2 , RaphaeleLeGarrec 1 , Jacek C. Szepietowski 1 , 1 3 , Department of Dermatology, University Brest, Laurent Misery Matthieu Talagas 2 Institute for Molecular Bioscience, the 1 1 , Christelle Le Gall-Ianot- 2 1 , , Laurent Misery Olivier Mignen 3 1 , , Elke Ric - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV intracellular calciumconcentration([Ca (VAS patients reportedtheirspontaneous itchintensityat60.7±4.3 hyperknesis aswellvasomotorreactivitywereassessed. AD over, histamine-andcowhage-provocationswereperformed More assessed. was efficacy modulation pain conditioned and and mechanicalquantitativesensorytesting(QST)wasconducted on itchcharacteristicswereadministeredtothepatients. Thermal and inhomologousareasofhealthycontrolsquestionnaires Sensory tests were conducted intra-lesionally, extra-lesionally, included 25 AD patientswithchronicitchand25healthycontrols. chemical pruritic stimuli in AD patients and controls. The study in AD, and compared sensitivity to thermal, mechanical, and sized thatnon-histaminergic neuronalsensitizationplaysarole cycle, whichmaintainsskinlesions,itchandpain. We hypothe itch pathway dominate AD itch and induces an“itch-scratch-itch” (AD). Ithasbeensuggestedthatthenon-histaminergic neuronal Chronic orepisodicsevereitchisrecurrentinatopicdermatitis 1 Holm Andersen Hjalte CALLY-EVOKED ITCHIN ATOPIC DERMATITIS FOR NON-HISTAMINERGIC AND MECHANI­ INTRA- AND EXTRA-LESIONAL SENSITIZATION OP18 evidenced astrikingroleof TTX-resistant Na imaging experiments performed on monoculture of neurons, we targets involvedinP-CTX-2-induced SP release.Usingcalcium coculture model, we prospected the role ofseveral molecular of ciguatera fish poisoning. Here, based on our previous published induced effect may contribute to explain the sensory disturbances are keymediatorsinvolvedinitchsensations,thisciguatoxin- calcitonin gene-relatedpeptide(CGRP).Sincetheseneuropeptides gated sodiumchannel-dependentreleaseofsubstanceP (SP)and voltage- a induce to able is Pacific-ciguatoxin-2 that showed we primary coculturemodelofsensoryneuronsandkeratinocytes, sensory disordersarestillpoorlyunderstood.Previously, usinga activators butthefollowingmolecularmechanismsrelatingto poisoning. CTXs are potent voltage-gated sodium channel (VGSC) toxins are one of the major potential health issue concerning seafood more case reports are notified in non-endemic areas. Hence, cigua spreading ofthisunsung illness to temperate countries and more and ming, growthoftourismandriseinternationaltradeleadtothe to detect them in intoxicated fish fleshes. With global climate war conditions, odourless withno suitable, quick and ready-to-use tool pruritus. These toxinsarethermostable,resistanttoacidicandbasic cutaneous sensory disorders such as cold allodynia and severe which are predominantly responsible of characteristic clinical (CTXs) ciguatoxins from originates intoxication This flesh. fish poisoning caused by the consumption of contaminated tropical seafood widespread most the is (CFP) poisoning fish Ciguatera ter North, Aalborg, Denmark, Yosipovitch ter, UniversityofMiamiSchool ofMedicine,USA toward sensitizationwasobserved intra-lesionally).Nodifferences trend (a groups between different significantly not was intensity both intra- and extra-lesionally, while histamine-evoked itch cowhage from itch evoked increased significantly experienced penhagen University Hospital, Gentofte, Copenhagen, Medicine, AalborgUniversity, new insights for therapeutic approaches to treat pruritus. new insightsfortherapeuticapproachestotreatpruritus. signalling consecutivetotoxin-induced VGSCs activation butalso studied. Taken together, those findings give not only new molecular cellular signalling,consecutiveto VGSCs activationbyP-CTX-2,is to regarding events calcium of order chronological that time first the toxin-evokedcalciumsignalandSP release.Indeed,thisisthe in influx calcium of role crucial the showed we Moreover, time. Laboratory ofExperimental CutaneousPainResearch, SMI,Faculty of 0-100 ) andtheirpainintensityat39.7±5.2 (VAS 4 , LarsArendt-Nielsen 1 , Jesper Elberling 4 Department of Dermatology and Itch Cen- 2 Department of Dermato-Allergology, Co- 1 2+ ] 2 i , ) imbalance within the ) imbalancewithinthe Henrik Sølvsten v channels to keep the channelstokeepthe 3 Dermatology Cen- 0-100 ). Patients 3 , Gil - - - - HSD11b1 the numberofspontaneousscratchinginstances.Furthermore, sten Gronert, Greg Barton,DianaBautista Emily Brock, RoseHill,JessicaWei, NatalieKelavaKucirek, Kar keratinocyte-specific HSD11b1-knockout (HSD11b1 of protein gene product (PGP) 9.5-positive nerve fibers in skin of is themainsymptomof AD. First,weanalyzedthedistribution investigated the impact of local cortisol activation on itch, which in thepathogenesis of AD is unclear. To address this issue, we regulation system,involvementofendogenousglucocorticoids dermatitis (AD)isthoughttocausedisruptionofthelocalstress Although decreased epidermal HSD11b1 expression in atopic and plays an important role in maintaining skin homeostasis. activates endogenousglucocorticoidsinresponse to local stress The enzyme11beta-hydroxysteroid (HSD11b1) dehydrogenase-1 Ltd. Kyoto,Japan Medicine, Osaka University, Osaka,Japan/Kaken Pharmaceutical Co., Dermatology, DepartmentofIntegratedMedicine,GraduateSchool Akira Matsumoto, VIAPRODUCTION ABERRANT ARTEMIN IN ATOPICDERMATITISALLOKNESIS INDUCES GLUCOCORTICOIDS INKERATINOCYTES ATTENUATED ACTIVATION OF ENDOGENOUS OP19 to thedevelopmentof lesions. molecular signatures and immune cells found in mature eczematous chanistic studies and therapeutic interventions have focusedonthe Eczema isoneofthemostcommon chronicitchdisorders. University ofCaliforniaatBerkeley, USA Carolyn Walsh, ITCH CHRONIC CROSSTALKACUTE AND DRIVES NEUTROPHIL-SOMATOSENSORY NEURON OP20 production andmaycontributetotheinductionofalloknesisin AD. endogenous glucocorticoids in keratinocytes increases ARTN Taken together, these results suggest that the deficiency in active ARTN andHSD11b1 expression in AD epidermiswasobserved. between correlation negative significant a and layer, papillary the and AD in increased specifically was expression sion in skin biopsy specimens of AD and psoriasis patients. ARTN were observedinskinfromHSD11b1 ging. Surprisingly, epidermal nerve fiber sprouting and thickening performed animmunohistochemical analysis of protein expres mice andsuppressedbytreatmentwithcorticosterone. Then, we of anyskinlesions.HSD11b1 production fromkeratinocyteswaspromotedinHSD11b1 related to skin innervation from keratinocytes. Artemin (ARTN) examined cytokinesandneurotrophicfactors,ahumoralfactor alloknesis andhypersensitivitytothermalnociception.Next,we was nodifference between HSD11b1 scratch responsetoalighttouchtheneck;nevertheless,there HSD11b1 (PAR2/TRPA1 mechanisms. Drugscandidatesinhibitingthenon-histaminergic also occurringextra-lesionally, indicatescentralsensitization The increasedsusceptibilitytomechanicallyevokeditchandpain, itch provocationssuggestspathway-specificsensitizationin AD. after itchprovocations.Increasedfollowingnon-histaminergic extra-lesional sensitivitytomechanicallyevokeditch,prior to, and intra- andextra-lesionallyexhibitedaugmented provocations. Patientshadincreasedmechanicalpainsensitivity were foundforthermalsensorysensitivityorpainevokedbyitch However, the molecular and cellular players that contribute KCKO KCKO micealsoshowedaugmentedpruritogen-induced ) miceusingimmunohistochemistryand3Dima + ) itch-pathway arepromisingfortreating AD itch. Jamie Schwendinger-Schreck, Hiroyuki Murota, MikaTerao, Ichiro Katayama eczema have not been systematically studied. eczema havenotbeensystematically studied. KCKO micefrequentlyshoweda KCKO KCKO Lecture abstracts Acta DermVenereol 2017 andwild-typemicein miceintheabsence Jacques Deguine, fl/fl Krt5-Cre; Krt5-Cre; 1013 Me KCKO - - - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta we coulddemonstratethattheabsenceofCD8 tg skinproducedhighlevelsofIL‑ sensory nerve fibers, which generate currents following the stimula skin inflammation requires the interaction of T cells with cutaneous protected tg mice from developing itch and inflammation. Pruritic tendo UrayasuHospital,Japan Suga 1 Yayoi Kamata NORMAL HUMAN EPIDERMAL KERATINOCYTES CALCIUM/PKC/MAPK/AP-1 SIGNALING AXIS IN SEMA3A EXPRESSIONISREGULATED BY OP22 fibers also reduced the numbers of IL nerve sensory cutaneous of depletion the note, Of inflammation. cantly down-regulatedchronicpruritusandadditionally, reduced (RTX).Notably,RTXsignifi resiniferatoxin analogue capsaicin the injecting by mice tg 4-1BB in fibers nerve sensory cutaneous tion oftheitch-relatedreceptorIL-31RA.Hence,wenextdepleted CD8 Particularly inflammation. neurogenic the IL-31 expression in T cells since IL-31 is knownto promote of 4-1BB-induced pruritic skin inflammation. Next, we quantified that mastcellswereofminorimportanceforthepathophysiology ding 4-1BB tg mice to mast cell deficient mutants and could show molecular mechanismsweanalyzedtheroleofmastcellsbybree 4 mice showed an increased scratching frequency, thus pointing to the tes consisting of mast cells, eosinophils and T cells. Moreover, tg acanthosis, fibrosis, collagenosis and massive immune cell infiltra irregular by characterized were which lesions, skin inflammatory (4-1BB tg).Interestingly, 4-1BBtgmicespontaneously developed nerated transgenicmiceoverexpressing4‑ of sensoryneuronsandimmunecells. To investigatethiswege tribute tocutaneousimmunitybyregulatingthecommunication cells, wehypothesizedthat4-1BB/4‑ its ligand4-1BBL areexpressedonneuronalaswellimmune of immuneresponses.Sincethe TNF familyreceptor4-1BBand control the in involved critically is fibers nerve cutaneous with regulate cutaneousimmunityandtheinteractionofimmunecells tion ofimmuneresponses.Membersthe TNF receptorfamily intheinduc totheenvironmentresulting The skinisexposed Department ofDermatology, UniversityofMünster, Münster, Germany Luger,mas A. Stefan Tran, Verena Kupas,KristianHolz,Marcus Maurer, Tho- ITCH SEVERE SKININFLAMMATION AND CHRONIC CUTANEOUS 4-1BB/4-1BBL SIGNALINGINDUCES OP21 behaviors inthedevelopmentofatopicdermatitis. interactions between neutrophils and sensory neurons that analysis, qPCR,FACS andmousebehaviorto of itch. model, neutrophils are the sole cellular player required for the onset innate immunecells atopic dermatitis. We find that although a variety of cytokines and during eczemapathogenesisusingthe Here wesetouttoexaminetheearlychangesthatoccurinskin 1014 versity Graduate School ofMedicine, 4 with pruriticskindiseases,thusstrengtheningourhypothesisthat signaling wasalsoup-regulatedincutaneouslesionsfrompatients lesional skinfromtgmice. Worth mentioningthat4‑ the development of itch and inflammation. the developmentofitchandinflammation. of theimmunesystemwithperipheralnervousduring Institute for Environmental and Gender Specific Medicine, Juntendo Uni- Juntendo Medicine, Specific EnvironmentalGender for and Institute ‑ ‑ 1BB-mediated inductionofpruritus. To elucidatethecellularand 1BB/4-1BBL signalingmightcontributetothecommunication 2 , MitsutoshiTominaga We usedavarietyoftechniques 17 th Congress of the European Society for Dermatology and Psychiatry Sonja Ständer, KarinLoser 1 , Yoshie Umehara infiltrate the skin 1 , KenjiTakamori 2 1 31 and by depleting these cells 31 andbydepletingthesecells Department of Dermatology, Jun- , ‑ 31 expressing CD8 Azumi Sakaguchi 1BBL signaling mightcon within the Vitamin Dmousemodelof including transcriptome including transcriptome 1BB in the epidermis 1BB intheepidermis + T cellsfrom4-1BB 2 define the molecular + T cellscompletely first 5 days of the 1BB/4-1BBL 1 +

, drive itch drive itch T cells in Yasushi ------(NCT02196324). Keyeligibilitycriteriaweretreatment-refrac safety, andtolerabilityofserlopitant5mginpatientswithPN efficacy, the assessed trial clinical 2 phase placebo-controlled the treatmentofchronicpruritus. A randomized,double-blind, California, USA identify novelantipruriticdrugtargets. the proximal promoter (-134/-24), and providea new insight to the PKC/MEK1/2/AP-1 and/orPKC/JNK/AP-1 signaling axisin calcium-induced Sema3A expressioninNHEKismediatedby kinase (JNK)inhibitor(SP600125). These resultssuggestthat ERK kinase(MEK)1/2inhibitor(PD98059)andjunN-terminal decreased byproteinkinaseC(PKC)inhibitor(Gö6976),MAPK/ cantly decreased by AP-1 inhibitor (T-5224). Similarly, it was also Up-regulation of Sema3A mRNA by 1.4 mM calcium was signifi promoter (-134/-24)inthepresenceof0.15or1.4mMcalcium. immunoprecipitation assayrevealed AP-1 boundtoproximal Sema3A expressioncomparedwithcontrolsiRNA.Chromatin Furthermore, AP-1 andRORalphasiRNA effectively reduced unchanged promoteractivityinthepresenceof1.4mMcalcium. up-regulated by 1.4 mM calcium, AP-1/ROR alpha mutant showed than in an intact case. Although Sema3A promoter activity was nesis of AP-1/ROR alpha site showed significantly lower activity GA-binding protein (GABP) were found. Site-directed mutage -1, retinoidrelatedorphanreceptor(ROR)alpha,Sox5/Sox9and transcription factorbindingsitesincludingactivatorprotein(AP) region, this In identified. was site start transcription the from bp and acriticalregionforSema3A promoteractivitywithin-134 cloned was gene Sema3A of region 5’-flanking The (NHEK). nism of Sema3A gene in normal human epidermal keratinocytes is unknown.Inthisstudy, weinvestigatedtheregulatorymecha tes. However, theregulatorymechanismofendogenousSema3A factors, suchassemaphorin3A (Sema3A)producedbykeratinocy factors, including nerve growth factor (NGF), and nerve repulsion tion ismainlycausedbyanimbalancebetweennerveelongation periphery. Previously, wereportedthatepidermalhyperinnerva Cutaneous hyperinnervationisinvolvedinitchsensitivityatthe compliance. Serlopitant produced a statistically significant de significant statistically a produced Serlopitant compliance. well matchedbetweenthetreatment groups,aswastreatment population comprised127patients; baselinecharacteristicswere efficacy The follow-up. and treatment during evaluated were Adverse events(AEs)andclinical andlaboratoryassessments Global Assessment (IGA);andPrurigo Activity Score(PAS). Assessment (PGA);NumericRatingScale(NRS);Investigator Verbal Rating Scale (VRS); worst-itch VAS; Patient Global in theaverageitch VAS included score. Secondaryendpoints weeks. The primary efficacy endpoint was change from baseline lopitant 5mgorplacebooncedailyfor8weeks;follow-upwas 2 hours ofbaseline.Patientswererandomized1:1toreceiveser 72 within mm ≥70 score (VAS)pruritus Scale Analog Visual tory PNlasting>6weeks,lesionsonmultiplebodyareas,and a neurokinin-1receptor(NK condition withsuboptimaltreatmentsavailable.Serlopitantis (PN)isanintenselypruriticchronicskin 1 Sonja Ständer PRURIGO NODULARIS MEASURES OF PRURITUSINPATIENTS WITH OF SERLOPITANT EFFECTSONMULTIPLE CONTROLLED PHASE2CLINICAL TRIAL RANDOMIZED, DOUBLE-BLIND,PLACEBO- OP23 pital Münster, Münster, Germany, Center forChronic Pruritus,DepartmentofDermatology, UniversityHos- NEW ANTIPRURITIC TREATMENTSNEW ANTIPRURITIC 1 , PaulKwon 2 Thomas A. Luger , ThomasA. 1 -R) antagonistindevelopmentfor 2 Menlo Therapeutics Inc., Menlo Park, 1 ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV 0.25 mg, 1 mg, and 5 mg, respectively, and 1.6% for placebo) and groups were somnolence(1.6%,4.6%,and4.7%forserlopitant most common treatment-emergent AEs (TEAEs) in the serlopitant 5 mgatweeks4,5,and6(p<0.05)comparedwithplacebo. The Rating Scale–asecondaryendpoint –withserlopitant1mgand of itch from baseline were also demonstrated using the Numeric serlopitant 5 mg. Statistically significant improvements in severity VAS pruritus score were statistically significantly greater with ser comparable betweengroups.Differences inchangefrombaseline female; meanagewas43.7years).Baselinecharacteristicswere follow-up. The studypopulationincluded257patients(60.7% and laboratoryassessmentswereevaluatedduringtreatment percent change from baseline. Adverse events (AEs) and clinical daily. pruritus the was endpoint efficacy primary The score VAS Zhang Pharmaceutical Development,SanFrancisco, Larrick ter, Münster, Germany, Chronic Pruritus,DepartmentofDermatology, University Hospital Müns- sity College Dublin, Dublin, Ireland , tology andUCDCharlesInstitute of Translational Dermatology, Univer (4.0; change in VAS pruritus scores were –28.3(4.1)forplacebo, –41.4 placebo. At the week 6 efficacy evaluation, the mean (SE) percent lopitant 1mgatweeks3-6and54-6,comparedwith ceive serlopitant 0.25 mg, 1mg, 5 re to (1:1:1:1) randomized were (VAS)Patients mm. ≥70 score pruritus lasting ≥6 chronic pruritus.Keyeligibilitycriteriaweretreatment-refractory receptor antagonistserlopitantvsplaceboforthetreatmentof phase 2clinicaltrial(NCT01951274)ofthenovelneurokinin-1 a from results safety and efficacy the report we Here, label. off with undesirablesafety/tolerabilityissues;therefore,mostareused current therapiesprovideinadequateitchrelieforcanbeassociated results in significant morbidity and impaired quality of life. Many Chronic pruritus is a frequently debilitating , which 1 Gil Yosipovitch CONTROLLED PHASE2CLINICAL TRIAL MULTICENTER, DOUBLE-BLIND,PLACEBO- PRURITUS: RESULTS OF A RANDOMIZED, SERLOPITANT FOR TREATMENT OF CHRONIC OP24 or moderate;nosignificantsafetysignalsweredetected. with PN.Serlopitantwaswelltoleratedandmost AEs weremild provides greaterreductionofpruritusthanplaceboinpatients measures ofpruritusconsistentlydemonstratedthatserlopitant changes invitalsigns,andnodeaths.Inconclusion,multiple There werenomeaningfultrendsinlaboratoryabnormalitiesor 4.8% ofserlopitant-andplacebo-treatedpatients,respectively. mild ormoderate;severe TEAEs werereportedfor9.4%and fatigue (9.4% serlopitant, 6.3% placebo). Most TEAEs were 3.2% placebo),diarrhea(10.9%serlopitant,4.8%and in theserlopitantgroupwerenasopharyngitis(17.2%serlopitant, The most frequently reported treatment-emergent AEs (TEAEs) greater proportionofplacebo-thanserlopitant-treatedpatients. tant overplaceboatweek8.Rescuemedicationwasusedbya greater improvementsintheexperienceofprurituswithserlopi PGA, worst-itch VAS, NRS, IGA, and PAS also demonstrated average-itch VAS score.Secondaryendpointresultsfor VRS, when assessed at weeks 2, 4, and 8 (p crease frombaselineinpruritusseveritycomparedwithplacebo Dermatology, Stanford University, Stanford, USA, versity ofCaliforniaSanDiego,USA Miller SchoolofMedicine,UniversityMiami,USA, Miami Itch Center, Department of Dermatology and Cutaneous p=0.022) for serlopitant 1-mg, and –42.5 (4.1; 3 , JeanY. Tang 4 , Andrew J.Perlman 1 , Sonja Ständer weeks and baseline pruritus Visual Analog Scale 5 3 Thomas A. Luger , ThomasA. Menlo Therapeutics, Inc., Menlo Park, 4 , Edward F. Schnipper 2 ,

mg, or placebo for 6 7 Matthew B.Kerby Department of Dermatology, Uni- 2 , MartinSteinhoff ≤0.05), as measured by measured as ≤0.05), 5 Department ofClinical 6 Department ofDerma- p=0.013) for 3

4 weeks once weeks once , , 2 James W. Xiaoming Center for 4 6,7 Velocity - - - - were observed. moderate intensity, whilenomeaningfuladversesafetytrends doses weresafeandwelltolerated. All TEAEs wereofmildor chronic pruritus VAS score,comparedwithplacebo,andboth in improvement significant statistically provided mg 5 and mg 1 abnormalities orchangesinvitalsignsandnodeaths.Serlopitant due toa TEAE. There werenomeaningfultrendsinlaboratory mild or moderate intensity. Six patients discontinued study drug 5 mg,respectively, and1.6%forplacebo).Most TEAEs wereof diarrhea (0%,6.2%,and3.2%forserlopitant0.25mg,1 Miami, MillerSchoolofMedicine,USA, μg), alum (1 alum μg), atopic dermatitis. Adult maleC57BL/6micereceivedOVA (100 epidermal innervationintheovalbumin(OVA) mousemodelof chronic itch. Therefore, weinvestigatedwhether Tofacitinib affects have beenobservedinatopicdermatitisandmaycontributeto largely unknown. However, themechanismbehindthisantipruriticeffect isstill tipruritic effects inaphase2trialofatopicdermatitispatients. an significant demonstrated has Tofacitinib inhibitor JAK The University ofMiami,USA Kristen Sanders,KentSakai, MOUSE MODEL OF ATOPIC DERMATITIS NERVE FIBERDENSITY BY TOFACITINIB IN A RECOVERY OF PEPTIDERGICEPIDERMAL OP25 skin disease that affects children and adults, is characterized by inflammatory chronic a (AD), dermatitis Atopic Introduction: 1 Emma Guttman-Yasky MODERATE ATOPICDERMATITIS CLINICAL TRIALS INPATIENTS WITH MILDOR RELIEF OF PRURITUSIN TWO PHASE3 CRISABOROLE OINTMENT PROVIDESEARLY OP26 press itchandcontributetotheantipruriticeffects of Tofacitinib. epidermal nerves may activate itch-inhibitory interneurons to sup epidermal nonpeptidergic nerves. The re-innervationofpeptideric compared tonaivemice. Tofacitinib didnotaffect thedensityof group vehicle-treated the in increased significantly was ENFD ENFD, recovering it to naive skin levels. mice. Tofacitinibnaive to peptidergic the increased significantly was significantly decreased in the vehicle-treated group compared or P2X3,amarkerfornonpeptidergic nerves.Peptidergic ENFD with antibodiesagainstCGRP, amarkerforpeptidergic nerves, mice wereperfusedonDay28,andskinwasimmunostained (ENFD), density fiber nerve epidermal investigate To vehicle. series. Tofacitinib didnotreducealloknesisscorecomparedto stimulus the by elicited bouts scratch of number the as defined the borderoftreatmentarea. The alloknesisscore(0-5) was along sites random to mN) 0.7 force: (bending monofilament cessive innocuous mechanical stimuli were delivered byvonFrey compared tovehicle-treatedmice. To testforalloknesis,5suc scratching spontaneous inhibited significantly displayed mice assess spontaneousscratching.Onbothdays, Tofacitinib-treated and 28,thepatchwasremoved,animalswerevideotapedto rostral backskinandcoveredwitha Tegaderm patch.OnDays21 topical OVA (100 water) wasdeliveredat15mg/kg/day. tinib orvehicle(50%DMSO,10%PEG300,and40%distilled Australia, nifin mini-pumps weresubcutaneouslyimplantedinthemice. Tofaci byOVA1, followed (50 Icahn School of Medicine at Mount Sinai Medical Center, 4 4 Oregon Healthand ScienceUniversity, USA mg), andpertussistoxin(300 μl, 0.1%) was applied daily by gauze to shaved Dynamic changesinepidermalinnervation 1 , Gil Yosipovitch μg μg sc) on Day 5. On Day 7, Alzet osmotic Gil Yosipovitch, 3 University ofNewSouthWales, 2 , Acta DermVenereol 2017 Poster abstracts Dedee Murrell Beginning onDay14, pg) ontreatmentDay

The nonpeptidergic Tasuku Akiyama 2 University of 3 , Jon Ha- 1015 - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta analyzed byRPPA, which examined expression levels ofover 200 The celllysatefromcontroland EGF-treatedHaCaT cellswere were stimulatedwithandwithout epidermalgrowthfactor(EGF). Reverse PhaseProtein Arrays (RPPA) technology. HaCaT cells using signaling EGFR tobetterunderstand amodelsystem as used plored. Towards thisgoal, humankeratinocyteHaCaT cellswere mast cells,theroleofhumankeratinocytes remainslargely unex keratinocytes. While previousstudieshavesuggestedarolefor reduces theadverseeffects causedbytheblockadeofEGFRin is tobetterunderstandthemechanismbywhichNK1Rblockade in patients treated with EGFR-TKI’s. The goal of the present study the Neurokinin1receptor(NK1R),iseffective indecreasingitch pruritus and acneiform skin eruptions. Aprepitant, an inhibitor of agents, theyproduceseriousadverseeffects ontheskinincluding several othercancers. While EGFR-TKI’s areeffective anti-cancer such as erlotinib, are currently used for the treatment of lung and Epidermal growth factor-tyrosine kinaseinhibitors (EGFR-TKIs), 3 1 Shawn Kwatra INDUCED PRURITUS A MECHANISMFORREDUCINGERLOTINIB- SIGNALING INHUMANKERATINOCYTES AS APREPITANT: PARTIAL ACTIVATION OF EGFR ACTIVITY OF THE NEUROKININ-1 ANTAGONIST NEW INSIGHTS INTO THE ANTI-PRURITIC OP27 mild tomoderate AD. provide muchneededearlyreliefofpruritusforpatientswith may representapromising,novel,topical AD treatmentthatcan pruritus severitythandidvehicle-treatedpatients.Crisaborole treated with crisaborole experienced greater early reduction in pruritus, regardlessofBL diseaseseverity. Additionally, patients tion of crisaborole-treated patients experienced early relief of –40.9% vs–26.1%;p patients (mild AD: –42.9%vs–29.2%;p moderate AD was significantly greater than that in vehicle-treated in crisaborole-treatedpatientswithmild AD andinthosewith At day6,meanpercentagechangefromBL inpruritusseverity improvement inpruritus(48hours:37.6%vs26.9%;p more crisaborole-treated patients with mild AD experienced p AD: 59.5%vs41.3%;p improvement inpruritus,regardlessofBL diseaseseverity(mild treated patientsthanvehicle-treatedexperiencedearly crisaborole- more Significantly improvement atday6.Results: of achievement as defined was pruritus in improvement Early BL. from improvement ≥1-grade a with (1) mild or (0) none of score a as defined improvement with [3]), severe to [0] (none twice dailyfor28days.Prurituswasmeasuredona4-pointscale tients wererandomlyassigned2:1toreceivecrisaborole:vehicle (ISGAmild with old years ≥2 (ISGAmoderate to 2) 3) Pa AD. by theInvestigator’s StaticGlobal Assessment (ISGA)inpatients disease severity. Methods:Globaldiseaseseveritywasmeasured crisaborole on early relief of pruritus stratified by baseline (BL) ter, vehicle-controlled,Phase3trialsevaluatingtheimpactof analysis wasperformedfrom2identicallydesigned,multicen inhibitor forthetreatmentofmildtomoderate AD. A posthoc 4 phosphodiesterase anti-inflammatory, nonsteroidal, novel, a akeytreatmentgoal.Crisaboroletopicalointment,2%,isis disturbance and reduced quality of life. Quick relief of pruritus scratching leadstodiseaseexacerbationthatoftenresultsinsleep intense pruritus,regardlessofdiseaseseverity. Pruritus-induced 1016 Madison Krischak cine, Division of Dermatology, Washington University School of Medicine, USA Department ofDermatology, JohnsHopkinsUniversitySchoolofMedi- <0.001). At the earliest assessment, at 48 hours, significantly hours, 48 at assessment, earliest the At <0.001). 2 Department of Anesthesiology, Duke University School of Medicine, 9 th WorldCongressofItch 1 , Cory Nanni 2 , MadanKwatra <0.001). <0.001; moderate AD: 54.7%vs38.3%; 2 , Yevgeniy Semenov Conclusions: A significant propor 2 =0.009; moderate AD: =0.009; 3 , Callie Roberts =0.02). 2 - - - - , to September 2016) to find published clinical trials for the treat the for trials clinical published find to 2016) September to performed usingPubMedand Trip Database(fromJanuary1990 systematic literaturereview. A systematicliteraturesearchwas a on based pruritus on efficacy their assess to was objective Our available systemictreatmentsforpsoriasisisincreasingrapidly. sis anditsimpactonthepatients’ qualityoflife. The varietyof documented thatpruritusisaveryfrequentsymptomofpsoria In thecourseoflast30years,severalstudieshaveclearly Department ofDermatology, UniversityHospitalofBrest, Brest, France sery Emilie Brenaut, Chloé Théréné, LITERATURE REVIEW AND META-ANALYSIS OF PSORIASISONPRURITUS: A SYSTEMIC EFFICACY OF SYSTEMIC TREATMENTS OP28 in thepediatricagegroup.Objective: We soughttoevaluate the age grouptocontroltheitching inchronicspontaneousurticaria studies tilldateofthisnoveltherapeutic regimeninthepediatric bronchial asthma in the pediatric age group, however there are no been triedinotherallergic disorderslikeatopicdermatitis and recent years,monoclonal Anti-IgE antibody‘omalizumab’ has side effects inthisagegroupandaremostlycontraindicated.In sives althougheffective temporarily, areassociatedwithalotof prevent arecurrence.Oralsteroidsandotherimmune-suppres pruritic wheals and oral anti-histamnics are mostly insufficient to in the age group of 6 to 12 years present frequently with episodic population, butitrepresentsahighburdentopatients.Children persisting for ≥6 weeks. It affects 0.5–1% of the global pediatric neous appearanceofitchywheals,withorwithoutangioedema, sponta the as defined is (CSU) urticaria spontaneous Chronic Base HospitalNewDelhi,India Barnali Mitra,BijuVasudevan, ReemaSolanki, POPULATION SPONTANEOUS URTICARIA IN THE PEDIATRIC MANAGEMENT OF PRURITUSINCHRONIC ANTI-IGE ANTIBODY OMALIZUMABIN THE CONTROLLED STUDY OF MONOCLONAL RANDOMIZED, DOUBLE-BLIND,PLACEBO- OP29 variable endpointsindifferent studies. results mustbedisplayedcarefullybecausetherearesomany necessarily correlated with lesion recovering. Nonetheless, these UVB phototherapy, improve pruritus inpsoriasisbutthatitisnot systematic reviewhighlightsthatsystemictreatments,including pruritus inpsoriasiswithvariableeffect sizemagnitudes.Our mab, andapremilastwereallshowntobeeffective inreducing adalimu inhibitors, JAK Il-17, pruritus. Anti on impact benefic 10 itchscaleandhighlightedthatalltreatmentsevaluatedhada confirmed.was to 0 a using trials 13 included meta-analysis The review. At baseline,thehighprevalence of pruritus (80 to 100%) 516 articles identified, 35 studies were retained in the systematic ments ofpsoriasis,thenameta-analysiswasperformed. Among EGFR signalinginkeratinocytes. may reduceitchandadverseeffects ofEGFR-TKI’s byaugmenting keratinocytes. Taken together, these data suggest that aprepitant primary human in confirmed were results These as Akt. well as NK1R blockeraprepitantincreasedthephosphorylationofEGFR presence oferlotinib. Interestingly, exposure ofHaCaT cells to the was blockedwhenHaCaT cellswerestimulatedwithEGFinthe SHP2, Src, and STAT3. The phosphorylation of all of these proteins JNK, MAPK,MDM2, p90RSK,PKC-betaII, PLC-gamma2, Shc, including thefollowing: Akt, EGFR,GSK-3beta,HER2,HSP27, proteins several of phosphorylation the increased significantly proteins/phosphoproteins. StimulationofHaCaT cellswithEGF Thomas Barnetsche, Debdeep Mitra Laurent Mi------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV by expectancyinterventions. strategies orreplacing regular pharmacological treatments partly adherence, addingenvironmental cuestothepreferredoutcome for example,byapplyingconditioning principlesfortherapy ous andautomaticstrategiesof optimizingexpectancyeffects, Treatment outcomesmightbeoptimized byusingbothconsci chronicitch. with forthetreatmentofpatients implications or changeplaceboandnoceboeffects. The resultshavedirect nocebo effects in itchaswell as innovative methods to induce will bepresentedtodemonstratetheevidenceforplaceboand pharmacological conditioning.Inthepresentations,recentresults play aroleforimmunefunctioning,suchashistamine,through outcome orsideeffects. Inaddition,placebomechanismsalso are inducedbyexpectationsofapossibleunfavorabletreatment seeing theitchkiller”). The sameistruefornoceboeffects which possible beneficial treatment outcome (“Itch already reduces when altered byplaceboeffects, duetoinductionofexpectationsa ample, physical complaints, such as itch or pain, can beeffectively nings andrelevanceofplaceboeffects forchronicitch.Forex Increasing evidencedemonstratestheneurobiologicalunderpin den, TheNetherlands Leiden University, Health,Medical and Neuropsychology Department,Lei- Andrea Evers EFFECTS INPATIENTS WITH CHRONIC ITCH? NOCEBO TO ALTERHOW PLACEBO AND OP30 . CSU who are symptomatic despite background therapy with H1 an effective andwell-toleratedadd-on therapyforchildrenwith with placebo,anexcellenttolerance. Thus, omalizumabis QoL andthe proportionofdaysfreefromangioedemacompared number andsizeofhives,increasedpatients’ health-related omalizumab significantly reduced theseverity of itching, and the resistant toantihistamines,add-ontherapywithsubcutaneous tion, inrecent, well-controlled clinical trials in patients with CSU both adultandpediatric(children;>6-year-old) patients.Inaddi the field of asthma and is currently approved for the treatment of to its high-affinity receptor FcεRI. It has been largely studied in Cε3 domain of the IgE heavy chain and prevents it from binding manized anti-immunoglobulinE(IgE)antibodythatbindstothe of thosewhosuffer fromit.Omalizumabisarecombinanthu prevalence thathasimportanteffects onthequalityoflife(QoL) urticaria (CSU) is a disease with significant morbidity and relative use ofapproveddosesH1-antihistamines.Chronicspontaneous urticaria inchildrenwhohadremainedsymptomaticdespitethe mab diminishedclinicalsymptomsandsignsofchronicidiopathic placebo groupbothat16and32weeks.Conclusions:Omalizu significantly reduced in the Omalizumab group as compared to the basophils andpDC2(p ted in a statistically significant reduction in FcεRI expression on 4–6 points). Results: Compared with placebo, omalizumab resul Urticaria activityscore(UAS)atbaselinewas5.7points(range, mg orplacebo,followedbya16-weekobservationperiod.Mean injections, spaced4weeksapart,ofomalizumabatadose150 baseline ageandserumIgElevelstoreceivefoursubcutaneous or placebo. We randomlyassigned30childrenwithcomparable between theagegroupof6to12yearsrandomizedomalizumab This wasadouble-blind,placebo-controlledtrialwithchildren despite H1- therapy (licensed doses). Methods: severe chronicidiopathicurticariawhoremainedsymptomatic in patients between the group of 6 to 12 years with moderate-to- efficacy and safety of monoclonal Anti-IgE antibody omalizumab METHODS INITCHRESEARCH

(CLINICAL) <0.001). UASandserumIgElevelswere ------

lergology, J-L-University, Giessen,Germany to histamine-evokeditch.Inadditionchemicalandpsycholo a similarintenseitchresponsetoaudio-visualstimulicompared In particular, primingontheskinseemstobeimportantevoke effective whencertainaspects areconsideredinthestudydesign. atopic dermatitisorpsoriasis,thesemethodsseemtobesimilarly audio-visual stimuli.Especiallyinpatientswithchronicitchdueto ditory orvisual(imagesvideos)stimuliandthepresentationof other peoplescratching(contagiousitch),thepresentationofau to induceitch: The provocationofscratchresponsesbyshowing hand, variousratherpsychologicallyorientedmethodsareused is oneofthemostpowerfulitch-inducingmethods.Onother used. Somestudieshaveshownthattheapplicationofcowhage invasive proceduressuchasiontophoresisandskinprickarealso end) ofitchcanbecontrolledmoreeasily. Inaddition,partial skin isparticularlyadvantageousbecausethetiming(startand to bementioned.Usingthe method of directapplicationonthe all, theapplicationofsubstanceslikecowhageorhistaminehas itch inductionhavebeendevelopedduringthelastyears.Firstof (prevalence, chronicity and intensity). Numerous methods of stakeholders: Methods to induce itch and measurement of itch all benefit would methods research of standardization greater where ofitchresearch, aspects ontwo lecturefocuses This 1 Joerg Kupfer METHODS IMPROVE STANDARDIZATION OF RESEARCH METHODS INITCHRESEARCH: ARGUMENTS TO OP31 between parentandchild’s ratingswastheoutcomevariablein (“last week”)aswellthedayprior (“yesterday”). The difference both ratedtheseverityofchild’s itchwithinthepast7days in theprocessofvalidatingchildren. The childandtheparent used foradults. The scalehasbeenvalidatedinadultsandweare ItchyQuant, acartoonversionof thetraditionalnumericalscale ren andtheircaregiverstoratethechild’s itchseverityusingthe itch forchildrenisalsounknown.Methods: We askedbothchild serve as a proxy for their children. to ability their influence may itch with caregivers of experience rate theseverityofitchinchildrenisunknown. ficult symptom to measure. Background: Chronicpruritus(CP)inpediatricpatientsisadif 1 Grace Lee BE PROXIES? PRURITUS INFLUENCEPARENT’S ABILITY TO DOES PERSONAL EXPERIENCE WITH CHRONIC MEASURING PEDIATRIC ITCHSEVERITY: OP32 arising fromthisarediscussed. is substantiallylowerifrepresentativenessgiven.Conclusions presentation ofGermanstudies. The prevalenceofchronicitch representativeness ofthesamples. This willbeillustratedbythe were similaroridentical. This problemmaybecaused bymissing results (eveninthesamecountry)althoughquestionsused studies ontheprevalenceof(chronic)itchrevealedverydifferent more comparable inthefuture.Nevertheless, epidemiological used increases. Therefore, itisexpected thatstudyresultswillbe Fortunately, standardizationwithregard tothequestionsthatare rable. The situationissimilarregardingthemeasurement of itch. same (similar)methodtoinduceitchisused,arehardlycompa to standardizetheuseofthesemethods,studyresults,evenif used. However, because right now there are only first approaches gical proceduresalone,alsocombinationsofbothtechniquesare mes Roberts Institute of Medical Psychology, and Emory University, and 1 , 2 Sandy François , Kuang-HoChen 1 , UweGieler 2 Georgia InstituteofTechnology, USA 2 , StephanieKiupel The ability ofcaregivers to accurately 1 , Shelby Smith 1 , SuephyChen 2 Department of Dermatology and Al- The best duration of recall of Acta DermVenereol 2017 Poster abstracts 1 , Caitlin Haydek 1 1 , ChristinaSchut The previous 1 1017 , Ja- 1 - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Chilly-Mazarin, France, were observed on the PP-NRS with PROs (P2b/P3 SCORAD itch change of correlations Moderate-to-strong P3. and P2b in ≥0.95 were analysis test-retest the of coefficients correlation Intraclass and significantly across known groups (p <0.0001) inP2bandP3. were observed in the P3studies. The PP-NRS differed predictably Global (IGA)[r=0.17,p Assessment measures ofdifferent constructs(EASI[r=0.09]andInvestigator’s [r=0.67], VAS [r=0.77],DermatologyLifeQualityIndex(DLQI) itchitem (Average constructs similar itch [r=1.00], SCORAD NRS Pruritus correlations wereobservedbetweenPP-NRSandmeasuresof ritus inthepast24hours.InP2bstudy, large positivebaseline to select a response aligned withtheirpersonal rating of peakpru consistently, and found it relevant, clear, comprehensive, and easy properties. longitudinal (test-retestandsensitivitytochange)measurement examine cross-sectional (construct and known-groups validity)and reported outcomemeasures(PROsandClinROs)wereused to with ≥1 post-baseline PP-NRS assessment. Patient- and clinician- dupilumab/placebo of dose subcutaneous ≥1 receiving patients daily throughendoftreatment(Week 16). The Analysis includes adult AD patients. Participants completed the PP-NRS once (n=1,379; NCT02277743,NCT02277769)inmoderate-to-severe studies (P3) 3 phase two from data pooled using confirmed and assessed inaphase2b(P2b)study(n moderate-to-severe itch(n tion included interviews with US adults with AD self-reporting the worstmomentduringprevious24hours?”Contentvalida being ’worstitchimaginable‘,how would yourateyouritchat 24 hours:“Onascaleof0to10,withbeing’noitch‘and10 item toassesstheintensityofpeak(worst)pruritusduringpast dermatitis (AD).Methods: The PP-NRS isasingle,self-completed for measuring itch in patients with moderate-to-severe atopic sessment ofthePeakPruritusNumericalRatingScale(PP-NRS) Objective: To conductcontentvalidationandpsychometricas 5 1 Gil Yosipovitch ATOPIC DERMATITIS PATIENTSMODERATE-TO-SEVERE WITH CLINICAL STUDIESOF DUPILUMABIN ADULT NUMERICAL RATING SCALE:RESULTS FROM VALIDATION OF THE PEAKPRURITUS OP33 significantly predicted the difference in scores (beta 0.26, rental experience trended significance (beta 1.25, significantly predict the difference in scores. recruited. Inthe“yesterday”group,parentalexperiencedidnot race, andgender. Results:231childrenages6–17withCP were with CP wastheprimarypredictorvariable,adjustingforage, a multivariable linear regression model. Parental experience 1018 kari Tarrytown, USA son larger studyisneededtounderstandthesedifferences. to theeffect oftheseverityitchonchildasages. A parent and child’s ratings. Perhaps the parent is more desensitized increase inthechild’s age,thelarger thedifference betweenthe the larger thedifference inassessment. Also, forevery3-month to theprevious7days.ThelessparentalexperiencewithCP, and parentassessmentofthechild’s itchseverity, whenreferring Parental experience and age influence the difference between child rather than“lastweek”giventhe lack ofpredictorsdifference. Conclusion: The bestdurationofrecallitchmaybe“yesterday” RTI HealthSolutions, Ann Arbor, and Miami School of Medicine, Miami, USA, 4 6 , Marci Clark 9 p<0.01 forall),andweak-to-moderatecorrelationswith th WorldCongressofItch Results: 1 , Matthew Reaney 5 , Interview participants interpreted the PP-NRS Marius ArdeleanuMarius 4 RTI HealthSolutions,Research Triangle Park, =14). Psychometricpropertieswere 2 6 , Regeneron Pharmaceuticals, Inc., <0.01]). Similar relationships <0.01]). Similarrelationships Laurent Eckert 6 2 Sanofi, Guildford, UK, Guildford, Sanofi, , Allen Radin =379; NCT01859988) For “lastweek,”pa p =0.09), and age =0.09), andage 6 3 , , Abhijit Gad- Lauren Nel- p =0.03). =0.03). 3 Sanofi, - - - - taka Furue Kuroki, differences wereobservedonly inthreequestions,wherethesec a good reproducibility of achieved results (ICC=0,72). Significant (r=0.53, VAS (r=0.58, with observed also was correlation scoring. Asignificant total a with correlated significantly questions single all to responses – 0.81) coefficient α (Cronbach consistency good showed results stimuli (fourquestions). A maximumscoringwas22points. The psyche (fourquestions),andscratchingasaresponsetopruritus patient and concentration on pruritus of influence question), (two questions),pruritusextent(onequestion)andduration Results: We havecreatedthe12-PSSassessingpruritusintensity interval. 12.0. Statistica with analyzedstatistically were results All who completed the itch questionnaire twice with the 3 to 5 day Test-retest comparisonof12-PSSwasconductedin102subjects (DLQI) andHospitality Anxiety andDepressionScale(HADS). were also asked to complete the Dermatology Life Quality Index Severity Score (12-PSS)and Visual Analog Scale (VAS). Patients were askedtoassesspruritusintensityusing12-ItemPruritus of 148 patients (81 women and 67 men) with pruritic dermatoses total new itchseverityquestionnaire.MaterialandMethods:A jective: The aimofthisstudywasthecreationandvalidation clinical problem due to a subjective nature of this sensation. assessment of pruritus intensity is an important, but still difficult predominantly diagnosedbasedonpatientcomplaints. A validated Introduction: Pruritusisaverycommonsubjectivesymptom, cal University, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Szepietowski Adam Reich, SEVERITY QUESTIONNAIRE DEVELOPMENT AND VALIDATION OF NEW ITCH 12-ITEM PRURITUSSEVERITY SCALE: OP34 AD condition among five different severity grades: clear, mile, clear, grades: severity different five among condition AD Japanese AD patients. GQisaquestiontoevaluatetheiroverall Rating Scale(VRS)andPOEM and GlobalQuestion(GQ)in150 ship between POEM and Visual Analogue Scale (VAS), Verbal mild, moderateandsevere/very severe, byassessingtherelation sought tostratifyPOEMscores intofourseveritybands,clear, taining whetherPOEMbandingscanbeusedinternationally, we of POEMscoreswhenusedindailymedicalpracticeandascer identifying POEMbandsthatcouldbeusedtoaidinterpretation such asitch,skindrynessandsleepdisturbance. With theaimof with atopicdermatitis(AD),whichconsistsofsevenquestions, is a self-assessed, repeatable measurement tool for the patients The Patient-OrientedEczemaMeasure(POEM)(score:0–28) ushu University, Japan Department ofDermatology, GraduateSchoolofMedicalSciences,Ky- Makiko Kido-Nakahara, JAPANESE ATOPIC DERMATITIS PATIENTS ECZEMA MEASURE(POEM)SCORES AMONG CLINICAL BANDINGSOF PATIENT-ORIENTED OP35 be usedindailyclinicalpracticethefuture. sions: The newly developedpruritusseverityquestionnairemay ond assessment demonstrated significantly lower values. with moderate-to-severe AD. with sensitive, andvalidscaletoassessitchintensityinadultpatients all). and ClinROs(EASI,r=0.50/0.46;IGA,r=0.50/0.46)(p<0.01for VAS r=0.77/0.73;DLQIitchitemr=0.66/0.64;PCSr=0.71/0.72) Peak Pruritus NRS is a well-defined, reliable, well-defined, a is NRS Pruritus Peak Conclusions: Tetsuya Koga,Toshihiko Mashino,Yuichi Kurihara, Masu- p <0.001). Test-retest comparison in102subjectsrevealed p Agnieszka Bożek, Agnieszka <0.001) and quality of life level according to DLQI <0.001) and quality of life level according to DLQI Yumi Yasukochi, Katarzyna Janiszewska,Jacek C. Takeshi Nakahara,Rie Conclu Ob - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV results beingsimilarbutnotexactlythesamewiththatofChar applicable toglobalclinicaltrialsfor AD. However, ourbanding the severity of patients’ symptoms and has a potential to become quite similar. POEMisasimpleandvaluablemeasuretoassess 25–28 (verysevere).OurbandingsandCharman’s turnedoutbe almost clear),3–7(mild),8–16(moderate),17–24(severe)and (clear/ 0–2 bands: severity five included (2013) al. et Charman, We showedbyIHCthatthemajoractors ofitch(PAR-2, TSLP, were able to confirm the presence of nerve fibers in the epidermis. ganglia ofrats. After severaldaysofco-cultureintranswells,we (dermis andepidermis)sensory neuronsfromdorsalroot model is based on a co-culture between a human skin explant hed re-innervated skin explant model by sensory neurons. This In ordertostudypruritusinvitro, weadaptedapreviouslypublis 1 Nicolas Lebonvallet MODEL FORIN VITRO STUDIESONPRURITUS RE-INNERVATED HUMANSKINEXPLANT AS A OP37 NC/Nga mice with IgE- and T the developmentofatopicdermatitis-likeskinlesionmodelsin great stepsforwardoverrecentyears,comprisingforinstance animals. Indeed,invivoanimalmodelsforitchresearchattained involved in itch processing could be identified in humans and also circuits neuronal the recordings, fibre nerve single sophisticated used to evoke experimentally itch. Bytheir means, and employing receptors andothers.Notonlypruritogensbutalsoalgogenscanbe peptides, lysophosphatidicacids,Mas-relatedG-proteincoupled play acentralroleinitchpathogenesis,suchasgastrin-releasing to identified and explored been had receptors and candidates of investigated andoverdecadesofresearch,agrowingnumber Initially, histamineor releasingsubstanceshadbeen volunteers followedbytherecordingofmagnitudeitchsensation. administration ofitch-inducingsubstances(pruritogens)inhealthy remarkably overthepastfewyears. The mostobviousmodel isthe The numbersofexplorativemethods for thestudyofitchincreased culty Mannheim,UniversityofHeidelberg, Mannheim,Germany Department of Anesthesiology, Experimental Pain Research, Medical Fa- Roman Rukwied INTRODUCTION – AN METHODS INEXPERIMENTAL ITCHRESEARCH OP36 validate itsglobaluse. man’s implythatlarger scaleofsampleanalysisisnecessaryto ( with POEM of correlation significant statistically and VRS VAS for POEMbandings,thisbandingwasproventohavethemost and severe/verysevere=19–28. Among thepossiblecandidates most appropriate banding: clear=0–2, mild=3–8, moderate=9–18 the as chosen was agreement coefficient kappa highest the with and 0.7049, respectively, significant correlations with GQ, VAS and VRS (r=0.7343,0.7364 moderate, severeandverysevere.POEMshowedstatistically Thierry Oddos additional toolforstudyingpathologicitch. atopic keratinocytesandtheneuronalnetwork,thusprovidingan fibroblasts, dermal between communication the into insights in vitro cell-culturesystemsalsohavebeenintroduced,gaining hyperproduction. Supplementingthemethodologicalport-folio, Brest, Laboratory of Neurosciences of Brest, University of Western Brittany, p =0.05-0.001). proposedby scores The bandingforPOEM 2 Johnson &SantéBeautéFrance,Val deReuil,France METHODS INITCHRESEARCH 2 , Laurent Misery (EXPERIMENTAL) 1 , Christelle Le Gall-Ianotto p<0.01). The banding for POEMscores H 1 2 cell-associated IL-31 1 , Cecilia Brun 2 - - , can be used for studying itch and neurogenic inflammation Geriatric HospitalandInstituteofGerontology, Tokyo, Japan mice. Thus, mastcellsmaynotcontributeCRF-associatedscrat mast cellsdidnotalteredbetweenCRFmiceandsham-operated Toluidine bluestainoftheskinsectionshowedthatnumber 2-neutralizing antibody did not inhibit CRF-associated scratching. H anitch-relatedbehavior. thatthebehavioris naltrexone, suggesting The scratching was inhibited by mu-opioid receptor antagonist was given5/6nephrectomy, spontaneousscratchingwaselicited. developed a mouse model of CRF-associated pruritus. When mice the underlying mechanisms ofthepruritusremainunclear. We have pruritus calleduremicpruritus. Although thepruritusisverysevere, withsevere achronickidneydisease Chronic renalfailure(CRF)is Pharmaceutical Sciences,UniversityofToyama, Japan Department of Applied Pharmacology, GraduateSchoolofMedicineand shi Kuraishi TsugunobuAndoh, PRURITUS OF CHRONICRENAL FAILURE-ASSOCIATED CHARACTERIZATION OF A MOUSEMODEL HISTOCHEMICALPHARMACOLOGICAL AND OP38 with aPAR-2 agonist(SLIGKV-NH measurement of TSLP releaseinthesupernatantafterincubation dermal cells. The functionalityofthemodelwasassessedby Japan). Sera obtained from mice with severe AD were injected real time image analyzer, a SCLABA-Real system (Noveltec, Inc., a using by quantified was behavior scratching and scored, was examined byusingeachgeneral method.Clinicalskinseverity tory-, anxiety-,anddespair-related behaviorandpreferencewere grades ofskinlesions. To evaluatedepressivebehavior, explora disorder weretestedinNC/Tndmiceaccompaniedwithvarious Method: Behavioralparametersassociatedwiththedepressive sions withIgEhyperproductonintheair-unregulated circumstance. using NC/Tndmicewhichspontaneouslydevelop AD-like skinle useful. Therefore, weinvestigatedon AD-associated depression clarify the mechanisms, an animal model suitable for AD is very mediators of AD-associated depression are poorly understood. To specific and pathogenesis the of mechanisms However, (AD). complicated inpatientssuffering fromsevereatopicdermatitis Background: Depressionisoneofthepsychologicaldisorders 1 Kenshiro Matsuda DERMATITIS NC/TND MICESUFFERINGFROM ATOPIC DEPRESSIVE BEHAVIOR MANIFESTEDIN OP39 for thedevelopmentofnewanti-pruriticdrugs. useful fortheelucidationofmechanismspruritusand above observation,itisconsideredthatthemousewithCRF involved inCRF-associatedscratching. Taken togetherwiththe suggested that plasma component increased in CRF mice is also plasma component of CRF mice elicited scratching. These results ved onprimaryafferents. In addition,anintradermalinjectionof increased inCRFmice,butnotsham-operatedwasobser section ofCRFmice,theimmunoreactivityplasmacomponent portant roleinCRF-associatedscratching.Interestingly, inskin B in pruritus.Both TP thromboxanereceptorandBLT leukotriene ching. Itiswellknownthatarachidonicacidmetabolitesinvolved TSLP-R, TRPA1, IL31,IL31-R)werepresentinneuronsandepi Hiroshi Matsuda suggesting thatthromboxane A Tokyo University of Agriculture & Technology, and 4 1 receptor antagonists attenuated CRF-associated scratching, histamine receptor antagonist and proteinase-activated receptor histaminereceptorantagonistandproteinase-activated 1 1 , Shikai Li, Shuichi Yanai Takahito Maki,DaisukeUta, 2 andleukotrieneB 2 , Shogo Endo 2 ). Inconclusion,ourmodel Acta DermVenereol 2017 Poster abstracts 2 Tokyo Metropolitan 2 , Akane Tanaka 4 playanim in vitro. Yasu- 1019 1 ------, Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Whelan South African MedicalResearch Council,CapeTown, South Africa Brestoff Danielle Bartels WITH VERBALCONDITIONING SUGGESTION REVERSING NOCEBOEFFECTS ONITCHBY OP41 behavior. mammalian influence to pathways signaling immune classical served paradigminwhichthesensorynervoussystememploys system. Collectively, thesestudiesrevealanevolutionarilycon system mayrepresentnoveltherapeutictargets withinthenervous Thus, signalingmechanismspreviouslyascribedtotheimmune treated withJAKinhibitorsinproof-of-conceptclinical studies. patients withrecalcitrantchronicitchmarkedlyimprovewhen and JAK1signaling.Basedontheseobservations,weshowthat demonstrate thatchronicitchisdependentonneuronalIL-4Rα stimulate sensoryneuronsinbothmiceandhumans.Further, we poorly understood.Here,weshowthattype2cytokinesdirectly remain itch as such sensations promote pathways inflammatory asthma and atopic dermatitis. However, the mechanisms by which as such diseases inflammatory chronic with associated also are environmental factors.Itiswellestablishedthattheseresponses ing andscratchingtoexpelinvadingpathogensnoxious Mammals have evolved neurophysiologic reflexes such as cough 1 Landon K.Oetjen CHRONIC ITCH IMMUNE SIGNALINGPATHWAYS TO MEDIATE SENSORY NEURONSCO-OPT CLASSICAL OP40 impaired hippocampalneurogenesisthroughtheperipheralblood. mice suffering from AD developed depressive behavior with NC/Tnd that demonstrated clearly findings These Conclusion: depressive behavior but also decreased the number of neuroblasts. injection ofseraobtainedfrommicewith AD notonlyinduced was comparable to that in age-matched SPF controls. Intravenous Tnd mice with the skin lesions, whereas the number of progenitors neuroblasts inthedentategyruswasdramaticallyreducedNC/ without AD did not show any significant changes. The number of swimming respectively. Ontheotherhand,SPFNC/Tndmice immobility wasobservedin the testsoftailsuspension andforced decreased relatingwithseverityoftheskinlesions.Prolonged behavior weredecreased.Sucrosepreferencewasstatistically prolonged aftertheonsetof AD, whereaspartitionandrearing NC/Tnd mice. In the open field test, immobility was significantly obvious relatingwithaggravationoftheclinicalaspects AD in (neural progenitormarker).Results:Depressivebehaviorbecame (neuroblast marker), and anti-brain lipid binding protein antibody hippocampal neurogenesis including anti-double cortin Xantibody nohistochemistry wasperformedbyusingtheneuralmarkersof intravenously intoSPFmicewithout AD symptoms,andimmu 1020 Trier Hijne vidson fer Lihua Yang cinnati CollegeofMedicine,Cincinnati, USA. hof IV HOT OFF THE BENCH:LATEST NEWSBY Washington University School of Medicine, St. Louis,. 1 1 , 2 , , Mark J.Miller 1 Andrea Evers Frank Brombacher 1 , , 2 Amy Z.Xu , QinLiu 1 1 Kaya Peerdeman , 9 ,

Haixia Niu th M. Laurin Council WorldCongressofItch 1 , YOUNG INVESTIGATORS Samantha L.Hamilton 1 1 , BrianS.Kim , 1 , Antoinette van Laarhoven 1 1

1 , Shivani V. Tripathi , 1 Madison R.Mack Zhou-Feng Chen , Changxiong J.Guo 3 1 , , Chyi-Song Hsieh Rogier Donders 1 , Richard Brasington 1 1 , Peter L. Wang 1 1 , , 1 , Jialie Luo Hongzhen Hu 3 University ofCapeTown & Jing Feng 1 , 2 1 1 , , , Sisi Chen Peter van de Kerk- Michiel Stroo Robert W. Gereau, 2 1 University of Cin- 1 , , András Schaf- 1 1 Xiaofei Gao , ,

Jonathan R. 1 Timothy M. , 2 , Steve Da- Anna M. 1 , Kim 1 - - - , Art, Co.,Ltd., for patientssuffering fromchronic itchconditions. to increasedtreatmenteffectiveness andimprovedqualityoflife diminish and reverse nocebo responses might eventually contribute conditioning with verbal suggestion. A better understanding howto by reversed be can effects nocebo that demonstrate to first the is reversed, signifying a placebo effect. Conclusions: The current study groups. Meanlevelsofitchshowedthatthenoceboeffect waseven cantly smallernoceboeffect onitchincomparisonwithbothcontrol applied. expectation induction was continued oranextinctionprocedure was ning with verbal suggestion. In the control groups either the negative experimental group, positive expectations were induced by conditio or oneofthecontrolgroups(part2:reversingnoceboeffect). Inthe these participantswererandomizedtoeithertheexperimentalgroup with verbal suggestion (part 1: induction ofnocebo effect). Second, about itchstimuliwereinducedin99participantsbyconditioning stimuli inhealthysubjects. by positiveexpectationinductionwithrespecttoelectricalitch study, weexaminedwhethernoceboeffects onitchcanbereduced if nocebo effects can be diminished by positive expectations. In this to theexperienceofitch,however, ithasnotyetbeeninvestigated expectations ofworsening.Noceboeffects areknowntocontribute lated to the treatment mechanism,whichare induced by patients’ Background: Noceboeffects arenegativetreatmenteffects, unre 1 through Stat6-mediatedpathways. condition by suppressing itch sensation and allergic inflammation indicate thattopicalapplication with b-pineneimprovedtheskin in DRGs.Conclusionanddiscussion: The resultsofthisstudy analyses revealedthatb-pinenestrongly suppressStat6activation nulation ofBMCMCsandneurite outgrowthofDRGs.Signaling in dermis. Adding theb-pinenetocellculturessuppresseddegra cutaneous mast cells aswell as density of PGP-9.5-positive neurons that application of b-pinene significantly decreased the number of water loss,andscratchingbehavior. Histologicalanalysesrevealed transepidermal dermatitis, of severity the reduced significantly In NC/Tndmice,weobservedthattopicalapplicationwithb-pinene that b-pinenewasamajorconstituentofthe A. intermediaextracts. pathways wereassessed.Results: The componentanalysisrevealed of dorsalneuriteganglia(DRGs)aswellinvolvingsignaling derived culturedmastcells(BMCMCs)andneuriteoutgrowth inhibitory effects ofb-pineneonthedegranulationbonemarrow- Histological analysesofinvivosampleswere also carried out. The scratching behaviors, and transepidermal water loss was evaluated. conventional conditions,andparametersincludingclinicalscores, applied on the skin of NC/Tnd mice, which were maintained under gas chromatography-massspectrometry. b-pinenewastopically ses ofthe A. intermediaextractswerecarriedoutusingheadspace spontaneous atopic dermatitis model. Methods: itch sensationandexaggerationofdermatitisinNC/Tndmice,a the distilledextractsobtainedfrom A. intermedia,suppressthe investigated whetherb-pinene,amajoringredientcontainedin for a long time in the southern districts of Japan. In this study, we longs totheZingiberaceaefamily, hasbeenusedinfolkmedicine Background: Alpinia (A.)intermedia,aperennialplantthatbe 1 Yosuke Amagai ALPINIA INTERMEDIA GAGNEP EXTRACTS COMPONENT CONTAINED INDISTILLED IN NC/TNDMICEBY BETA-PINENE, THE MAJOR AMELIORATION OF ATOPIC-ITCH SENSATION OP42 shi Matsuda megen, TheNetherlands Leiden University, Leiden, Research Fellow of the Japan Society for the Promotion of Science, Results: 3 3 , Tokyo Universityof Agriculture andTechnology, Japan Akane Tanaka 1 Positive expectation induction resulted in a signifi , Tetsuyoshi Hamasaki 2 Radboud University Medical Center Nij- First, negative expectations Methods: First, negative expectations 3 2 , Yoshihiro Nomura Component analy 3 , Hiro- 2 Gray ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Medicine, Philadelphia, USA, partment ofClinical Sciences, Temple University Lewis KatzSchool of M. McGregory 1 strated antipruritic efficacy of nalfurafine hydrochloride in chronic long-term suppression ofpruritus. Moreover, recently we demon to hemodialysispatientsat5µg perdayfor52weeks,produced study showed that nalfurafine hydrochloride, orally administered in 337hemodialysispatients.In addition,ourrecentopen-label nalfurafine hydrochloride, effectively reduced intractable pruritus agonist, ĸ-receptor opioid that demonstrated study double-blind itch viatheCNS.Ourpreviousplacebo-controlled,prospective, μ-opioid system induces whereas the ĸ-opioid system suppresses the indicate findings . These and failure renal chronic to suppress pruritus in patients with systemic diseases, including opioid receptor (KOR) agonists (e.g., nalfurafine) have been found contrast, MORantagonists(e.g.,naloxoneandnaltrexone)k- In agonists. (MOR) receptor μ-opioid other and morphine with pruritus isawell-knownsideeffect inpatientstreatedforpain pruritus in the central nervous system (CNS).modulating Opioid-induced in roles pivotal play systems ĸ-opioid and μ- The 1 Kenji Takamori INDUCED ITCH AN OVERVIEW OF TREATMENT FOROPIOID- OP44 lasting treatmentforlocalized,non-histaminergic itch. months. These results suggest that BoNT/A is a potential long- One treatmentofBoNT/A reducedcowhageitchforatleastthree no effect onthermal thresholds orheat pain intensity. Conclusions: months (p=0.005)comparedtothesalinetreatment.BoNT/A had with BoNT/A at1week(p=0.0002),month=0.0001),and3 and 3months(p versus salinecontrolat1week(p=0.016),month=0.015), itch (AUC; percent change from baseline)was also decreased ( compared tothesalinecontrolat1week(p<0.0001),month intradermal injectionofBoNT/A reducedcowhageitchintensity then 1week,month,and3monthsaftertreatment.Results:The (before treatment)and at baseline test areas the on were examined heat painintensity)anditchintensityaftercowhageapplication Thermal sensoryparameters(warmthandheatthresholds with asalinecontrol(10units)injectedintothecontralateralarm. of 35healthysubjects(16malesand19females;age26.8±6.8), dermally injected in a 4x4 cm test area on the volar surface of arm Background: Botulinumtoxintype A (BoNT/A orBotox Nattkemper Leigh A. INDUCED ITCH BOTULINUM TOXIN TYPE ACOWHAGE- ON PROLONGED ANTIPRURITIC EFFECT OF OP43 Juntendo UniversityUrayasuHospital,Chiba,Japan Singapore LonLinSchoolofMedicine,Singapore (NCT02639052) Botox Methods: Inarandomized,single-blind,placebo-controlledtrial BoNT/A on cowhage, a non-histaminergic model for chronic itch. and glutamate.Objectives: To testtheitch-relievingeffect of acetylcholine and other pruritic factors, such as substance P thought to have an antipruritic effect due to the inhibition of versity GraduateSchoolofMedicine, Chiba, Miller SchoolofMedicine,Miami, Institute for Environmental and Gender Specific Medicine, Juntendo Uni- Juntendo Medicine, Specific EnvironmentalGender for and Institute Department ofDermatology, MiamiItchCenter, UniversityofMiami p <0.0001), and3months(p THE WIDE RANGEOF CLINICAL PRESENTATIONS OF ITCH 2 , R.V. Ramsey 1,2 =0.007). The peakitchintensitywaslowered , NobuakiTakahashi 1 , ® C. Stull (BoNT/A;10units; Allergan) wasintra 3 , Y.H. Chen 4 Biostatistics Unit,National University of =0.0004). The overallperceived 2 2 , Department ofDermatologyand M.J. Lavery 4 , H. Mochizuki 1 , MitsutoshiTominaga 2 Department ofDermatology, 2 , R. Valdes-Rodriguez 1 , Gil Yosipovitch 1 3 ® De- )is 2 - - 1 ,

Psychology, Justus-Liebig-UniversityGiessen,Germany logy, UniversityHospitalHeidelberg, Heidelberg, of Clinical Social Medicine, Environmental and Occupational Dermato- patients withafunctionalgraftwithouttheneedofdialysis.Met those in findings laboratory and clinical of series a and pruritus a kidney transplant and analysed possible correlations between this topicweinvestigatedpatientswhohadpreviouslyreceived pruritus disappearsafterkidneytransplantation. To readdress symptom in patients on dialysis. According to former studies Background: 1 Thomas Mettang TRANSPLANTS PRURITUS INPATIENTS WITH KIDNEY OP45 primary effector ofurticariaisthemastcell,whichreleases hista disrupt orrestrictactivities,and causesocialembarrassment. A severely affected, sincetheassociateditchingcandisturbsleep, an estimated1%worldwideprevalence. Qualityoflifeisoften weals, angioedemaorboth,lasting for6weeksorlonger. Ithas characterizedbypruritic adisease is Chronic urticaria(CU) Royal Free Hospital,London,UK Tabi Leslie URTICARIAITCH AND OP46 should beevaluatedinalarger cohort. use ofbeta-blockersdoesplayaroleinitchtransplantpatients a different patients. ofitchintransplant pathogenesis Whether the itch duringtimeondialysis intensity. There seemstobenoassociationbetweenhistoryof kidney-transplant suffer fromchronicitchalthoughtoaminor clusion: A functioning with proportionofpatients substantial beta-blockers, noneofthesepatientshadalpha-blockers.Con and haemoglobinlevels. All patientssuffering fromitchwereon correlated withtransplant-function(CKD-epi),serum-creatinine while ondialysis)andaftertransplantation. The intensityofitch there wasnoassociationbetweenthehistoryofitchbefore(ie. lence ofpruritusandthetimesincetransplantation. Additionally, neck (4/11). Noassociationcouldbefoundbetweenthepreva itch appeared on the extremities (9 of 11), the back (3 of 11) and 2 (range0-7)onanumericratingscalefrom0to10.Mostoften The medianoftheintensityitchdayinterviewwas of theremaining66(16.7%)reportedtosuffer fromchronicitch. from a dermatosis and were excluded from the analysis. 11 pat. to fill in the questionnaire. 8 of these 74 patients reported to suffer patients onroutinefollow-upafterkidney-transplantationagreed calculated using appropriate statistical tools. as wellcurrentmedicationwererecorded.Correlations and laboratory parameters routinely and periodically obtained complete a questionnaire regarding pruritus. Additionally, clinical 2014 whosefollow-uptookplaceinasinglecentrewereaskedto hods: Patientswhohadreceivedakidneytransplantfrom1976to and overviewontreatmentofopioid-induceditch. like dermatitisinmice.Intheplenarysession,Iprovideanupdate itch-related scratchingbehaviorofimiquimod-inducedpsoriasis- most recentstudyshowedthatMORandKORwereinvolvedin (e.g. naltrexone) relieved pruritus in atopic dermatitis patients. Our antagonist receptor μ-opioid of application topical example, For peripheral opioidsystemsmayalsoplayimportantrolesinpruritus. itch-selective neuronsthatsuppressitchsensation.Meanwhile, k-opioid agonist dynorphin acting as KOR-expressing spinal neurons, spinalinhibitoryinterneurons,produceanendogenous double-blind study. Experimentally, itisacceptedthatB5-I disease patients with intractable pruritus in a randomized, Department ofNephrology, DKDHeliosClinic, Wiesbaden, Uremic pruritusisafrequentandoftentormenting 1 , ElkeWeisshaar and aftertransplantation,suggesting 2 , Jörg Kupfer Lecture abstracts Acta DermVenereol 2017 Results: 74 of 132 3 Institut forMedical 3 2 Department 1021 - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta veau AP (30.9vs17.2%,p=0.03). The artery/veinrateofthrombotic were more thrombotic events during the follow-up in group with there contrast, In found. was groups between difference ficant of thrombotic events (arterial or venous) at diagnosis, no signi (2.2 vs1.1treatmentlines,p=0.005).Concerningtheoccurrence thrombocythemic, ET with AP weremoreproliferative(morepolycythemicbutless perviscosity, constitutionalsymptomsandsplenomegaly(p Furthermore, theypresentedmoresymptomsaserythrocytosis,hy median ageatdiagnosiswasyounger(51.6vs63.8yr, p<0.0001). (10.6%) ofour396patientssuffered from AP. Interestingly, their myéloprolifératives database,OBENE,NCT02897297).So,42 in ourhospitalwasused(ObservatoireBrestoisdesNEoplasies this, thebiologicalandclinicaldataof396ET patientsfollowed impact of the presence of AP in ET patients for such a risk. For sis. So,itseemedparticularlyinterestingtoanalyzetheclinical of AP inPV wasassociatedwithalowerriskofarterialthrombo ristics fromthoseobservedinPV patients.In2008,thepresence recently thatitalsopresentinET withdifferent clinicalcharacte water contact,isatypicalsymptomofPV. How­ most recurrent complications. (AP),induced by boses and phenotypic evolutions (leukemia, myelofibrosis) are the myeloproliferative neoplasmsinwhicharterialorvenousthrom Polycythemia vera (PV) and essential thrombocythemia (ET) are 3 1 Christelle Le Gall-Ianotto MORBIDITY DURING THE FOLLOW-UP AND AHIGH PROFILE ATDIAGNOSIS THE BIOLOGICALCLINICAL AND MORE AGRESSIVE AQUAGENIC PRURITUS: AN ENTITY WITH ESSENTIAL THROMBOCYTHEMIA WITH OP47 as wellotheranti-IgEandanti-IL-1biologics. Potential futuretreatmentsforCUincludeH4receptorantagonists, acute exacerbations,howeverlong-termuseisnotrecommended. of systemiccorticosteroidsmaybeuseasarescuetreatmentfor atment, followedbyciclosporinormontelukast.Shortcourses anti-IgE antibody, omalizumab,should bethenextlineoftre The Europeanguidelinesnowrecommendthatthemonoclonal are available for patients with CU refractory to antihistamines. may beincreasedbyupfourfold. A numberofadd-ontreatments dosages and treatment, first-line mainstay the are antihistamines for managingthedisease. All recommendthatsecondgeneration nes forCUallhavesomevariationintheirstep-wiseprocedures of qualitylifeimpairment. The European,UKandUSguideli Severity Score (ISS), and the CU-2QoL, a disease-specific measure CU include the Urticaria Activity Scoreover 7 days (UAS7), Itch various cutaneous diseases. Assessment tools for the severity of to addition in disease, autoinflammatory and urticarial confirmed with provocation tests. Differential diagnosis includes blood teststhatmayexcludeanunderlyingdisease.CIndUcanbe nosis forCSUismadebytakingathoroughhistory, aswell where symptomsareinducedbyademonstrablestimulus.Diag curs withoutprovocation,and chronic inducibleurticaria (CIndU), Chronic spontaneous urticaria (CSU), which is endogenous and oc The latest European guidelines categorise CUinto two subtypes; which outline the classification, diagnosis and management of CU. guidelines several are There itch. causes that mechanism reflex H2 receptors,withH1receptorstimulationleadingtoaneuronal or non-immunological.HistamineactspredominantlyonH1and mine whenactivatedbystimulithatmaybeeitherimmunological 1022 University HospitalofBrest, Brest, France Brest, Laboratory of Hematology,Laboratory and Laboratory ofInteractionsNeurons-Epitheliums, UniversityofBrest, 3 , EricLippert 2 Department ofHematology, HospitalofCornouaille,QUimper, 9 th WorldCongressofItch 3 <0.04 each) and were more difficult to treat to difficult more were and each) p<0.04 , Laurent Misery 1 , Ronan Le Calloch 4 Department ofClinicval Hematology, 1 , Jean-ChristopheIanotto ever, weshowed 2 , Aurélie Chau- <0.01). <0.01). 4 ------score andmaximum(r=0.39,p<0,01)aswellaveragepruritus CLASI Activity between observed was correlation Significant as therestofface(n=19;31.1%)andarms n=15; 24.6%). Dermatology and Allergology, Tenon Hospital,Paris,France, cine, Section ofDermatology, University ofFlorence, Italy, partment ofDermatology, ShimadaMunicipal Hospital, Shimada,Japan, ment ofDermatology, Wakayama Medical University, Japan, of Medical Sciences, University of Fukui, Japan, of Dermatology, PoznanUniversity of Medical Sciences, Poland, 1 Dominik Samotij CUTANEOUS LUPUSERYTHEMATOSUS TICS OF PRURITUSINPATIENTS WITH PREVALENCE AND CLINICAL CHARACTERIS­ OP48 patients forabettermanagementandfollow-up. in ET patients at diagnosis should permit to better identify these evolution). The systematic determination of the presence of AP patients withhighriskofmorbidity(thromboses,phenotypic survival. So,thepresenceof AP inpatientswithET characterizes ET without AP. Despitethat,these patientshaveahigheroverall had alsohigherriskofthrombosisandphenotypicevolutionthan AP weremoreproliferative,symptomaticatdiagnosisbut a PV symptom, but is also present in ET. Furthermore, ET with a longestfollow-up(12.1vs7.7years,p=0.002). AP isnotonly AP havealowerrateofdeath(11.9 vs32.5%,p=0.006)inspiteof cerning theoverallsurvivalofpatients,wenotedthatET with pruritus affectedpruritus (n scalp the differences were not statistically significant. Most commonly 5.5±2.4 points,beingthemost severe ingeneralized ACLE, but pruritus severity measured with Numeric Rating Scale (NRS)was experienced byonly8(13.1%)ofCLEpatients. The maximum by 46(75.4%)patients.Incontrast,painwithinskinlesionswas while meandamagewas3.3±4.2points.Pruritusreported ACLE andCCLE.MeanactivityaccordingtoCLASIwas6.0±5.6 (CCLE). One(1.6%)patientpresentedclinicalfeaturesofboth (22.9%) subacuteCLE(SCLE)and43(70.5%)hadchronic nary analysis. Three (4.9%)patientshadacuteCLE(ACLE),14 completed and verified questionnaires were included for prelimi by Ethic Committee of Wroclaw Medical University. A total of 61 were assessed with SELENA-SLEDAI. The study was approved severity was assessed with CLASI, while systemic symptoms treatment modalitiesusedbypatientstoalleviateit.Skinlesion as well as psyche on influence experiences, sity,accompanying well asvariousclinicalaspectsofpruritus,includingitsinten assessing sociodemographicdata,clinicalsubtypesofCLE,as in patientswithCLE. The studywasbasedonthequestionnaire to evaluatetheprevalenceandclinicalcharacteristicsofpruritus multicenter, prospective,cross-sectionalstudywasundertaken (CLE)arevery limited. lupuserythematosus from cutaneous This of various severity. However, data on pruritus in patients suffering Various inflammatoryskindiseasesareaccompaniedbypruritus 8 rent Misery tology, UniversityHospitalofBrest, France School ofMedicine, UniversityofPennsylvania,Philadelphia, USA, myelofibrosis) against 13.8% in the other group (p 1/3 ofET with AP hadphenotypicevolutions(PV orsecondary events was also different (50/50 vs 2/3:1/3, Fukumi Furukawa ical University, Poland, lege, Pakistan, Werth Chasset hammad Rafiqul Mowla Department ofDermatology, Venereology and Allergology, Wroclaw Med- Department of Dermatology and Venereology, Chittagong Medical Col- 6 , Adam Reich 3 , lkada Dańczak-Pazdrowska Aleksandra 10 , 9 Zygmunt Adamski Department ofDermatology, SchoolofMedicine, Faculty 1 , 5 , 1 Justyna Szczęch Justyna Carolyn Kushner 2 Department ofSurgery andTranslational Medi- 8 , =22; 47.8%), nose (n =22; 47.8%),nose Aminul Islam 4 , Jacek C. Szepietowski 1 , Emiliano Antiga 6 8 , , Minoru Hasegawa Hideo Hashizume p 10 4 <0.05). Furthermore, <0.05). Furthermore, , Department of Derma- =16, 34.8%) as well well =16, 34.8%)as din Polańska Adriana =0.0007). Con 3 Department of 4 2 Department , 1 , 6 François Perelman Victoria 5 Depart- 9 7 , , Lau- Mo- 7 De- 4 - - - , Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV nek, JacekC.Szepietowski kowski examination wasreportedamong 41.7%ofHSpatients,whereas examined. mon factorsresponsibleforits aggravationoralleviationwere Moreover, various clinical features of pruritus and the most com tionnaire. DLQIwasalsoimplemented toassesstheQoL issues. scale (VAS), numericrating scale(NRS)anda4-itemItchQues Pruritus andpainintensitywereevaluatedwithvisualanalogue purativa SeverityIndex)andHurleyI/II/IIIstaging,respectively. HSS (HidradenitisSuppurativaScore),HSSISup as 38.0±36.5points,9.2±4.6pointsand42/47/14accordingto mean ageof35.6±13.2years. The diseaseseveritywasassessed consisted of103(50females,53males)HSpatientswiththe pain amongHSpatients.MaterialandMethods: The studygroup This studywasundertakentoevaluatethepruritusandadditonally as animportant suppurativa (HS)feature.Objectives: Background: The growing bodyofresearch has indicated pruritus cal University, Wroclaw, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Matusiak, Lukasz HIDRADENITIS SUPPURATIVA PATIENTS CLINICAL CHARACTERISTICSOF PRURITUSIN OP50 with HGBandHCT servingasmajorcontributors ofitsintensity. seems tobeanentity ofneglected importance among PV sufferers 3 patientswithoutanyclinicalimprovement.Conclusions:AP severity werefound. Antipruritic treatmentwasreceivedonlyby hemoglobin,hematocritandpruritus negative correlationsbetween disturbances, wereobservedamong16.7% AP patients.Ofnote, third of patientswith AP avoided any contact withwater. Sleep points (VAS) and 6.0±2.9 points (4-item Itch Questionnaire). One diagnosis (52.4%). The mean AP intensity was assessed as 4.8±1.9 noticedinthemajorityofsufferers was and itsonset beforethePV in 41.1%individuals. The mean durationof AP was6.6±8.6years underwent alsobasiclaboratorytests.Results: AP was observed for itsaggravationoralleviationwereexamined.Participants quality, descriptors)andthemostcommonfactors responsible Moreover, variousclinical features of AP (including localization, (VAS), verbal rating scale (VRS)and a4-item Itch Questionnaire. lected. Pruritus intensity was evaluated with visual analogue scale on disease history, PV statusand treatment modalities were col PV with the mean age of66.9±12.7 years. Demographic data, data study group consisted of 102 patients with molecularly confirmed associations withlaboratoryresults.MaterialandMethods:The was undertakentoanalyzeclinicalcharacteristicsof AP andits ristic andmanagementstillremainsscarce.Objectives: This study than threedecadesago,theknowledgeaboutitsclinicalcharacte features of polycythemia vera (PV). Despite it was described more Background: Aquagenic pruritus(AP)is one of themain clinical 1 Edyta Lelonek PRURITUS INPOLYCYTHEMIA VERA CLINICAL CHARACTERISTICSOF AQUAGENIC OP49 the efficacyofvarioustreatmentmodalities. needed tobettercharacterizeitsclinicalcharacteristicsandverify overlooked symptomsinpatientswithCLE.Furtherstudiesare we mayconcludethatpruritusisrelativelyfrequent,butoften symptoms and reported pain oritch intensity. Based onourresults pain. No relationship was also foundbetweenseverityofsystemic intensity (r=0.32, p row Transplantation, Wroclaw MedicalUniversity, Wroclaw, Poland Department andClinicofHematology, BloodNeoplasmsandBoneMar Department andClinicofDermatology, Venereology and Allergology, and 2 , JacekC.Szepietowski Results: The prurituswithinlastsevendaysbefore 1 , Łukasz Matusiak Łukasz =0.02). Such relationship was not observed for utn Szczęch, Justyna 1 1 , Tomasz Wróbel Karolina Kaaz,EdytaLelo- 2 , Jacek Kwiat------associated withthediseaseadverselyaffecting thequalityoflife. pruritus of mild-to-moderate intensity is not uncommon symptom smell. consecutively outpacingexudation,pruritus,appearanceand The painwasreportedasthemosttroublesomesymptomofHS intensity were increased sweating, heat and physical activity. or tickling(18.6%). The mostcommonfactorsexacerbatingitch patients describedtheiritchasburning(46.5%),stinging(25.6%) andadditionallywithdiseaseseverity.with DLQI The majorityof DLQI. The pain intensity correlated negatively with QoL assessed with significantly correlated intensity pruritus the Nonetheless, (p=0.002), evenmoreimportantthandiseaseseverity=0.04). pain inthisregard. The painpresencewasacrucialcontributor on QoL assessedwithDLQI,nordiditshowinteractionthe anogenital area. The presenceofpruritusneitherhadanimpact quite equally between armpits, inguinals, abdomen, chest and of pruritic lesions). With except for buttocks, pain was distributed buttocks area (90% of pruritic lesions) and armpits (83% and 87% 7.5±2.5 points(NRS School, UniversityofManchester, Manchester, UK in relation to that model; and (3) cognitive interviewing to ensure in relationtothatmodel;and(3) cognitiveinterviewingtoensure of aconceptualmodel;(2)generation ofcontentintermsitems in which a PRO is created, three steps are important: (1) definition content validationarelessprominent. Inthecontentvalidityphase the psychometrictestingofPROs, thosethatadequatelyreporton of reports detailed give often studies PRO coefficient. While tion the measurementsovertime)bycalculatinganintra-classcorrela metric phase,forinstancetestingtest-retestreliability(stabilityof we thinkaboutPROvalidation,oftenthepsycho interpretability orcompletiontimealsoneedtobeassessed. When validity. Aspects offeasibility suchaspatientcomprehensibility, rement error, hypothesistesting,criterionvalidity, cross-cultural responsiveness, internalconsistency, structuralvalidity, measu group, theseare:contentvalidityincludingfacevalidity, reliability, Standards fortheselectionofhealthMeasurementInstruments) the consensus-based taxonomy ofthe COSMIN(COnsensus-based all measurementpropertiesofthePROinterest. According to chometric testingphase.Inthisprocess,itisimportanttoconsider a multi-stepprocess,involvingcontentvalidityphaseandpsy validation isdoneinarobustway. The developmentofaPROis stakeholders. This willonly beachievedifthedevelopmentand valid andrelevantforpatients,healthcareprofessionalsother tion. The measurementsgenerated byPROmeasuresneedtobe (HRQOL) suchastheItchyQoL,symptomsortreatmentsatisfac PROs include instruments that measure health-related quality of life research and-morerecentlyinroutinehealthcare.Examplesof healthservices observational inclinicalresearch, assessment ment ofPROshasbecomeanimportantcomponentoutcomes without interpretationofaclinicianoranyoneelse. The measure status ofapatient’s healththatcomesdirectlyfromthepatient, the of report any as defined Ais (PRO) outcome patient-reported 1 Christian Apfelbacher DUCTION PATIENT-REPORTED OUTCOMES: AN INTRO­ OP51 (for VAS was assessedas5.0±2.1points,5.5±2.3 and4.6±1.9points pain was observed in 77.5% individuals. The pruritusseverity The painintensitywasevaluatedas7.3±2.4points(VAS University ofRegensburg, Regensburg, Germany, PATIENTS’ PERSPECTIVES AND PATIENT Medical Sociology, Institute of Epidemiology and Preventive Medicine, Conclusions: InpatientswithHS,inadditiontopain,the max , NRS REPORTED OUTCOMES max and4-itemItchQuestionnaire,respectively). max 1 , PaulineNelson ). Prurituswasobservedpredominantlyin 2 Lecture abstracts Acta DermVenereol 2017 2 Manchester Business max ) and 1023 ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta but alsoscratchinginitchinducingsituations. areabletoreducenotonlyitchrelatedcognitions, awareness with certain mindfulness techniques aiming to especially increase acting our point of view, it would therefore worth to investigate whether in patientswithdifferent skinconditionsinapreviousstudy. In also showedthestrongestcorrelationswithpsychologicalburden with itch catastrophizing. It is striking that this facet of mindfulness whereby acting withawarenessshowedthestrongestcorrelations are negativelyrelatedtoitchcatastrophizinginpatientswith AD, mindfulness of facets different that show to first the was study many, Thompson ment ofDermatologyand Allergology, UniversityClinicGießen,Giessen, Stefanie Meeuwis SUGGESTIONS ONITCH PLACEBO? EFFECTSOF OPEN-LABEL VERBAL KNOW THATSUBJECTS THEYRECEIVE A EFFECTS WORK WHEN PLACEBO DO OP53 with awareness“ [F (2/76) = 24.789; of thevarianceitchcatastrophizingwasexplainedby„acting and itchintensityduringthelasttwoweeks,anadditional11.1% showed thataftercontrollingforage,gender, illnessdurination and non-reactivity:r=–0.230;p=0.018]. The regressionanalysis and non-judgemental orientation: r=–0.196;p strophizing [acting with awareness: r=–0.368; p non-reactivity“ significantly negatively correlated with itch cata cepting andnon-judgementalorientation“„decentering revealed thatthemindfulnessscales„actingwithawareness“,„ac a visual analogue scale (VAS 0–10).Results: Correlation analyses the lasttwoweekspriortostayatclinicwasmeasuredby Borkum, Germany. Inaddition,the averageitchintensityduring (ICQ) during the first week of their stay at a rehabilitation clinic on ness Experiences(CHIME)andtheItchCognitionQuestionnaire Mindful of Inventory Comprehensive the in filled years) 45±13 time. atopic dermatitis (AD), is investigated with this study for the first catastrophizing inpatientswiththechronicitchyskindisease naturally occuringlevelsofmindfulnessarealsorelatedtoitch and skinshameinpatientswithdifferent skindiseases. Whether, been showntoberelatedanxiety, depression,qualityoflife Moreover, recently, naturallyoccuringlevels of mindfulnesshave on theskin,qualityoflifeandstressinpatientswithpsoriasis. fulness interventionshavebeenshowntopositiveeffects leads people to react consciously instead of automatically. Mind tion tothepresentmomentonpurposeandwithoutjudging, atten paying as defined Mindfulness, Theoretical background: 4 1 Christina Schut ATOPIC DERMATITIS CROSS-SECTIONAL STUDY INPATIENTS WITH CATASTROPHIZING: FIRST RESULTS OF A GO ALONG WITH LOW LEVELSOF ITCH OFWITH AWARENESS ACTING LEVELS HIGH OP52 ciplinary expertisetoconducteachphasewell. of quantitativeandqualitativeresearchtherequisitemultidis requires amixed-methodsapproachwithappropriateapplication It alone. psychometrics to restricted not and complex is fields of PROmeasuresforpatientswithchronicitchasinotherclinical feasibility ofthemeasure. Thus, thedevelopmentandvalidation 1024 Antoinette vanLaarhoven Germany Department ofDermatology, Rehabilitation CenterBorkumRiff, Borkum, Institute of Medical Psychology, Justus-Liebig-University, Gießen, Ger Methods: 109ND-patients(44male,65female;meanage: 2 Department of Psychology, University of Sheffield, UK, Sheffield, of University Psychology, of Department 9 th 2 WorldCongressofItch , UweGieler 1 , 1 Kerry Montgomery , Henriët van Middendorp 3 , ChristophZick 1 , JanDeHouwer p≤0.001]. 2 , 4 Kjell Lüßmann , Jörg Kupfer 2 , Andrea Evers 1 =0.044; decentering =0.044; decentering , Judy Veldhuijzen ≤0.001; accepting Discussion: This 1 1 , Andrew 3 1 Depart- 1 ------, rie Mengeaud knowledge onhowtooptimizetreatmenteffects inchronicitch. identifying the role of expectations in itch could provide new explicit explanationsoftheroleexpectationsinitch.Further suggestions used in the current study, for example by using more in itch.Futureresearchmightfocusonstrengtheningtheverbal efficacy placebo label open for support offer results These itch. expected itch was significantly associated with lower self-reported within the experimental group only, lower post-verbal suggestion itch expectationsinthisstudy, butnot induceditch. Additionally, were given.Open-labelverbalsuggestionsfoundtoaffect verbal suggestions),whereasin the controlgroup, no suggestions positive open-label (i.e. itch influence could expectations how that thetestwouldelicitlittleitchandreceivedinformationon iontophoresis. Intheexperimentalgroup,participantsweretold experimentally duringasinglelaboratorysessionbyhistamine evoked to eitheranexperimentaloracontrolgroup.Itchwas histamine test.Healthyvolunteers(n avalidateditch-inducing reduceitchfollowing would suggestions suggestions on itch. It wasexpectedthatopen-labelpositiveverbal conducted toinvestigatetheeffects ofopen-labelpositiveverbal substance isinert(open-labelplacebo). An experimentalstudywas that placeboeffects canoccurevenwhenitisknownthatagiven agrowingbodyofliteraturethatsuggests placebo/nocebo), thereis participation thattheyreceivedaninertsubstance(closed-label and noceboeffects haveonlyinformedparticipantsfollowing such as itch. Although most experimental studies on placebo symptoms subjective influence to shown been have suggestions, Negative andpositiveoutcomeexpectancies,inducedbyverbal 1 through structuredliteraturereview andfocusgroups. of CP severity and its impact on patients’ HRQoL has been achieved sion: A comprehensive andclinicallysoundconceptualframework Saturation ofconceptswasreached afterthesecondFG.Discus sub-domains ofinterestwereconsistent acrossallskinconditions. attributed toothers;(8)socialrelations; and(9)timespent. These and cognitions;(5)concentration;(6)dailyactivities;(7)cognitions fatigue; (2)copingandanticipation;(3)sexuallife;(4)emotions domains ofinterestforHRQoL wereorganized into:(1)sleepand and scratchingresponse),(ii)duration,iiiextension.Sub- CP wasreportedintermsof:(i France wereinterviewedthrough3FGsessions. The severityof Results: Nineteen participants from one dermatological center in analyzed usingqualitativecontentanalyses(inductiveapproach). were textuallyreportedintotranscript,whichthematically elderly people)duringfocusgroups(FG).Participants’ verbatim atopic dermatitis,scalpseborrheicurticariaornone,in tients suffering fromCP (underlyingskincondition were psoriasis, review. Itwasrevisedbasedonqualitativedatageneratedbypa conceptual frameworkwasdevelopedafterasystematicliterature health-related qualityoflife(HRQoL).Methods:Apreliminary nic Pruritus(CP)perceivetheseverityofCP anditsimpacton Objectives: To understandhowpatientssuffering fromChro 1 Jennifer Theunis HEALTH-RELATED QUALITY OF LIFE OF CHRONICPRURITUS AND ITSIMPACT ON PATIENTS’ PERCEPTIONOF THE SEVERITY A QUALITATIVE STUDY TO UNDERSTAND OP54 logy, GhentUniversity, Belgium France Netherlands, Health, Medical and Neuropsychology unit,LeidenUniversity, Leiden,The liano Orri Faculty ofSocialandBehaviouralSciences,InstitutePsychology, Pierre Fabre, 3 , 2 Jesus Cuervo Department ofExperimental Clinical and HealthPsycho- 1 2 , LaurentMisery LASER Analytica, 1 , Clementine Nordon 2 , Gilles Berdeaux 4 ) intensity of itch (sensation type ) intensityofitch(sensationtype 3 CESP, INSERM1018, 2 , Ylana Chalem =92) wererandomized 1 , Marie Auges 4 1 CHU Brest,CHU , Massimi- 1 , Vale- - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV sity ofMünster, Münster, Germany a restrictionofqualitylife. There arecurrentlynouniformpro Pruritus isafrequentsymptom of manydermatosesandleadsto 1 Claudia Zeidler LIFE INPRURITICDERMATOSES INEUROPE ITCH INTENSITY ITCH-IMPAIRED QUALITY OF (PRUNET): VALIDATION OF INSTRUMENTSFOR OF SEVERITY AND BURDENOF PRURITUS EUROPEAN EADV NETWORKON ASSESSMENT OP56 for itsevaluationindependentofotherdiseasemeasures. Thishigh lights theunmetmedicalneedinpruritustreatmentand most patients. for partial remains efficacy treatment in allgroupsandwasindependentofPASI. Systemic andtopical Measurement ofitchby VAS wasanimportant predictorofDLQI psoriasis whereithadlessimpactonsleepthantheothergroups. symptom. There was significantly less severe itch in patients with Conclusion: Inthispatientcohortitchwasfoundtobeachronic overall. treatment efficacious most the be to reported was erapy partially effective (71.67% and72.73%respectively).Phototh Most patient’s felt that topical and systemic treatments were only iety. This wasproportionallygreatestinpatientswithPN(50%). 34.7% ofpatientshadaborderlineorabnormalHADSforanx highest inpatientswithPUOandlowestpsoriasis. abnormal sleeppatters(PSQIscore>than5). The meanPSQIwas B=1.881, coefficient (regression PASI of independent of DLQI predictor significant a remained it Importantly HADS. and PSQI, DLQI, of predictor significant two groups(83.3%vs47.2%,p the between itch severe very and severe in difference significant with PN(7.50)andlowestinpatientspsoriasis(5.89)a indicating moderatetosevereitch. This wasgreatestinpatients the commonest exacerbating factors. The mean VAS was 6.69 ted bedtimeasthemostbothersometime.Heatandstresswere reported “always” feeling itchy. 36.49%, the largest group repor ted. Itchwasasymptomformorethan5yearsin62.67%.45.9% PSQI andHADSwerealsoused.Results:73patientsrecrui questionnaire incorporatingtheitch VAS were recruitedfromthedermatologyOPDofSVUH. A pruritus (AD), psoriasis(PSO)andpruritusofundeterminedorigin(PUO) tients withadiagnosisofprurigonodularis(PN),atopicdermatitis ate the efficacy of treatments as reported by patients. impact ofitchonqualitylife,sleepandmentalhealth.3)Evalu of patientsattendingthedermatologydepartment.2)Evaluate sures. patients, evaluatingitchindependentlyandwithobjectivemea options onthehorizonitisimportanttoclinicallydifferentiate newtreatment With life. of quality on patient’s impact nificant Itch isthemostcommonsymptomindermatologyhavingasig 4 1 McDonald Ian PATIENTS WITH CHRONICPRURITUS AND TREATMENT OUTCOMESIN A COHORT OF ASSOCIATEDCHARACTERISTICS, MORBIDITY NAIRE BASEDEVALUATION OF CLINICAL THE BURDENOF CHRONICITCH-A QUESTION­ OP55 logy, FacultyofMedicine,UniversityDebrecen, Debrecen, Hungary, hoff Sabine Steinke University Hospital of Münster, Weil CornellUniversityWatar, Doha,Qatar Dublin, Ireland, Department ofDermatology, Competence Center forChronic Pruritus, Dept ofDermatology,Medical Corporation,QatarUniversity, Hamad UCD CharlesInstitute of Dermatology, StVincents University Hospital, 1,4 Aims: 1) Characterize clinical features of itch in a cohort 1) Characterizeclinicalfeaturesofitchinacohort 1 2 1 , MichaelStorck Department ofDermatologyand , 1 Imre Szabó Lőrinc , Philipp Bruland 2 Institute of Medical Informatics, Univer 2 , MartinDugas <0.05). VAS wasfoundtobea p <0.05). 77.73% of patients had <0.05). 77.73%ofpatientshad 2 2 , , Attila Szöllősi Claudia Riepe was developed. DLQI, was developed.DLQI, 3 Department ofPhysio- 2 , SonjaStänder 3 , 1 Methods: Pa , Martin Stein Inaki Soto 1 2 ------, drugs targeting alpha2 and alpha3GABA targets underlyingtheantipruriticeffect. Ourresultsindicatethat alpha3GABA and alpha2 of targeting pharmacological specific that found we ratory ofGeneticNeuropharmacology, McLeanHospital, sensitized tohousedustmites. Transsynaptic circuittracing,im chronic oxazolone-induced itch inmice,andchronic in dogs Department, Vetsuisse Faculty, Switzerland order tobettercompareclinicaldata. in clinicaltrialstoestablishurgently needednewtherapeuticsin to improvethecareofpatientswithitchydermatoses,butalso harmonization is given. This is not only important in daily routine a tools, specific itch of validation By involved. physicians and validity. The acceptanceofinstrumentswashighamongpatients an excellent reproducibility, a good concurrentandconvergent countries. All questionnairesshowedanexcessiveconsistence, Following theCOSMINchecklist,weanalyzeddatafromall Sézary syndromeandpruritus>3ontheNRSwereincluded. nodularis, psoriasisvulgaris,lichenplanusormycosisfungoides/ total of 552 (> 50/center) patients with , prurigo Switzerland, Spain,France, Turkey, RussiaandItalyfor4weeks. A place inadermatologicalcollectiveGermany, Poland, Austria, languages andweredigitizedfortabletapplication. Validation took in patientswithchronicpruritus),weretranslatedintonational 5PLQ (bothtoolsformeasuringtheimpairmentofqualitylife numeric ratingscaleandverbalscale),theItchyQoL and questionnaires, itch intensity scales (including visual analog scale, lected forthevalidationstudyusingaDelphiprocess. The chosen se and evaluated were instruments pruritus-specific conference, which comprises31expertsfrom15countries.Inaconsensus patients’ lifewithinEurope.ForthisreasonPruNetwasfounded, cedures formeasuringthesymptomitselfanditsconsequencesin spinal dorsal hornneurons to noxious stimuli, but little is known Inactivation ofdescendingpathways enhancedresponsesof 1 Earl Carstens TRANSMISSION COLD BLOCKONSPINAL ITCH AND PAIN OPPOSING EFFECTSOF CERVICAL SPINAL OP58 alpha2andalpha3GABA that spinal suggest experiments electrophysiological and munofluorescence bition. Using a battery of GABA dorsal horn,whichuseGABA and/orglycineforsynapticinhi underthetightcontrolbyinhibitorycircuitsofspinalis different groups has demonstrated that the relay of itch signals respond toclassicalantipruriticcompounds.Previousworkby itch is in most cases histamine-independent and does as such not Chronic itchaffects about10%ofthegeneralpopulation.Chronic 1 William T. Ralvenius CONTROLLING ITCH SPINAL GABA-A RECEPTOR SUBTYPES OP57 is aparticularlydifficulttotreatcondition. to alleviateitch,includingnon-histaminergic chronicitch,which alpha3GABA histaminergic itch in mice. Systemic treatment with an alpha2/ tina Pagani Miami, USA M. Nagamine Claude Favrot Neurobiology, Physiology & Behavior, UCDavis,CA, Institute of Pharmacology and Toxicology, University of Zürich, 1 , 1 A A Dietmar Benke 1 3 , receptorselectivemodulatoralleviatedacuteand receptorsreducesacutehistaminergic andnon- , HannsUlrichZeilhofer Mirela IodiCarstens ITCH AND PAINITCH AND 1 , Elena Neumann 1 , Hendrik Wildner A receptor point mutated mice, A receptors as likely molecular receptorsaslikelymolecular 1 , T. Akiyama 1 Lecture abstracts A , 1 Acta DermVenereol 2017 receptors are well-suited receptors are well-suited Mario A.Acuña 2 1 Dermatology, Univ , Uwe Rudolph 2 , A. Davoodi 3 Dermatology 1 , 2 Labo- Mar 1025 1 2 - - - - , , Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta either VPM orPoT. 3) pruriceptivethalamicneurons weremostfrequentlylocatedin thalamic neuronswerealsoactivated bynociceptivestimuli;and tested pruritogens;2)theoverwhelming majorityofpruriceptive the cheekwerealsoactivatedby injectionofoneormorethe thalamic neuronsthatresponded tomechanicalstimulationof results indicatethat1)surprisingly, morethanthree-fourthsof 22% bytwopruritogens,19%threeand11% byallfour. These cent ofexaminedneuronswereactivatedbyasinglepruritogen, 49% bybetaalanine,and31%chloroquine. Twenty-four per neurons were activated by injection of histamine, 52% by 5-HT, tivated by pruriceptive stimuli. Eighty-six percent of pruriceptive that respondedonlyto innocuous mechanical stimuli were ac noxious mechanical stimuli (WDR). A small number of neurons mechanical stimuli(HT),39%wereactivatedbyinnocuousand 44% ofpruriceptiveneuronswereactivatedonlybynoxious smaller fractionsinotherposteriorthalamicnuclei.Morethan nucleus (VPM),40%inposteriortriangular(PoT)and pruriceptive neuronswererecordedintheventralposteriormedial by atleastonepruriceptivestimulus.Forty-threepercentofsuch mined. Seventy-eightpercentofthalamicneuronswereactivated (pinching of the skin and injection of capsaicin) were also exa determined. Response by these neurons to nociceptive stimuli serotonin (5-HT),chloroquine,betaalanineandhistaminewere to pruriceptivestimulithatincludedintradermalinjectionsof mechanical stimulationofthecheek.Responsestheseneurons responses ofmorethan50thalamicneuronsinratsactivatedby been examinedtoitch-producingstimuli. We characterizedthe med inwhichtheresponsesofindividualthalamicneuronshave information inthebrain.Indeed,nostudieshavebeenperfor Comparatively littleisknownaboutprocessingofpruriceptive Department ofNeuroscience, UniversityofMinnesota,USA nald Simone Glenn Giesler, THE RAT PRURICEPTIVE AND NOCICEPTIVESTIMULI IN TOUNITS SINGLE THALAMIC RESPONSES OP59 facilitatory modulation. pruriceptive transmissionisunderanopposing,tonicdescending is undertonicdescendinginhibitorymodulation,whilespinal These resultsindicate that spinalchemonociceptivetransmission pared to control responses in theabsence of cold block (n chloroquine-evoked activityduring cold block was lowercom for dorsalhornunitresponsestochloroquine(n A similar but weaker depressant effect of cold block was observed histamine-evoked responsesintheabsenceofcoldblock(n following cold block was significantly lower compared to control firing. in decrease starting 1minafteridinjectionofhistaminecausedamarked of coldblock(n same timeperiodofcontrolresponsesto AITC intheabsence the to compared greater significantly was block cold during of coldblockbeginning1minafter AITC application. Activity period 1-min the during firing in increase significant further a 18 unaffected. during coldblock,while6units’ responseswerereducedand enhanced significantly were heat noxious to responses units’ block hadnoeffect onmechanically-evokedresponses. wide dynamicrange-type,54%nociceptive-specific). in pentobarbital-anesthetizedmice. unit recordings were made from superficial dorsal horn neurons of dorsalhornneuronstoitch-andpain-evokingstimuli,single- sion. regarding tonicdescendingmodulationofspinalitchtransmis 1026 To studyeffects ofcervicalspinalcoldblockonresponses 9 th WorldCongressofItch Brett Lipshetz, Hai Truong, Sergey Khasabov, 26 unitsrespondedto mustard oil(AITC),with =39). The histamine-evokedresponseduringand Id histamineexcited17units. 64 unitsweretested(46% =26), forwhich Cold block =25). =57). Cold Ten Ten Do------

four chronicpainconditions. to shamacupuncturecontrolsandtheusualcareinall and shoulder pain. The result reflects that acupuncture was superior chronic pain:backandneckpain,osteoarthritis,headache, et altoevaluatetheeffectiveness of acupunctureforfourtypesof individual patientdatameta-analysiswasconductedby Andrew an practice, acupuncture clinical daily the reflect that designs of acupuncturetreatmentleadtomanychallengesintheresearch response totheneedleinsertionandnatureofholisticcharacter acupuncture for pain conditions, although nonspecific physiologic have increasinglyproducedrobustevidenceoftheeffectiveness of for painconditionsinEBMHigh-qualityRCTs andmeta-analysis solve. Challengesandfuturedirectionsofacupunctureresearch are allimportanttasksforacupunctureresearcherstoaddressand effectsdiscovery ofphysiological ofacupuncture.inbasicscience turists, adequateoutcomemeasuresintheclinicaltrials,and sham control,involvementofskilledandexperiencedacupunc ofanadequate example,thedesign infutureresearch.For forward field the move to help would and designs research of challenges torecognizethelimitationsand are invaluableforresearchers damage. The previousexperienceofacupunctureresearchstudies actual orpotentialtissuedamagedescribedintermsofsuch “an unpleasantsensoryandemotionalexperienceassociatedwith the settings ofdaily clinical practice needs to bedeveloped Pain is research methodology that can reflect the effect of acupuncture in for the efficacy of acupuncture. A more applicable and innovative wide. However, somechallengesexistinestablishingevidence of patientswithpainhaveacceptedacupuncturetreatmentworld controlled trials(RCTs) andmeta-analyses.Increasingnumbers randomized large by verified strongly been has management of allagesworldwide. The effectiveness of acupunctureforpain Pain isanenormousandprevalentproblemthattroublespeople MAK CollegeofPharmacy, India TaqeeMohammed Ansari EVIDENCE-BASED MEDICINE ACUPUNCTURE FORPAIN MANAGEMENT IN OP60 pain –93/108(86.0%)vs.88/108 (81.5%)patients,respectively. of patients:itch–66/108(61.0%) vs.61(56.5%)patientsand subjective symptomswereexperienced bythefollowinggroup Results: Duringthecourseofdiseaseand withinthreelastdays Quality Index(PSQI)andEpworth SleepinessScale(ESS). estimated with Athens InsomniaScale(AIS),Pittsburgh Sleep was assessedbyDLQI.Moreover, sleepabnormalitieswere evaluated withvisualanaloguescale(VAS). The qualityoflife Hurley I/II/IIIstaging,respectively. Itchandpainintensitywere Score), HSSI(HidradenitisSuppurativaSeverityIndex)and points and50/49/9accordingtoHSS(HidradenitisSuppurativa mean diseaseseveritywasassessedas34.8±32.1points,9.0±4.4 males) HSpatientswiththemeanageof36.3±12.1years. The and Methods: The studygroupconsistedof108(51females,57 on qualityoflifehidradenitissuppurativapatients.Material study was undertaken to evaluate the influence of itch and pain HS hasgreatimpactonpatients’ qualityoflife.Objectives:This lesions. scarring and fistules , painful by manifested matory, debilitatingandsuppurative disease of the hair follicle Background: Hidradenitis suppurativa (HS) is a chronic, inflam cal University, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Karolina Kaaz,ŁukaszMatusiak,JacekC.Szepietowski HIDRADENITIS SUPPURATIVA PATIENTS OF LIFE AND SLEEP DISTURBANCESOF ITCH AND PAIN INFLUENCEONQUALITY OP61 - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV pain anditchexperiencedduringthecourseofdisease. seem tobeanunderestimatedproblemandcouldrelated of life and sleep disturbances in hidradenitis suppurativa patients (p≤0.0001 for both correlations). correlated positivelywithscoresobtained AIS andPSQI the intolerableitch. maintenance treatmentinorder to enablethepatientwithstand cases needtobetailoredthe exacerbationsthatoccurandto Combined sequential treatments forgeneralised, therapy-resistant and interleukin31antibodyseem promisingintreatmentofitch. be useful.ClinicaltrialsofdrugsusingsubstanceP antagonist targeting transmittersofmoodwhichdeteriorateprurigomay quine, dapsone,minocyclineornaltrexone.Psychopharmaca methotrexate, cyclosporin A, arotinoidacid,azathioprine,chloro photochemotherapy. Systemic regimens involve use of PUVA, nabinoid receptoragonist,UVB,cryotherapy, capsaicinorbath dressings or intralesionally), calcineurin receptor inhibitors, can are: (preferentiallyadministeredunderocclusive or “papulareruptionsinblackmen.” Topical treatment options found predominantlyinnativeNorthandSouth American Indians) pigmentosa inJapan,actinicprurigo(achronicphotodermatitis specialised formsofprurigowithethnicpreference,like some are There scratching. and itch of perception the influence hologic firing of damaged nerve fibers. Emotional factors can also which destroys epithelial innervation mechanically leading to pat prurigo. Some forms ofprurigomaybe secondary to scratching neoplasias arethemostcommonmalignanciesassociatedwith also inducespecialtypesofprurigo. T-cell lymphomaandvisceral tion duetoglutenenteropathy, anorexianervosaorfastingcan renal failure,diabetesmellitusorcollagendisorders.Malabsorp type ofprurigomaybeassociatedwithsome internal diseaseslike sometimes inatopicpatientsorduringpregnancy. An umbilicated result both in itch generally and in prurigo lesions. Prurigo occurs light can induce changes in epidermal innervation that administered drugscaninduceitch.Insusceptibleindividuals, deposited intheskinbyparasites,bacteriaortopicallyorally genous andendogenoustriggersofitchinprurigo. Toxic agents fibers may fire spontaneously to produce itch. There are many exo nerve pathologic fibers. The nerve sensory dermal hypertrophic density of intraepithelal nerve fibers and an increased number of Histologically, the hyperkeratotic nodulespresentwithareduced dular lesionsscatteredonskinsitesthatcaneasilybescratched. Prurigo isaclinicallyacceptedentityofitchingpapularorno SUS, Lund,Sweden Department of Dermatology, Lund University, Skane University Hospital, Joanna Wallengren DISEASES PRURIGO AND OTHERPRURITICSKIN OP62 AIS (R=0.22, the by obtained scores with correlated significantly HSSI with p with scores obtained by the AIS (R=0.44, p respectively. points and6.1±3.9withregardto AIS, PSQIandSSE, sleep abnormalitiesquestionnaireswere5.4±4.3points,6.4±3.6 QoL wasassessedas13.0±8.0points. The scoresforparticular pain – 4.9±2.9 points, 7.3±2.4 points, respectively. The mean days wereassessedas:itch–4.1±2.9points,5.0±2.1pointsand The mean and maximal severity of itch and pain within three last =0.001), respectively. Moreover, thediseaseseverityassessed PRURIGO AND OTHERPRURITICSKIN The severity of itch and pain significantly correlated p =0.03). Decreased QoL assessed with DLQI DISEASES Conclusions: Decreasedquality =0.004) and (R=0.39, ------may be of various origins (dermatological, systemic, neurological, may beofvariousorigins(dermatological, systemic,neurological, mechanisms, theoriginalcause fortheitchunderlyingCPG presence ofpruriginouslesions. Regarding itspathophysiological in themedicalhistoryoruponphysical examinationand(iii)the pruritus foratleast6weeks,(ii)evidenceofprolongedscratching the diagnosingchronicprurigoinclude(i)suffering fromchronic separations areavoidedbyusingthisgenericterm.Maincriteriafor artificial thus and prurigo plaque-type to ultimately and prurigo disease stageswithpapularprurigooftendevelopingintonodular various presentationsofthisdisease. These mayindicatedifferent ‘Chronic prurigo’ waschosenasanumbrellatermcondensing the own pathophysiologicalmechanismsandclinicalpresentation. Experts consideredchronicprurigoadistinctdiseasewithits achieved. was participants the of ≥75% across agreement an Method wasusedforthevotingandconsensusreachedwhen resolution ofskinlesioniscrucialfortheitchelimination. There standard to treat psoriatic itch. According the European guideline as welldisturbedperipheralopioidsystem. There isnogold innervation densityandabnormalneuropeptideshomeostasis to its appearance and exacerbation. One may consider increased not completelyclearandseveralpossiblefactorsmaycontribute level ofstigmatization. The pathogenesisofpsoriaticitchisstill well-being status,theyaremoredepressedandhavehigher tor contributingtothediseaseseverity. Patientspresentdecreased most bothersomesymptomofpsoriasisandisimportantfac moderate severity. Recentlyithasbeendocumentedthatitchisthe the five points, indicating that most patients suffer from pruritus of assessed accordingtovisualanalogscale(VAS) isslightlyabove may alsoaffect uninvolvedskin. The meanseverityof pruritus be limitedtopsoriaticplaques,butinabout30–40%ofpatients found in70-80%ofpatientssuffering fromthisdisease.Itchmay knowledge showsthat itch is a very prevalent symptom ofpsoriass was considered as anon-pruritic dermatosis. The current2017 affecting 1–3%ofgeneralpopulation.Foralongtimepsoriasis diseases, skin inflammatory chronic a is Psoriasis fungoides, ted to atopic dermatitis, eczema, psoriasis, , mycosis itch accompanies numerous skin disorders including, but not limi indermatology. themostcommonsymptom Itch is tosevere Mild cal University, Wroclaw, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Jacek C.Szepietowski PSORIATIC ITCH2017 OP63 University HospitalMünsteronFebruary3 the DepartmentofDermatologyandCenterforChronicPruritus, (European Academy ofDermatology and Venereology) met at prurigo, twenty-fourEuropeanexpertsofthe Task ForcePruritus chronic for terminology and classification definition, consensual a achieve to Aiming literature. scientific the in and care routine sociated withprurigoleadingtoconfusioninthedermatological plaque-type orumbilicatedtypes,avarietyoftermshasbeenas of possible clinical manifestations, including papular, nodular, for many years without well-defined criteria. Due to the multitude Prurigo existsasatermforovertwocenturies,buthasbeenused Hospital Münster, Germany Department ofDermatologyandCenterforChronic Pruritus,University Manuel PedroPereira,SabineSteinke, TERMINOLOGY OF CHRONICPRURIGO NOVEL DEFINITION,CLASSIFICATION AND OP64 offered tothisgroupofsubjects. the holisticapproach,includingpsychologicalsupportshouldbe However, itch. psoriatic with patients for benefit of are they that fore, newbiologicaltherapieshavebeenevaluatedanditisclear Sonja Ständer Lecture abstracts Acta DermVenereol 2017 rd , 2017. The Delphi 1027 - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Hospital Münster, Münster, Germany Department ofDermatologyandCenter forChronic Pruritus,University bias Lotts,KarinLoser, SonjaStänder Konstantin Agelopoulos, PRURIGO NEUROKININ 1RECEPTOR INCHRONIC PERIPHERALOFEFFECTS TARGETING THE OP66 lesions inthispatient. treatments tobecomeeffective inreducingitchandpruriginous cycle”, eventuallypavingthewayforadditionalUV andtopical aprepitant treatmentwascapableof“breakingtheitch-scratch reduce itchinthispatient,itappearsthatthelong-term(16weeks) while various previous treatments were insufficient to permanently to 0.5andonlyveryfewexcoriationsremained.Inconclusion, daily topical calcipotriol. Within further8 weeks itchwas reduced with NB-UVB,intermittent topical corticosteroids, andadditional completely.From thattime point on,treatment wascontinued its doseto80mgeveryotherdayandstoppeditafter2weeks to 2.2. Eventually, due to the high costs of aprepitant, we reduced and theneveryotherdayfor2weeks. This furtherreduceditch further 4weekstopicalcorticosteroids,oncedailyfor2 weeks. We thenaddedNB-UVBthreetimesperweekandafter weakened from4.7to3.3(34%reduction)andwas3.0after6 still present. Within 2weeksofdailyaprepitant80mg,pruritus itch) andextensivelyexcoriatedpruriginousskinlesionswere pruritus wasstill4.7onthe VAS (0=noitch,10=worst imaginable Finally, after2monthsofsaltwater plus narrowband(NB)-UVB, repeatedly received UVB, UVA1, oral and bath-PUVA therapies. antihistamines were clinically ineffective. Over the years, he topical corticosteroids,tacrolimus,andcapsaicin,aswelloral menthol, urea,andpolidocanol,antipruritictreatmentsincluding with aprepitant80mg/dayfor16weeks.Besideemollients and pruriginousnodularskinlesionsonhisextremitiestrunk, for morethan20yearsfromrecalcitrantCPR,withpermanentitch inCPR. lesions skin We suffering treatedamalepatient(73years) However, long-termitchreductionisrequiredtoclearpruriginous antipruritic effects in prurigo nodularis during short-term use. miting duringhighlyemeticchemotherapy, wasreportedtohave a NK1antagonist,licensedforthetreatmentofnauseaandvo play animportantroleinthepathophysiologyofitch. Aprepitant, Substance fects are available only off-label for the treatmentof CP or CPR. or plaques. To date,medicationswithadditionalantipruriticef scratching eventuallyleadingtopruriginouspapules,nodulesand/ scratch cycle”,withchronicpruritus(CP)(>6weeks)andrepeated Chronic prurigo(CPR)resultsfromthedevelopmentofan“itch- Department ofDermatology, MedicalUniversityGraz, Austria Franz J.Legat A PATIENT WITH CHRONICPRURIGO SUPPORTED RESOLUTIONOF SKINLESIONSIN STERED FOR16 WEEKS REDUCEDITCH AND APREPITANT, ANK1-ANTAGONIST, ADMINI­ OP65 litate the communication among clinicians, scientists and patients. classification and terminology of chronic prurigo in order to faci symptoms. Dermatologists should embrace this novel definition, patients withCPGinordertoachieveanimprovementofthe fore, thesechronicityprocessesshouldbetargeted whentreating the itch-scratchcyclethatensuesplaysanimportantrole. There persist duetothedevelopmentofchronicityprocesses.Especially even aftertreatmentoftheunderlyingcauseitch,CPGmay psychiatric/psychosomatic, multifactorialorunknown).However, 1028 Klara Waltner, PeterWolf 9 th WorldCongressofItch P anditsneurokinin-1(NK1)receptorarebelievedto , Alexandra Gruber-Wackernagel, Falk Rülander, Julia Dangelmaier, To Angelika Hofer, - - - - - ( reduced inCPGpatients(n Hospital Münster, Münster, Germany partment of Anesthesiology, IntensiveCare andPainMedicine, University compared tocontrols(p patients CPG in higher significantly was stimulation cowhage histamine (p itch intensityafterstimulationwithcowhageincomparisonto forearm. CPGpatients, but not healthy controls, showed enhanced with cowhage, histamine and a negative control (NaCl) at the volar (n healthy controls play acentralrole. We comparedpatientswithCPG(n mechano- and heat sensitive C-fibers (C observed antipruriticeffect ofNK1R antagonism. vitro suggests a peripheral mechanism on keratinocytes for the receptor expressionandreducedMAPKactivationinvivo phosphorylation aftertreatmentwithaprepitant.Insum,altered confirmed significantly reduced by both, aprepitant and casopitant. This was be affected. SP ofErk1/2was inducedactivation/phosphorylation molecules whichcanbeactivatedbyNK1RandfoundErk1/2to downstream analysed we Additionally cytokines. inflammatory in keratinocytes lasting blockagebyaprepitant.FirstanalysesofNK1Rantagonism upregulation maybeneededtoovercomeatleastinpartsthelong ment with aprepitant it increased even more. We speculate that the patients compared to matched healthy controls (n therapeutic effect. EpidermalNK1R expressionwashigherinPN expression of some inflammatory marker short treatmentperiod.Immunohistochemistryrevealedaltered was not reflected by histological changes what may be due to the This patients. PN in intensity pruritus significantly reduced tant on downstream moleculeswas assessed. Treatment with aprepi aprepitant orcasopitant. Again, theeffect ofNK1Rantagonism activating substanceP (SP)withorwithoutpre-treatment cytes (HaCaT, NHEKs).CellswerestimulatedusingtheNK1R were measured.Studiescontinuedinvitro usingkeratino expression of NK1R and activation of potential downstream targets parameter wereassessedbeforeandaftertreatment.Furthermore with aprepitant(80mg/d).Clinicalandimmunohistochemical treatment receivedanoralfourweeks (PN) type prurigonodularis the mediated bytheNK1Rantagonistsaprepitantandcasopitant.For we therefore investigated study this Within keratinocytes. by cytokines pro-inflammatory matory reactions like mast cell activation and expression of inflam several initiate may NK1R skin human In mechanisms. involving cutaneous components are discussed as underlying effects involvingspinaldorsalhornneuronsandperipheraleffects has recently been shown to reduce pruritus intensity. Both, central Blocking theneurokinin1receptor(NK1R)inchronicpruritus tion ofC (C C-fibers mechano-insensitive both transmission, itch peripheral For clarification. further need derlying pathophysiological mechanisms remain unclear and un the However, CPG. of terminology and definition clinical of the EADV Task Force Pruritus reached a consensus on the has gainedinterestinrecentyears.RecentlyEuropeanexperts Chronic prurigo(CPG)isahighlyburdensomecondition,which 1 Manuel PedroPereira PRURIGO NEUROPHYSIOLOGICAL STUDIESONCHRONIC OP67 ki-Zahn revealed inanearlierstudyno differences inthermaldetection Department ofDermatology and Center forChronic Pruritus,and n =27). In spite of this finding, quantitative sensory testing sensory quantitative finding, this of spite In =27). in vivo study13patientssuffering fromthechronicprurigosub 2 , SonjaStänder MH in vivoas7of9PNpatientsshowedreducedErk1/2 -fibers. The intraepidermal nerve fiber density was density fiber nerve intraepidermal The -fibers. <0.01). Additionally themaximalitchintensityafter in vitro revealed no effect on expression of pro- =40) in their response to cutaneous stimulation stimulation tocutaneous =40) intheirresponse 1 1 , <0.05), arguing forperipheralsensitiza Konstantin Agelopoulos in vivo and =21) comparedtohealthycontrols MI ) activatedbyhistamineand in vitro peripheral effects MH suggesting aperipheral ) activated bycowhage 1 =10); after treat , Esther Pogatz- =40) and 2 De------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Elmariah nal interneurons. These results establish that the Tac1-expressing medulla (RVM) inhibitoryneurons thatareknowntoinhibitspi inhibition ofspinalitchprocessing viatherostralventromedial induced robustspontaneousscratching behaviorbyremovingthe Consistently, selectiveactivationofthese Tac1-expressing neurons Tac1-expressing neurons greatly impaired itch signal processing. scratching behavior. Suppressingtheactivityorablationofthese expressing neuronsinthePAG waselevatedduring itch-induced (GRPR), the key relay neurons for itch sensation. Activity of Tac1- of spinalneuronsexpressinggastrin-releasingpeptidereceptor the itch-scratchingcycle,throughpositive-feedbackdis-inhibition neurons intheperiaqueductalgray(PAG) ofthemouse facilitate that agroupoftachykinin1(Tac1)-expressing glutamatergic feedback circuitingatingspinalitchprocessing.Herewereport stress enhancesorinducesitchinesspointstoatop-downpositive moting theitch-scratchingcycleremainselusive. The factthat control atthespinallevel,butneuralcircuitmechanismpro itch. Itchsignalprocessingisknowntobeundertonicinhibitory in seriousskinanddeeptissuedamagepatientswithchronic spread itchiness.Uncontrollableitch-scratchingcyclesresult Itch triggersscratchingbehavior, whichinturnleadstowide- Institute ofNeuroscience, Chinese Academy ofSciences,China Yan GangSun GATES ITCH-SCRATCHING CYCLE A CENTRAL FEEDBACKNEURAL CIRCUIT OP69 the therapeuticparadigmforitsmanagement. of keycellulareventsinatopypathogenesisandpromptashift Our dataprovidecritical insights regarding the temporal sequence cellular feedbackloopsthatdriveallergic eczemaandscratching. essential regulatorofearlyneuralresponsestoallergens, priming development of inflammation. We identify Mrgpr signaling as an and fibers nascent of maintenance the for required was activity their arborswhilevascularandimmunechangesfollow. Neural expand and pathfind to begin fibers neuropeptidergic exposure, as precursorstotheallergic process. Within hoursofantigen of anallergic eczema,we show thatcutaneousnervesfunction labeled peripheralsensoryneuronsinmiceduringtheevolution pathogenesis. Performingserialinvivo imaging of fluorescently- mation playlesswell-characterizedbutimportantrolesindisease dysregulation, alteredneuralinnervationandneurogenicinflam severe itch.Inadditiontodefectivebarrierfunctionandimmune and inflammation chronic by characterized is dermatitis Atopic Massachusetts GeneralHospital/Harvard MedicalSchool,USA Ethan Lerner, MOUSE MODEL OF ATOPIC DERMATITIS ARE REQUIREDFOR THE DEVELOPMENT OF A MRGPR ACTIVITY RECRUITMENTNEURAL AND OP68 sensitization ofC not functionalneuronalalterationsobservedinCPG.Peripheral not an endogenous neuropathy, is responsible forthe structural but lesions, we speculate that the prolonged scratching activity, and prurigo the of healing after density fiber nerve intraepiderrnal we coulddemonstrateinapreviousstudynormalizationofthe As observed. was function C-fiber of impairment no thus and thresholds betweenpatients(n pruritus andoftheCPG. to prolonged scratching may contribute to the perpetuation of the NEW RECEPTORS, CHANNELS AND PATHWAYS FORITCH Tuanlian Luo, EhsanAzimi, MH -fibers and structural neuronal alterations due =8) andcontrols(n Vemuri Reddy, Sarina =12; p =0.68) - - - Buscaglia logical Laboratories,Courbevoie,France CXCL2. PAR-2-mediated cytokinesup-regulationinthekeratino TSLP expression and by 2-folds expression of IL1-β, TNF-α and demonstrated thatSLIGKV induceda13-foldsup-regulationofthe RT-qPCR to study the inflammatory cytokines RNA expression, we Ca C) and TRPV1 antagonist(AMG9810)impairedPAR-2-evoked the specific PLC antagonist (U73122). The InsP3R (xestospongin release fromendoplasmicstores,whichwastotallyinhibitedby showed thatPAR-2 agonistpeptide(SLIGKV)evokedcalcium modulation. CalciumimagingrecordingsinCa genes inflammatory consequently and keratinocytes ferentiated through aCa2 The activation of PAR-2 in keratinocytes enhances inflammation 1 Olivier Gouin DIFFERENTIATED KERATINOCYTES INFLAMMATORY MEDIATORS PRODUCTIONIN INTRACELLULAR CA2+RELEASE AND TRPV1 REGULATES PAR-2-EVOKED OP70 consistent with delayed-firing GRPR cells being glutamatergic being cells GRPR delayed-firing with consistent rheobase compared to GRP neurons. These characteristics are mem brane potentials (RMP), lower input resistances (Ri) and higher resting hyperpolarized significantly had neurons GRPR delayed-firing that found also subpopulations. We firing (36%) more heterogeneous comprising delayed (64%) and non-delayed 92% of cells showing initial bursting firing. GRPR neurons were GRP neuronsconstitutearatherhomogenouspopulation with intrinsic biophysical properties and firing patterns. We found that GRPR neuronsinacutespinalcordslicestocharacterizetheir We performedwhole-cellpatch-clamprecordingsfromGRP and to study theirsynapticconnectivityas well asmodulationbyGRP. functionally characterizeGRP-andGRPR-positiveneurons combined and electrophysiological optogenetic toapproaches spinal itch-processingcircuitsare not wellunderstood.Here,we pruriceptive-processing. However, the functional aspects of as identified been have Gastrin releasingpeptide(GRP)anditscognatereceptor(GRPR) land Institute ofPharmacologyandToxicology, UniversityofZurich,Switzer Martina Pagani RECEPTOR (GRPR)-POSITIVENEURONS THRESHOLD SYNAPTIC ACTIVATION OF GRP PEPTIDE (GRP)ISREQUIREDFORSUPRA­ SPINAL RELEASEOF GASTRINRELEASING OP71 in thedifferentiated keratinocytes throughPLC-dependentCa that inflammation time skin first promotes the PAR-2 for strated impaired PAR-2-mediated gene expression. Our findings demon SB366791 and capsazepin)orwithsiRNA knockdownof TRPV1 (AMG9810, antagonists specific with TRPV1 of blockage the cytes was abolished with PAR-2 antagonist (GB83). In addition, inflammatory genesexpression. release bybothIP3and TRPV1 channelsreleaseandconsequently of PAR-2 intheintracellularcalciumsignalingpathwaysdif itch. and process inflammatory involvement the investigated We the basalstratumofepidermistoanalyzerolePAR-2 in as TSLP. However, studiesonlyusedprimarykeratinocytes from through feedbackregulationofitchprocessinginthespinalcord. neurons inthePAG playakeyroleingatingitch-scratchingcycles, Brest, Buhé Laboratory of Neurosciences of Brest, University of Western Brittany, 2+ release partially but totally when they were associated. Using 1 2 , LucLefeuvre Canalopathies etSignalisation Calcique, Brest, 2 , Olivier Mignen 1 + , -dependent cytokinesexpressionandreleasesuch Killian L’herondelle 3 , Laurent Misery important componentsinspinalcord 2 , Christelle Le Gall-Ianotto 1 , 1 , NicolasLebonvallet Raphaele LeGarrec Lecture abstracts Acta DermVenereol 2017 3 2+ Uriage Dermato- -free medium 1 , Virginie 1 1 , 1029 Paul 2+ - - - - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta 1 Nobuaki Takahashi OF ATOPICDERMATITIS DERIVED LIPOCALIN-2 IN THE PATHOGENESIS POSSIBLE ROLEOF SATELLITE GLIAL CELL OP73 itch andsensitizationofitch-signalingpathways. animal modelappearstobeusefulforinvestigationsofpost-burn through disinhibitionofitch(reductionpainsignals). duced epidermal nerve skin wasobservedinthe10mmscaldburnmodelonDay28.Re fiber density may contribute to post-burn itch adjacent and site burn the both in density fiber nerve epidermal of Protein Gene Product 9.5 antibody to label nerve fibers. A reduction itch. Finally, post-burnskinwasdissectedandimmunostainedwith histaminergic itchpathwaysareinvolvedinlate-phasepost-burn not inhibitspontaneousscratchingoralloknesis,suggestingthatnon- receptor antagonistchlorpheniraminewastestedonDay22butdid mm model andDays2128inthe10mmmodel. The histamineH1 7 the in 3 and 1 Days on significantly increased scratching absence ofevokedhindlimbscratchboutswasnoted. VF-evoked post-burn skinonDays0,1,3,5,7,14,21,and28. The presenceor scratch responseinnaïveC57BL/6mice,wasrepeatedlyappliedto a weak von Frey filament (VF; 0.7 mN), which does not elicit any and increasedagainonDays14,21,28. To testforalloknesis, transiently onDays1,3,and5,returnedtothebasallevelbyDay10, of post-burnitch:countsspontaneousscratchboutsincreased declined within14days. The 10mm scaldburncausedtwophases burn causedatransientincreaseinspontaneousscratchboutsthat 1, 3,5,7,10,14,21,and28afterthescaldburn. The 7mmscald To assessspontaneousscratching,wevideotapedmiceonDays0, model. burn scald the in altered is fibers intraepidermal of density H1R antagonist inhibits post-burn itch in mice and whether the of post-burnitchinmice. We furthertestedwhetherahistamine of burninjury (7 mm or 10mm diameter) affect the time course exhibit more severe itch, we presently investigated if different sizes to boilingwater).Becausepatientswithlarger burnsurfaceareas in adultC57BL/6mice(exposinganareaoftheshavedbackskin developed a model of post-burn itch by inducing scald burn injury nisms behindpost-burnitcharelargely unknown. To thisend,we and alloknesis (touch-evoked itch), but the underlying mecha sensitization ofitch-signalingpathways,leadingtoongoingitch resistant toantihistaminetreatment. This post-burnitchinvolves The majority of burn patients suffer from chronic itch, which is often University ofMiami,USA Kent Sakai, AND EPIDERMAL NERVE INNERVATION INMICE EFFECTS OF BURNSIZEONPOST-BURN ITCH OP72 functional outputfromspinalitch-processingcircuits. in spinalpruriceptiveprocessingandsuggestthatGRP booststhe physiological characterizationofGRP-andGRPR-cellsinvolved firing in GRPR delayed neurons. Our results represent a detailed GRP, thesamelightstimulationparadigmtriggeredactionpotential after severalminutes.Moreover, inthepresenceofexogenous firing potential action ongoing in resulted often which neurons, GRPR delayed-firing of depolarization slow a caused GRP nM subthreshold responses in GRPR neurons. Application of 300 tions, lightstimulationofChR2-expressingGRP cellsinduced synaptically connectedtoGRPRneurons.Underbaselinecondi GRP-ChR2 ween GRP-andGRPR-positiveneuronsinslicespreparedfrom information. We thencharacterized thesynapticconnectivitybet neurons involvedinintegratingandtransmittingthespinalitch 1030 ronori Matsuda versity GraduateSchoolofMedicine, Chiba, Institute for Environmental and Gender Specific Medicine, Juntendo Uni- Juntendo Medicine, Specific EnvironmentalGender for and Institute 9 th WorldCongressofItch Kristen Sanders,GilYosipovitch, GRPR::eGFP mice andfoundthat GRP neuronswere 1 , Yasushi Suga 1 , Mitsutoshi Tominaga 3 , KenjiTakamori 2 Department ofBiological 1 , Ryohei Kosaka Tasuku Akiyama 1,3 This new This new 1,2 , Hi- - - - - Takase University UrayasuHospital,Chiba,Japan Tokyo UniversityofScience, Kat, Science and Technology, Faculty of IndustrialScience and Technology, the pathogenesisofdermatitisin AD-NC/Nga mice. These resultssuggestthatSGCderivedlipocalin-2isinvolvedin mice. NC/Nga in behavior scratching induce not did μl) μg/5 (1 ing thatintrathecaladministrationofrecombinantmouseLCN2 without inhibiting scratching behavior. This is supported by find of AD-like dermatitisinNC/Ngamicereducedscore induction as time same the at weeks 3 for week a twice μl) μg/5 Nga mice.Intrathecallyadministratedanti-LCN2antibody(1 cord during the processofinduction AD-like dermatitisinNC/ spinal the in than faster increased significantly was DRG the in AD-NC/Nga mice. In addition, expression level of LCN2 mRNA of DRG the in increased significantly was SGC immunoreactive co-localized with GLAST, a marker of SGC, in DRG. LCN2- mice. Immunohistochemical analysis revealed that LCN2 was of AD-NC/Nga micewashigherthan that ofcontrolNC/Nga week for3weeks.LCN2geneandproteinexpressioninDRG by application of Dermatophagoides farinae body (Dfb) twice a in AD modelNC/Ngamouse. AD-like symptomswereinduced involved intheinductionofdermatitisanditch-relatedbehavior study, weexaminedwhetherSGCderivedlipocalin-2(LCN2)is SGC ininductionofdermatitisanditchremainsunclear. Inthis cells (SGC)isinvolvedinpainmodulation.However, theroleof ported thatinteractionbetweenDRGneuronsandsatelliteglial important roleinsignaltransductionofitch.Itwasrecentlyre with intractableitch.Dorsalrootganglion(DRG)playsan disease skin inflammatory chronic a is (AD) dermatitis Atopic is not sufficient and objective evaluation should be applied to applied be should evaluation objective and sufficient not is to thelevelofscratching.Inconclusions, subjectiveevaluation Over 70% had dry skin, the severity of which positively correlated nied having itch scratched according to the observation by others. itch or not, or rate the severity of itch. Over 30% of those who de larger percentageofpatientscouldnotanswerwhethertheyhad evaluation by others. The higher the dementia severity was, the self-evaluation ofitch,whereasnearly50%accordingtoscratch itch inthesurveyeddementiapatientswas37.8%accordingto and frequencyofskincareusingmoisturizer. The prevalenceof dryness andsoughtitscorrelationwiththeextentofscratching where scratchmarksexist. We alsoevaluatedtheseverityofskin the extentofscratchmarksbycalculatingbodysurfacearea the presence and extent of scratching behavior and we evaluated objective evaluationofitchbyothers,theircaregiversevaluated them toratetheiritchonnumericalratingscale(NRS).Forthe asked thesubjects whether theyhaditch ornotatpresent andasked in nursinghomesorathome.Fortheself-evaluationofitchwe on itchin148dementiapatientswhoarereceivingmedicalcare not applicableinthispopulation. We conductedastudyfocusing are scales dementia patients,sincethebroadly-usedself-evaluation than 20%inmostcases.However, itchhasnotbeenstudiedin show the prevalence of itch in a range from 7to 37.5% with greater Itch is common inthe elderly. Previous epidemiologicalstudies 6 1 Toshiya Ebata CE OF ITCHINJAPANESE DEMENTIA PATIENTS EPIDEMIOLOGICAL STUDY ON THE PREVALEN­ OP74 sse Style Care Co. Ltd., Joelle Vaglio EPIDEMIOLOGY OF ITCH AND QUALITY Nestle SkinHealthSHIELD, Chitofuna DermatologyClinic,Japan 4 , Nao Taniguchi 7 , MichelPoncet 1 , Lefkos Middleton 4 Takase Clinic, 5 , Kimitoshi Takemura 7 OF LIFE Galderma R&D 7 , 3 Akihiko Ikoma Department ofDermatology, Juntendo 2 2 5 Imperial CollegeLondon, Saint-Care Holding Corporation, , Ryoko Fukuda 6 6 , Didier LeClercq 3 , Yoshimasa 3 Bene 6 - - - - , Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV rie Mengeaud by 2medicalexperts.Patients’ verbatimshowedsomerelevant of HRQoL and7ofseverity, andwhichwasclinicallyvalidated reviewed todevelopthepreliminary CFaddressing16domains (semi-structured interviews;n prehensibility was tested during cognitive debriefingwith patients of itemswasgeneratedforeachdomain ofinterest,andtheircom was updatedfollowingFocusGroupswith19patients;(3)apool render therelevantdomainsforseverityandHRQoL;(2)CF using asystematicliteraturereviewandexperts’ interviews, to was followed: (1) a Conceptual Framework (CF) was developed related qualityoflife(HRQoL).Methods: A three-stepapproach the severityofChronicPruritus(CP)anditsimpactonhealth- Objectives: To measuring developapatient-reportedquestionnaire, 1 Jennifer Theunis TO ITEMSGENERATION PRURITUS: FROM THE CONCEPTUAL MODEL QUALITY OF LIFEINPATIENTS WITH CHRONIC OP76 patients totestthevalidityofthisnewtool. to thepriorweek. We willbeginapilotstudywith4–5-year-old items ontheItchyQoL,whilealsoeliminatingquestionspertaining account forthesecognitivedifferences byreducingthenumberof for the 6–7-year-olds. As a result, we have implemented changes to is likelytoocomplexfor4–5-year-old patients,whileappropriate strated thatthecurrentversionofcartoon-annotatedItchyQoL younger group.Conclusion:Ourinitialinvestigationhasdemon child’s itchseverityratingalmost20%less(64%vs.45%)inthe or distractedduringtheprocess.Finally, parentsagreedwiththeir were also 9% more likely (12% vs. 3%) to be deemed hyperactive with comprehendingquestionsontheItchyQoL.4–5-year-olds younger childrenwere16%(18%vs.2%)morelikelytostruggle ting a lackofunderstandingtime.Second,interviewersnotedthat of theweekincorrectlycomparedto6–7-year-olds, demonstra (30% vs.75%and36%75%)toanswerquestionsaboutthedays olds and6–7-year-olds. First,4–5-year-olds were40%morelikely and data collection showedthreekeydifferences between 4–5-year- pruritus were recruited. A combination of interviewer observations of recall(lastweek).Results:Ninety-sevenchildrenwithchronic asked bytheinterviewertoassessabilitycomprehendduration they agreedwiththechild’s response.Standardizedquestionswere Parents alsoestimatedtheirchild’s itchseverityandwereaskedif timate thequality-of-lifeimpactoncartoon-annotatedItchyQoL. were asked to rate their itch severity on the ItchyQuant scale and es ren. undertaken toassessthefeasibilityofthesescalesinyoungerchild of pruritus inchildren, respectively. A mixed method approach was illustrated scalestomeasureitchseverityandqualityoflifeimpact have createdtheItchyQuantandpediatricversionsofItchyQol, vary withinasmallagerange.Inresponsetothesechallenges,we severity can be challenging as their cognitive levels may drastically Introduction: The abilityofchildrentoconveyaself-reportitch 1 Shelby Smith IMPACT PRURITUS SEVERITY AND QUALITY OF LIFE PITFALLS INPEDIATRIC SELF-REPORTED OP75 is animportantfactorassociatedwithitchindementiapatients. understand the status of itchin dementia patients. Skin dryness Ho Chen France liano Orri Pierre Fabre, Emory University, Children with itch > 6 weeks, between ages 4–7 years, Methods: Childrenwithitch>6weeks,betweenages4–7years, 1 , JamesRoberts 3 , Jesus Cuervo 1 , 1 2 , LaurentMisery Grace Lee LASER Analytica, 1 2 , Georgia InstituteofTechnology, USA Clementine Nordon 1 2 2 , , SuephyChen , Sandy François Gilles Berdeaux =21). 4 3 CESP, INSERM1018, Results: 155articleswere 2 , Ylana Chalem 1 1 , 1 Alix Pijeaux , Marie Auges 4 1 CHU Brest,CHU , 1 Massimi- , Kuang- 1 , Vale------matology, University Hospital Heidelberg, or becausetheywerenotondialysistreatmentanymoreduetotrans could not be contacted (e.g. because they had moved to another place prognostic markerforpatientsonHD,however, thisisnowinvesti analyses. PreviousresearchsupportstheobservationthatCIisapoor identify itsdeterminantsbasedoncross-sectionalandlongitudinal the incidenceandprevalenceofCIinthisfollow-upstudy, andto new itchcases(incidence)inthiscohort. We aimtoprovidedataon patients arecurrentlycontactedagaintoinvestigatethenumberof from currentchronicitch(CI).In2017,fouryearslater, all860HD Germany. We showedthat25.1%(n a totalof860hemodialysis(HD)patientsin25dialysisunits representative cross-sectionalcohortconductedin2013.Itcontains GEHIS (GermanEpidemiologicalHemodialysisItchStudy)isa 1 Katarzyna Grochulska OF PATIENTS WITH CI ITCH STUDY)ONINCIDENCE AND MORTALITY (GERMAN EPIDEMIOLOGICAL HEMODIALYSIS- PATIENTS: A FOLLOW-UP STUDY OF GEHIS CHRONIC ITCH(CI)INHEMODIALYSIS OP77 in some of them itch is a hallmark symptom. Crucial data on its in someofthemitchisahallmark symptom.Crucialdataonits Many dermatological conditions are associated with pruritus and Universitätsmedizin Berlin,Germany Dept. ofDermatologyand , Allergie-Centrum-Charité Charité- Maurer, MartinMetz Tomasz Hawro, OF PRURITUSINCHRONICDERMATOSES PREVALENCE, CHARACTERISTICS AND BURDEN OP78 to seeifthiscanbeconfirmedinthewholecohort. and withoutCIinyoungeragegroupsbutfurtheranalysesareneeded analyses hinttoadifference inmortalitybetweenHDpatientswith an increasedincidenceofCIinyoungerHDpatients.Preliminary 70 yearsorolderwasequalbetweengroups.Firstresultsreferto group vs.19.0%in the CIgroup)while the mortality in patients aged in patientsagedyounger70years(32.7%mortalitythenon-CI between sexeswerefound.Interestingly, thiseffect waspronounced in 2013comparedto54.9%thegroupwithoutCI,nodifferences 25.8%. The mortalityratewas45.7% inthegroupsuffering fromCI to suffer fromCIanymore, resultinginaone-yearprevalenceof CI had developed in the past year, while 13.5% (n male andthemeanagewas69.0years(SD12.4).In11.2% (n plantation). 89HDpatientswereinvestigated,60.7%ofthose those, 46.7%(n dialysis unitscontaining212HDpatientsbeingaddressedsofar. Of As thisisanongoingstudy, results are preliminaryandreferto9 (during the last 3years), severity ofCI (visual analogue scale, VAS). questionnaire asin2013investigatinge.g.currentandpreviousCI Patients’ characteristicsandCIwereassessedwiththesamepatient time. first the for patients HD of cohort representative a in gated lios Klinik,Wiesbaden, Germany its impactonHRQoL inacomprehensivemanner. interviews. This questionnairewillmeasuretheseverityofCP and internationalguidelinesandnamely,following patients’ using version ofthispatient-reportedquestionnairewasdeveloped items. 50 includes version sessions. final The debriefing cognitive after refined and drafted was questionnaire anticipating andthinkingaboutCP. A preliminaryversionofthe Moreover, a new domain of interest was revealed: the time spent differences onseverity, betweenclinicalandpatients’ perspectives. Elke Weisshaar Spindler, Dept. of Clinical Social Medicine, Environmental and Occupational Der Karsten Weller, Sabine Altrichter, 1 =99) haddiedinthemeantimeand11.3% (n Katarzyna Przybylowicz, 1 , Robert Ofenloch =217) ofHDpatientssuffered 2 Dept. ofNephrology, DKDHe- Lecture abstracts Acta DermVenereol 2017 Ulrich Reidel, 1 , André Ellrich, Thomas Mettang Thomas Discussion: Afirst =12) reported not =12) reported not Marcus 1031 =24) =24) =10) =10) Max 2 - - - , Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta and itch. The pivotalquestionremained: Howdoesthebraincode which thentransmittheiractivity toacommonnetworkforpain to thebrain. activates“pruriceptivenociceptors” itchystimulus An population codingwasproposed whereitchusesitsownpathway similar cerebral regions were detected. Beside this intensity model activations ofthenociceptors.From this,it was notsurprisingthat been considered as sub-modality of pain and is elicited by weak overlap isduetotheneuralbasisofitchthatformanyyearshas qualitatively different sensations.Itwasdiscussedthatthis these experiences,althoughitisobviousthattheyclearlyevoke that thereisastrongoverlapoftheaffected brainareasduring in thesuppressionofitchorareactivatedbypain.Itturnedout compare withregionsthathavebeendescribedtobeinvolved brain regions which generate the sensation of itch. They were identified signal depended) level oxygenation (blood BOLD the processing of the respective perception. This technique based on regarded asmarkersofregionsthatareinvolvedinthecerebral been have rCBF the of changes related Stimulus (rCBF). flow ging (fMRI) has been used to image regional cerebral blood Since more than 20 years functional magnetic resonance ima roradiology, FAU, ErlangenNuremberg, Erlangen,Germany Department ofPhysiologyandPathophysiology, andDepartmentofNeu- Clemens Forster TECHNIQUES NEW METHODS INBRAINIMAGING OP79 pruritus itshouldbeinquiredwhethersuicidalthoughtsexist. presence ofpruritus,andinindividualsreportingaboutchronic presenting atadermatologicaldepartmentshouldbeaskedforthe Patients options andcanleadtoabettermanagementofourpatients. itch inthesediseases,helpthedevelopmentofbettertreatment This canleadtoabetterunderstandingofthepathophysiology results showacharacteristicpatternofpruritusformanydiseases. variety of dermatologicaldiseases. Together with itch intensity, the for the first time, the localization of pruritus in patients from large patients withlichenplanus. Taken together, we have visualized, to 19%inpatientswithpruritusonunaffected skinandto22%in itchy skin diseases, ranging from 0% in en plaque cidal thoughtsduetoprurituswerereportedbymanypatientswith visual analoguescale=8±1.4),followedby AD (7.5±2.2).Sui patients withpruritusonunaffected skin(mean±SDofmaximum patients (11). The mostintensemaximalprurituswasreportedby (26), 100%/67% (15), 82%/64% lichen planus parapsoriasis en plaque (29), 39%/31% cutaneous Bcell lymphoma cytosis (54),100%/86%pruritusonunaffected skin(30),45%/28% (75), 65%/47% cutaneous T cell lymphoma (68),78%/56% masto 100%/78% chronic inducible urticaria (76), 100%/96% prurigo 88%/73% psoriasis (138), 100%/91% atopic dermatitis (AD, 128), by 100%/77% patients with chronic spontaneous urticaria (143), aires. Pruritusinthediseasecourse/currentprurituswerereported different dermatologicaldiagnosesreturnedcompletedquestionn and out-patients of dermatology university department with 18 of life,qualitysleep,sexuality, andsuicidalideations.880in- on pruritus presence, localization, characteristics and the quality filled out the study questionnaire including questions be, reportedly, associatedwithpruritusandcontrolpatients dermatoses. Unselectedpatientswithactivedermatoses,thatcan on quality life and the presence of suicidal thoughts in different distribution patterns(bodyheatmaps),burdenofchronicpruritus lyzed prevalence,characteristicsofchronicpruritus,includingits burden are still missing for many dermatoses. Here, we have ana prevalence, characteristicsincludingdistributionpatternsand 1032 NEW IMAGING TECHNIQUES NEW 9 th WorldCongressofItch OTHER ASPECTS OF ITCH AND - - - - - logy, and been used as a reflection of the innervation density of itch-trans of density innervation the of reflection a as used been have biopsies skin in count (IENF) fibre nerve Intra-epidermal National SkinCentre, Singapore Hong LiangTey ATOPIC DERMATITIS AND PSORIASISSKIN CUTANEOUS NERVOUS SYSTEMINPRURITIC THREE DIMENSIONAL ANALYSIS OF OP80 healthy subjects. The limitations of this method will be discussed. suffering fromchronicprurituswillbecomparedwiththose patients from findings Preliminary conditions. chronic to due can beusedtoidentifyitchrelatedbrainnetworkanditschanges tation ashortoverviewwillbegivenaboutthistechnique,howit networks duetoachronicpainfulorpruriticinput.Inthepresen they seemtohavethepotentialdetectchangeswithincerebral pursue stimulusrelatedchangeswithinsuchanetwork.Further, New approachesforanalyzingthecorrelationsofBOLDsignals the processingofastimuluspatternco-activationchanged. measured bycorrelationanalysesoftheBOLDsignals.During regions includedinthisnetwork. The relatedconnectivitywas tected whichreferstoapatternofco-activationacrossthebrain various substances including bile salts, endogenous opioids, and disorders particularlythosewith cholestaticfeatures. Although Introduction: Pruritusisafrequentsymptom ofhepatobiliary 1 Andreas Kremer CHRONIC ALTERED ACTIVATION OF BRAIN AREAS IN FUNCTIONAL CONNECTIVITY REVEALS OP81 itch receptorsco-localisingwithnervefibres. manner and serves asa platform in future studies to better identify us tostudythecutaneousnervoussysteminacomprehensive3D skin andfromhealthyvolunteers. This novelmethodenables atopic dermatitisandpsoriasislesionscomparedtonon-lesional in the innervation densities and neural characteristics in the itchy Preliminary analyses suggest that there were significant differences dendrite branchesandstraightness,werethenperformed. teristics of the neural network, such as filament length, number of by filament tracing of IENF. Analysis of neural density and charac The epidermis was then segmented from the 3D image, followed and 3D imaging of tissue sections up to 450 µm was performed. nervesinthebiopsy,PGP9.5-positive byopticalclearing followed responding bodysitesin10healthyvolunteers.Immunostainingof non-lesional areaswereobtained,togetherwithbiopsiesatcor the prior1weekwererecruited.Skinbiopsiesfromlesionaland and 10psoriasispatientswithanaverageitchscoreof>3/10over a 3-dimensionalapproachtosuchananalysis.12atopicdermatitis examined. ofthesection limited bythethickness We herebyadopt cal sections. However, such an approach is 2-dimensional and is the basement membrane perunitlength in 50 µm-thick histologi by assessing the number of PGP9.5-positive nerve fibres crossing results. The conventionalmethodofdeterminingIENF countis matitis and psoriasis, but previous studies have reported conflicting atopicder as such inpruriticconditions densities inIENF changes mitting C nerve fibres in the skin. It is of interest to determine the Erlangen-Nürnberg, Erlangen,Germany fler stimulus, nomentaltask)a“defaultmodenetwork”couldbede fMRI connectivityanalysesshowedthatduringrestingstate(no a functionalbrainnetworkcodetheperceptionquality. Indeed, The conclusion was that different temporal activity patterns within the different qualitiesifnotbyapatternofactivatedbrainareas? Department of Medicine 1, 3 , ClemensForster 3 Deparment ofNeuroradiology, Friedrich-Alexander-University 1 , Theresa Buchwald 2 2 Institute for Physiology and Pathophysio- 1,2 , Marcel Vetter 1 , Arnd Dör ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV subjects whoarenotsuffering fromspontaneousitch. pruritic stimulusarelesspronouncedinSP ascomparedwith Accordingly changes within the networks due to an additional be violatedinSP probablyduetothecontinuouspruriticinput. BA10) wereenhanced.Conclusion: The DM networkseemedto regions whilein WP onlyFCtoPAG modulatingareas(ACC,IC, increased morestronglyascomparedtoDMinSP withinlimbic however, FCvaluesweresmallerinSP. FCoftheoutputnetwork histamine FCin the input networks were enhanced in both groups, of the PAG to thalamus, caudate body and limbic system). During in theSP group. Also theoutput networkwasenhancedinSP (FC somatosensory cortexS2,whileFCtofrontalareaswasweaker parts oftheinsularcortexbothhemispheresandtosecondary within theSP groupinthe“input”networkoflpICtoanterior the DMsituationhigherfunctionalconnectivity(FC)wasfound were calculatedbetweenthetwopatientgroups.Results:During (r=0.90, smartwatch-detected and video-captured scratching time per hour between correlation positive statistically-significant a was There average sensitivityandPPV were84.6% and90.2%,respectively. evaluated itchseveritywasstudied. Results: In the first study, the The correlation of scratching time with the skin severity and self- record nocturnalscratchingathome forsevenconsecutivedays. with atopicdermatitisandtenhealthyvolunteersparticipatedto the softwarewerestudied.Insecondstudy, twentypatients compared, thesensitivityandpositivepredictivevalue(PPV)of during night. With the records from the video and smartwatch for video-monitoringandsmartwatch-recordingofscratching who hadmoderateorsevereitchwerehospitalizedforonenight dermatitis atopic with patients five of total a study, first the In the smartwatch inwhichthe software is installed were carried out. the app’s reliability. Methods: Two proof-of-concept studies using scratching duringnight.Clinicalstudieswereconductedtovalidate be installedtobroadly-usedsmartwatchesandusedmeasure loped anapplicationsoftware(app),namedItch Tracker, that can itch severitythroughmeasurementofscratching. We havedeve lerometers inwatch-typedevicestohelpobjectiveevaluationof Previous studiesofactigraphydemonstratedpotentialsacce Background/objective 1 Akihiko Ikoma TOOL TO MEASURENOCTURNAL SCRATCHING TURNING WEARABLE SMART DEVICESINTO A TRACKER: ANAPPLICATIONSOFTWAREITCH OP82 regions ina whole brain study. In a 2 other and regions seed the between calculated were coefficients the PAG forexploringthe“output”network.Pearson’s correlation and posterior insulacortex(lpIC)forexploringan“input”network mean BOLDtimecourseswereextractedfromtheseedregionsleft run sensoryqualitieswereassessedbyquestionnaire.Individual itch stimuli(histamineiontophoresis)wereapplied. After each During thesecondandthirdfMRIsequencemildheatpain free fromstimulationtodetectthedefaultmode(DM)network. sequences to BOLD signal changes. The first fMRI sequence was scans wereusingaclassicalconnectivityfMRI-designwithEPI analogue scale.Functionalmagneticresonanceimaging(fMRI) visual a and questionnaire a using quantified was intensity itch pruritus (SP, n divided into two groups, those patients suffering from spontaneous cholangitis wereinvestigatedinthisstudy. These patientswere 23 patientswithprimarybiliarycholangitisorsclerosing in itchsensationcholestaticpruritusremainselusive.Methods: potential peripheralpruritogens,thecentralmechanisminvolved as acidhavebeencontroversiallydiscussed lysophosphatidic Ebata Nestle SkinHealthSHIELD, 2 <0.001). There was no significant difference in scrat in difference significant no was There p<0.001). =9) andthosewithoutpruritus(WP, n 1 , Kimitoshi Takemura : Itch is difficult to objectively evaluate. objectively to difficult is Itch : 2 Chitofuna DermatologyClinic,Japan 1 , nd Didier LeClercq levelanalysiscontrasts =14). Baseline =14). Baseline 1 , Toshiya - - - itch and a block of non-itch images (counterbalanced between par (counterbalancedbetween itch andablockofnon-itchimages participants (withnopruriticskinconditions) viewed ablockof ofthevibration.40right-handed alarms’) (‘false and misperception thelikelihoodofbothcorrectdetection(‘hits’) increases which left index finger on 50% of trials. A LED flashes on 50% of trials, detect thepresenceofanear-threshold vibrationpresentedonthe affected participants’ tactilesensitivity. IntheSSDT, participants al., 2008)toinvestigatewhetherviewingitchornon-itchimages study usedtheSomaticSignalDetection Task (SSDT; Lloydet sensitivity areinvolvedinthecreationofthesesensations;this physical stimulation.Ithasbeensuggestedthatchangesinskin related imagescancreatesensationsofitchintheabsenceany Visually Evoked Itch (VEI) is the phenomenon whereby itch- University ofLeeds,UK Michellie Young, MelanieBurke, VIEWING ITCH-RELATED IMAGES CHANGES IN TACTILE SENSITIVITY AFTER OP83 validity andreliabilityinmeasuringscratching. disturbance. detected scratchingtimeandself-evaluateditchseverityorsleep smartwatch- between correlation statistically-significant no was with theself-evaluateditchseverityorsleepdisturbance. There with smartwatch-detectedscratching(r=0.71,p<0.001),butnot study,the second correlated well (EASI) ofthelesions theseverity ching durationbetweenthedominantandnon-dominantarm.In with DNFBinsensitizedmice contrasttocontrolmice.Inthis withdrawal inducedseverescratching behaviorafterchallenge reported thatlong-termepicutaneous applicationofGCandits cessation of chronic use of GC, even in now days. We previously celerated itchsensationisoccasionally observedshortlyafterthe However, serioustopicalsteroid withdrawalsyndromewithac ment ofallergic skindiseasessuchasatopicdermatitis(AD). Topical glucocorticoid(GC)iscommonly usedforthemanage cine, Japan Department ofDermatology, OsakaUniversityGraduateSchoolofMedi- royuki Murota Ichiro Katayama INFLAMMATION LATES ITCH-EVOKED ALLERGIC CUTANEOUS KERATINOCYTE DERIVEDCORTISOL REGU­ OP84 of VEI basedonalteredsensorythresholdsfordetectingitch. and whatishappeningtoit. This lendsweighttoanexplanation images promptparticipantstopaygreaterattentiontheirskin its presencemorefrequentlyoverall. This maybebecausethese tecting atactilestimulus,withoutcreatingbiastowardsreporting itch imagesappearstoprimeparticipantsperformbetteratde of VEI correspondswith achangeintactilesensitivity. Viewing consistent with the presence of VEI. This indicates that the creation scratch frequency were both higher during the itch block, which is report feelingavibrationoverall.Participants’ itchinessratingsand viewing eithersetofimagesdidnotcreateagreaterpropensityto which indicatesthatnochangeintheirresponsecriterionoccurred; to itchimages. There waslittledifference infalsealarmrates, suggests their tactile perception was enhanced following exposure sensitivity duringtheitchblockthannon-itchblock,which block, both withand without the light. Participants showed greater itch andnon-itchconditions. The hitratewashigherfortheitch that performance on the SSDT significantly differed between the images andtheirscratchingbehaviourwasobserved. We found intensity fortheSSDT. Participantsalsoratedtheitchinessof was measuredbeforeeachblockwhichusedtosetthestimulus ticipants) interspersedwiththeSSDT. Their sensitivitythreshold Conclusion: The apphasbeenproventohaveahigh , Akira Matsumoto, SaoriOchi, Donna Lloyd Lecture abstracts Acta DermVenereol 2017 Mika Terao, Hi- 1033 - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta tion, mostofwhicharelocatedintheUSA (n=95)andEurope 280 activestudycentersarecurrentlyrecruitingforthisindica als. According totheonlineportalclinicaltrials.gov, morethan increasingly becomingconsideredanindicationinclinicaltri (CP) hasincreasedinthepastseveralyears;accordinglyCP is The understandingofthemechanismsbehindchronicpruritus Center forChronic Pruritus,UniversityHospitalMünster, Germany Sonja Ständer ITCH FUTURE PERSPECTIVESIN THE TREATMENT OF OP85 immune responsein AD. barrier functionofhornylayerbutalsobyaffecting localinnate stress might disrupthomeostasis ofthe skin notonly byimpairing and accelerate itch associated skin inflammation. Taken together, abrupt withdrawal might modify 11βHSD1 expression in the skin A, MurotaHetal.).LongtermapplicationoftopicalGCandits in K5HSD11b1 KOmice(cKO),comparedwith WT (Matsumoto Mas related Gprotein-coupled receptor A3(MrgprA3) is observed increased scratchingbehaviortochloroquine(CQ),aligand Pathol. 2016;186(6):1499-510). More recently, wepresented that ment oftheinnatehostdefenseresponse.(Terao Metal. Am J in keratinocytes has been found in AD and leads to the impair skin in a homeostatic fashion. Decreased expression of 11βHSD1 environmental stimuli,isspeculatedtominimizedamageofthe skin. Cortisolderivedfromkeratinocytes,whichareexposedto the in (11βHSD1) 1 type dehydrogenase 11β-hydroxysteroid of tive cortisolviaconversionfrominactivecortisonebyactivation as UV-irradiation orexposuretohaptenschemicalsinduceac cytokines. Ourrecentstudiessuggestthatoxidativestresses,such IL-3 beforechallenge,butnotinthosepre-injectedwithother more, PPT-A mRNA was only expressed in mice pre-injected with scratching behaviorinDNFBcontactdermatitismice.Further Among the cytokines, only IL-3 and TNF-α significantly increased ear ofDNFBcontact-sensitizedmicebeforechallenge. the into subcutaneously TNF-α) and IL-3 IL-2, (IL-1α, tokines for theaugmentedscratchingbehavior, weinjectedvariouscy known toinduceitch.Inorderevaluatethefactorsresponsible (iNOS) mRNA inmicewasobservedbothofthosemoleculesare precursor ofsubstanceP (SP),andinduciblenitricoxidesynthase model, theexpressionofpreprotachykinin-A (PPT-A) mRNA,a 1034 9 th WorldCongressofItch FUTURE PERSPECTIVES ------Primary sensory neurons in dorsal root ganglia (DRG) play an es Johns HopkinsUniversitySchoolofMedicine,USA Xinzhong Dong BIOLOGY OF ITCH OF ITCH:MRGPRRECEPTORS AND THE FUTURE PERSPECTIVESINBASICRESEARCH OP86 itch mechanisms. us tomonitorDRGneuronalactivitiesinvivoandunveilnovel In addition,wehavedevelopedimagingtechniqueswhichallow innate immunecellsfoundinmanytissues,areinvolveditch. DRG neurons,wearealsointerestedinhowmastcells,atypeof in the spinal cordis likely not mediated by labeledline. Besides labeled lineinDRGforitchcoding.Ontheotherhand,coding neurons in DRG and demonstrated for the first time that there is a We have geneticallylabeledandmanipulatedMrgpr-expressing studies. psychophysical human by confirmed been have works peptides, drugs,aminoacids,andproteases.Importantly, themouse receptors bydirectlysensingvarietyofitchysubstancesincluding DRG neurons. We foundthatseveralMrgprs functionasnovel these receptorsareexclusivelyexpressedindistinctsubsetsof of Gprotein-coupledreceptorsinmicecalledMrgprs. Manyof the spinal cord via their central axons. We identified a large family through theirperipheralaxonsintheskinandsendingsignalsto sential role in generating itch bydetecting painful and itchy stimuli histamine 4receptorantagonists. and E4inhibitors phosphodiesterase antagonists, factor (NGF) kappa agonists,neurokinin-1receptorantagonists,nervegrowth trial resultshaveshownpromisingformuantagonists/ has thuswonrecognitionasarepresentativeindication.Current is selectedastheprimaryendpoint.CP inchronickidneydisease of pruritusareaddressedinthetrialsandCP ofasystemiccause mechanisms forneuronaltransmission,inductionandperception are arepresentativeexampleforthis.Ontheotherhand,central antibodies againstinterleukin(IL)-31orIL-4/IL-13receptors endpoint arerecorded. Atopic dermatitisanditstherapieswith changes tothepruritusasasymptomofdiseaseandprimary of cytokines)intheacutephasediseases,duringwhichany blocking (e.g. mechanisms disease inflammatory-based mainly specific, of influence the for examined are substances new hand, be distinguished byanalyzingtheutilized substances. Onone prurigo andepidermolysisbullosa. Two therapeuticconceptscan CP suchasuremicpruritus,atopicdermatitis,psoriasis,chronic (n=77) andareevaluatingnewsubstancesforvarioustypesof - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV litation Hospital, Hyogo, cal andDentalUniversity, Tokyo, repulsion factorssemaphorin3A wasdecreased. The application expression ofnerve growth factor wasincreased andthat ofnerve knockout mice.Inbothwildtype andHDCknockoutmice,the nerve fibers into the epidermis in wild type mice, but not in HDC The repeatedSDSexposureincreased theelongation of peripheral tamine on SDS-induced neuronal sprouting into the epidermis. into theepidermis.Inthisstudy, weinvestigatedtheroleofhis histamine maycontributetotheinductionofneuronalsprouting density of intraepidermal nerve fibers. These findings suggest that repeated applicationsofSDStomouseshavedskinincreasedthe histamine intheepidermis,ourpreviousreporthasshownthat enzyme histidinedecarboxylase(HDC)andtheconcentrationof tion totheincreaseofexpressionhistamine-synthesizing in laundrydetergents, dishdetergents andshampoos.Inaddi decyl sulphate(SDS)isasyntheticsurfactantcommonlyfound inducedbysoapsremainunclear. Sodiumdo mechanism andthefactorsassociatedwithcutaneoussensory ces itchinessandisinducedbyseveralstimuli.However, the symptoms. hypersensitivity sensory to cutaneous This enhan canlead soaps with yourskin The repetitiveactofwashing 1 Yoshihiro Inami WITH ITCHINGINDUCEDBY SURFACTANT NERVE ELONGATION INTO EPIDERMISOF MICE HISTAMINE ISINVOLVED INPERIPHERAL PP2 lipid mediators. serotonin andhistaminerelease AGMO-dependent bioactive that itchinthemousepartlydependsonGch1/BH4-dependent and gain-of-function experiments of myeloid-specific Gch1 show skin, afunctionofBH4-dependent AGMO. Together, theseloss- additionally augmenting itch-suppressing bioactive lipids in the inhibition providedevenstrongeritchsuppression,mediatedby production. Diaminohydroxypyrimidine(DAHP)-mediatedGch1 tive changesofnitricoxide,butdidnotinvolvehydrogenperoxide mine andserotoninreleasefrommastcells,contributedbyrespec knockout (LysM-Gch1 Gch1 specific myeloid Cre-mediated M lysozyme in functions behaviourandmyeloidcell studied we pain anditch.Hence, we askedhereifGch1ofmyeloidimmunecellscontributedto models. While thesepreviousstudiesaddressedneuronalGch1, its knockout in nociceptive neurons reduces nociception in various coupling ofnitricoxidesynthases(NOS).InhibitionGch1or biogenic aminesynthesis,bioactivelipidmetabolismandredox zyme cofactor, tetrahydrobiopterin(BH4),whichisessentialfor GTP cyclohydrolase(Gch1)governstheproductionofen Institute forClinicalPharmacology, GoetheUniversity, Frankfurt,Germany schinger, Irmgard Tegeder Caroline Fischer, ITCH MYELOID GTP-CYCLOHYDROLASECONTROLS PP1 effects weremediatedbyinhibition, respectiveincrease,ofhista and non-histamineevokeditchmodels. The anti-andpro-itching and itsoverexpressionincreasedtheitchingresponseinhistamine and sciatic nerveinjury, butLysM drivenGch1knockout reduced, behaviour in various models including formalin, paw inflammation HA). Knockoutoroverexpressionhadnoeffect onnociceptive University ofToyama, Toyama, Japan Yasushi Kuraishi Fundamental Research Laboratory, HoyuCo.,Ltd., Aichi, 3 1 , Tsugunobu Andoh , Katja Zschiebsch, Atsushi Sato 3 -/- Research Administration Division, Tokyo Medi- ) andoverexpressing mice (LysM-Gch1- 4 Department of Applied Pharmacology, 2 , Hiroshi Ohtsu 4 Annett Häussler, KatrinWat- 2 , Yosuke Mano 2 Tekiju Rehabi POSTERS 1 ------, therapy in combination with the5-HT tagonist utilizedinchemotherapy-inducednauseaandvomiting is aselective,longlastingandbrainpenetrantNK-1receptoran for treatingchronicandmalignancy-associatedpruritus.Netupitant tagonist aprepitanthasbeenshowninsmallstudiestobeeffective preclinical aswellclinicalstudies.Forexample,theNK-1an and NK-1antagonistsdemonstratedantipruriticpropertiesin Spinal NK-1 receptors play an important role in itch transmission 1 Girolamo Calo’ MICE ANTAGONIST NETUPITANT ONITCHMODELSIN THE EFFECTSOF THE NK-1RECEPTOR PP3 atopic dermatitis-likepruritic dry skin(M.Fujiietal.,Exp. containing nopolyunsaturatedfatty acidsandnostarchdevelop We havepreviouslyshownthathairless micefedaspecialdiet and thermalpainsensitivityin a chronicdryskinmousemodel. activation ofRVM 5-HT neuronsontouch-evokedscratching study, usingoptogenetics,weexaminedtheeffects ofselective pain modulation, theirrole in alloknesis remainsunclear. In this descending RVM 5-HT neuronsarewellknowntocontribute taining 5-HT neuronsdescendingtothespinalcord. Although the contributing topersistingitch.RVM isabrainstemregioncon with wool)oftenelicititchsensation(calledalloknesis),thus In atopicdermatitis,innocuousmechanicalstimuli(e.g.,contact 1 Masanori Fujii INDUCED CHRONICDRY SKINMOUSEMODEL TOUCH-EVOKED SCRATCHING IN A DIET- VENTROMEDIAL MEDULLA (RVM) FACILITATES GIC (5-HT)NEURONSIN THE ROSTRAL OPTOGENETIC ACTIVATION OF SEROTONER­ PP4 Ohya histaminergic itch. is worthy of development as innovative drug for treating non results suggestthatNK-1receptorselectiveantagonistnetupitant behavior elicitedbycompound48/80inmice.Inconclusionthese is noinvolvementofNK-1receptorsignalinginthescratching mast cells are not the cell target for the action of SP and that there substances but not compound 48/80. This latter effect suggests that all of effect pruritogenic the manner significant statistically a in (2 hpretreatment). The resultsshowedthatnetupitantreduced were selectedtobechallengedagainstnetupitant10mg/kgp.o. approximately promoting 100bouts ofscratching in 30min, effects. Fromthesedoseresponse studies,equieffective doses, compound 48/80(1–50µg)eliciteddosedependentpruritogenic cloroquine (10–200nmol),deoxycholicacid(25–250µg),and of scratchingwerecountedfor 30 min. Substance P (10–100 nmol), (i.d.) in the rostral part ofthe mouse back andthe number ofbouts with different mechanism of action were injected intradermally antipruritic actionofnetupitantinmice.Pruritogenicsubstances Thus, theaimofthisstudywas the investigationof the putative skin treatedrepeatedlywithSDS. important role in intraepidermal nerve fiber elongation in murine neurons. Therefore, theseresultssuggestthathistamineplaysan in small-sized, but not large-sized, mouse dorsal root ganglion of histamine increased the total length and the maximum length Ferrara, Italy, USA, Department of Medical Sciences, Section of Pharmacology, University of Neurobiology, Physiology & Behavior, University of California, Davis, 2 2 Kyoto PharmaceuticalUniversity, Kyoto, Japan , Mirela IodiCarstens 2 Helsinn Healthcare SA,Lugano,Switzerland 1 1,2 , Anna Rizzi , Taylor Follansbee 1 1 , EarlCarstens , ChiaraRuzza 3 1 antagonist palonosetron. , Acta DermVenereol 2017 Poster abstracts Yuma Yasui 1 1 , ClaudioPietra 2 , Susumu 1035 2 - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta that TRPV3 activationinduced TSLP expression. nels withPKA,PKC,PKDsignaling pathways.Italsoseemed edly reducedintracellularCa nels. TRPV3 activationitselfresultedinlittleincreaseofCa vation, intracellular Ca acti scars. 3 TRPV burn With pruritic in increased significantly and proteinlevelsofPAR2, NK1R, TSLP, and TSLPR werealso keratinocytes fromnon-pruriticburnscars.Inaddition,mRNA more abundant in keratinocytes from pruritic burn scars than in significantly were TSLP and TRPV3 of mRNA that showed patients, thanthatofnon-pruritic-burnpatients.Realtime-PCR more intensely the epidermis of the burn scars of post-burn-pruritus immunofluorescence staining, TRPV3, TSLP, and TSLPR stained blotting andreal-timePCR.Results:Inimmunohistochemical after TRPV3 activation in keratinocytes were measured by western fects ofPAR2 agoniston TRPV3 function.Expressionsof TSLP Ca PCR andwesternblottingweredone. We measuredintracellular performed onsamplesofburnscarsandnormalskin.Real-time TSLP, and TGF-a,were TSLPR, loricrin,involucrin,b-SMA, ing for TRPV3 and TRPA1; and immunofluorescence staining for from thosesampleswereseparated.Immunohistochemicalstain investigated, including skin biopsies. Keratinocytes and fibroblasts (n=40)orwithout=25)prurituswere with patients burn five considered toberelatedpathwayofpruritus.Methods:Sixty- fully elucidated. Transient receptor potential(TRP)channelsare have asatisfactoryoutcomebecausethemechanismhasnotbeen of burnwounds.Empiricalantipruritictreatmentoftenfailsto Background: Post-burnpruritusisacommondistressingsequela Department ofDermatology, KangnamSacred HeartHospital,Japan Jung, ChunWook Park Hye One Kim, TRPV CHANNELS AND POST-BURN PRURITUS PP5 biting thermalpain. of RVM 5-HT neuronsfacilitatestouch-evoked itch,whileinhi results suggestthatunderchronicdryskinconditionsactivation significantly decreased by the stimulation. Therefore, the present pain-related thermal response (measuredby Hargreaves test)was scratching inspecialdiet-feddryskinmice.Ontheotherhand, the optogenetic stimulation significantly increased touch-evoked Consequently, testing. behavioral during fiber optic implanted the RVM. Bluelight(20Hz,5mspulses)wasdeliveredviathe above just implanted was fiber optic an then and neurons 5-HT the RVM ofFev-CremiceinwhichCreisexpressedcentral Cre-inducible adeno-associatedviruscarryingChR2geneinto hodopsin-2 (ChR2)inRVM 5-HT neurons, wemicro-injecteda mice. To selectivelyinducealight-activatedchannelchannelr diet-fed C57BL/6micewithdryskin,althoughrarelyinnormal of theskinfrequentlyevokedsite-directedscratchinginspecial the shaved back skin. The low-threshold mechanical stimulation loknesis was assessed using 0.7 mN von Frey filaments applied to to C57BL/6mice,similardryskinconditionswereinduced. Al Dermatol., 24:108-13,2015). When thisspecialdietwasgiven 1036 from all samples, PLC-β, PKA, PKCs, and PKD inhibitor mark inhibitor PKD and PKCs, PKA, PLC-β, samples, all from keratinocytes In keratinocytes. in inhibition PAR2 with influx following TRPV3 activation andblocking,measuredtheef PAR2 activationmarkedlypotentiatedopeningof TRPV3 chan from non-pruriticones.Inkeratinocytespruriticburnscars, increased inkeratinocytesfrompruriticburnscarsthanthose scars. In addition, it seemed that PAR2 sensitized TRPV3 chan NK1R, TSLP, and TSLPR werehighlyexpressedinpruriticburn conclusion, we confirmed that TRPV3 of keratinocytes and PAR2, and proteinexpressionof TSLP inkeratinocytes. Conclusions:In as byPAR2 activation. TRPV3 activationalsoincreasedmRNA 2+ levelsinkeratinocytesfromscarswithorwithoutpruritus, 9 th WorldCongressofItch Yong Won Choi,Jee Hee Son,Yong SeJo,BoYoung 2+ concentrations were more significantly more were concentrations 2+ levelby TRPV3 activation,aswell 2+ ------

or [D-Trp D-Trp in[Leu Tohoku MedicalandPharmaceuticalUniversity, Japan fective durationonscratchingbehaviorinmicewithchronicitch. However, it is not clarified whether [Leu mal injectionofsomepruritogenssuchashistamineorserotonin. pretreatment with[Leu of11sisting aminoacids.Recently, thatthe demonstrated we Hemokinin-1 (HK-1)isamammaliantachykininpeptidecon 1 Hideki Funahashi CHRONIC ITCH ON SCRATCHING BEHAVIOR INMICE WITH EFFECT OF [LEU11]-HK-1-DERIVED PEPTIDES PP6 responses to5-HT. Voltage clampexperimentswerecarriedoutin the cAMP analog, 8-Br-cAMP (10 μM) did not affect the sustained respectively. The adenylyl cyclase activator forskolin (10 μM) or TRPA1TRPM3, for μM) (0.5 HC-067047 TRPV4 and and μM) the more selective antagonists: CIM 0216 (1 μM), A967079 (5–10 Ruthenium Reddidnotinhibit the sustainedresponses.Nordid The broad-spectrum Transient Receptor Potential channel blocker the intracellular pathways leading to the sustained calcium influx. by 5-HT. As 5-HT1A isametabotropicreceptor, weinvestigated was able to irreversibly inhibitthe sustained responses evoked WAY-100,635antagonist receptor 5-HT1AnM) The (100 μM). but werenotinhibitedbythe5-HT7antagonistSB269970(1–10 elicited by the 5-HT1A and 5-HT7 agonist 8-OH-DPAT (10 μM) that weresensitiveto5-HT. The samekindsofresponseswere neurons in solely responses, sustained CT,only induced μM) 50 neurons. The non-selective agonist 5-Carboxamidotryptamine (5- agonist SR 57227 (1–10 μM) elicited similar responses in the same (1 μM) completely inhibited transient responses while the 5-HT3 ing totheirkinetics. The selective5-HT3antagonistgranisetron accord sustained and transient as classified were μM) 5-HT(50 a fast-exchangesuperfusionsystem. The calciumresponsesto Green-1 AM and imaged while being chemically stimulated using on glasscoverslips. After 24h, the cellswere loaded withCalcium from adult male Wistar rats and dissociated neurons were cultured cultures ofratsensoryneurons.DRGand TG weredissectedout patch clamp technique to investigate the action of 5-HT in primary (TG) ganglion neurons. We used calcium microfluorimetry and the subtypes expressedintheratdorsalroot(DRG)andtrigeminal nervous system. Our aim was to identify the specific 5-HT receptor Serotonin (5-HT)mediatesbothpainanditchintheperipheral 1 Dan Domocos DORSAL ROOT GANGLIONNEURONS IN CALCIUMINFLUXCULTURED RAT SEROTONIN RECEPTOR SUBTYPESINVOLVED PP7 HK-1-derived peptidesinmicewithchronicitch,[Leu injection of[D-Trp 30 minutes,whiletheeffect lasted until24hoursafterintrathecal induced bybothintrathecaladministrationofHK-1andintrader of HK-1wasreplacedbyLeu,producedadecreaseinscratching University ofCalifornia,Davis,USA Rumi Nakayama-Naono mice withchronicitch. Therefore, toclarifytheeffect of[Leu (D-Trp), change theeffective durationonscratchingbehaviorin in whichapartofaminoacidswasreplacedbyD-tryptophan Medicine, University of Miyazaki, chronic itch was attenuated by administration of[Leu attenuatedbyadministration chronic itchwas of diphenylcyclopropenoneonthenape.Scratchinginmicewith stens Division of Psychiatry, Department of Clinical Neuroscience, Faculty of University ofBucharest, Romania, 2 , AlexandruBabes 9 ]-[Leu 1 11 , ]-derived peptidesplaysacrucialroleintheef Tudor Selescu 11 ]-HK-1 was intrathecally injected after painting ]-HK-1 was intrathecally injected after painting 1 9 , ]-[Leu Yu Miyahara 11 2 , Toshikazu Nishimori 1 ]-HK-1, inwhichMetattheC-terminal 11 ]-HK-1. These resultsindicatethat 1 2 2 , Division of Anatomy and Cell Biology, Neurobiology, Physiology & Behavior, Earl Carstens 1 , Ayaka Haruta-Tsukamoto 11 ]-HK-1-derived peptides, ]-HK-1-derived peptides, 1 2 , Yasushi Ishida , Mirela IodiCar 11 ]-HK-1 until until ]-HK-1 11 ]-HK-1 1 11 ]- 1 - - - - - , Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV ter, Germany to serotonin-induceditchisdevelopedincholestaticmice. Conclusion: Despite the potentiation of evoked itch, a resistance the scratchingbehaviorwasnotaffected bymotordysfunctions. between PL andPH,376DEGsbetweenPL andHH only (DEG) database. genes deregulated 276 A revealed analysis first pathway analysiswemadeuse of Reactome,afreeopensource with anabsolutelog2-foldchange >1andap-value<0.05.For R/Bioconductor package limma. Deregulated genes were defined Due tothesmallsamplesizedata processingwasdoneusingthe were generatedusing Affymetrix HumanGene1.0ST Arrays. PH) and 5 HCs (healthy = HH) were included. Expression profiles Biopsies from5PNpatients(lesional=PL;healthy/non-lesional = (HC). controls healthy matched and patients PN in profiles sion therapeutic targets. Therefore, weperformedglobalgeneexpres into affected pathways and involved genes may help to define new quality, effective therapiesarestillnotavailable. A deeperinsight nodules. Although CPGshowsahighnegativeimpactondailylife characterized bycontinuousscratchingthatleadstomultipleitchy Prurigo nodularis(PN)isasubtypeofchronicprurigo(CPG).It is 1 Konstantin Agelopoulos PRURIGO NODULARIS GLOBAL GENEEXPRESSIONPROFILINGIN PP9 from un-operated (UNOP) mice on 5 differentsignificantly not was mice SHAM BDLor of activity in BDL mice compared to SHAMmice. Likewise, the locomotor behavior induced by serotonin or sertraline was significantly less after surgery, while it did not induce itch at day 5. The scratching scratching behaviorinBDL micecomparedtosalineatday7 gery. inducedAdditionally, significantly sertraline or serotonin scratching responsestosalineinjectiononthe7 Results: bouts towardstheinjectionsiteoveronehouraftertreatments. scratching paw hind of quantification by assessed was itch and the rostralbackareainBDL andsham-operated(SHAM)mice, Serotonin, sertraline or saline were administeredintradermallyto Methods: we investigatedtheserotonin-induceditchincholestaticmice. of serotoninhavenotbeenevaluatedincholestaticmice.Here, cated incholestaticitch;however, thepruritogenicproperties impair thequalityoflifepatients.Serotoninsystemisimpli significantly and severe be can itch Cholestatic Introduction: 1 Sattar Ostadhadi CHOLESTATIC MICE RESISTANCE TO SEROTONIN-INDUCED ITCHIN PP8 the calciuminfluxelicitedby8-OH-DPAT and5-CT. This is supported by the inhibitory effect of WAY-100,635 and by sponses arelikely mediated bythe5-HT1A metabotropic receptor. are mediatedbythe5-HT3ionchannelwhilesustainedre nM). In conclusion, ourresultssuggest that thetransient responses tential of-80mV. These currentswereinhibitedbygranisetron(10 and revealedonlytransientcurrents(5-HT3-like)ataholdingpo 5-HT-sensitive DRGneuronspre-selectedwithcalciumimaging, Research Center, MassachusettsGeneralHospital,Boston,USA en, and Molecular Physiology oftheBrain,Georg-August UniversityGötting- Hospital Münster, Münster, Sciences, Tehran, Iran, Dugas san Azimi Department ofDermatology and Center forChronic Pruritus,University Experimental Medicine Research Center, Tehran University of Medical 3 Institute ofMedicalInformatics,UniversityHospitalMünster, Müns- 3 , SonjaStänder Bile duct ligated mice had significantly increased significantly had mice ligated duct Bile 2 , SarinaElmariah Cholestasis wasinducedbybileductligation(BDL). 1 , Nazgol-Sadat Haddadi 2 Department of Dermatology, Cutaneous Biology 1 2 1 Cluster of Excellence: Nanoscale Microscopy , Tobias Lotts 2 , Ahmad-Reza Dehpour th and 7 1 , Heike Conrad 1 , ArashForoutan th day, suggesting that th dayaftersur 1 2 , Martin 1 , Eh------Austen School, triggering pruriceptorneuronsthroughCysltr2toproduceitch. Our studyimplicatesLTC4 asarelevantendogenousligandfor inflammation. skin and dermatitis atopic of models mouse in We are testing the functional relevance of this signaling pathway By contrast,LTD4 didnotproduceitchorneuronalactivation. also inducedneuronalactivationanditchdependentonCysltr2. N-methyl LTC4 (NMLTC4), thenonhydrolyzableformofLTC4, in mice,andthisitchbehaviorisdecreasedCysltr2-/-mice. capsaicin. IntradermalcheekinjectionofLTC4 triggersscratching activates asubpopulationofsensoryneuronsthatalsorespondsto behaviors inmice.Usingcalciumimaging,weshowthatLTC4 Cys-LTs activatessensoryneuronsandproducesitch-associated cells duringallergicimmune inflammation. We firsttestwhether neuronal Cysltr2actstodetectCys-LTs intheskinreleasedby neurons thatco-expressIL31raandNppb. We hypothesizethat pruriceptor in enriched highly is Cysltr2 that find we neurons, affinities. Using transcriptional profiling analysis of somatosensory LT receptor(Cysltr1)ortype2(Cysltr2)withdifferent LTC4 and LTD4 have been found to signal through the type 1 cys- initiates theproductionofthreeCys-LTs: LTC4, LTD4, andLTE4. Cysltr2 receptorinitch.LTC4 synthase(LTC4S) istheenzymethat investigate theroleofCys-LTs andtheirsignalingthroughthe we Here dermatitis. atopic in inflammation skin and asthma in by immune cells that play a prominent role in lung inflammation leukotrienes (Cys-LTs) areeicosanoidlipidmediatorsreleased tization inallergic conditionsarenotwellunderstood.Cysteinyl mechanisms underlyingpruriceptorneuronactivationandsensi matitis withfeweffective treatments. The molecular andcellular Itch isassociatedwithallergic skindiseasessuchasatopicder 1 Tiphaine Voisin CYSLTR2 RECEPTOR INPRURICEPTION ROLE OF CYSTEINYL LEUKOTRIENES AND THE PP10 revealed that ATP-sensitive potassiumchannels(K which convey itch signals to the central nervous system. It has been pathway. Chloroquinedirectlyexcitesperipheralsensoryneurons scratching behaviorin rodents throughahistamine-independent Introduction: Chloroquine (CQ)evokes itch in human and ences, Tehran, Iran Experimental Medicine Research Center, Tehran University of Medical Sci- Nazgol-Sadat Haddadi, SCRATCHING BEHAVIOR INMICE CHANNELS INCHLOROQUINE-INDUCED INVOLVEMENT OF ATP-SENSITIVE POTASSIUM PHARMACOLOGICAL EVIDENCEFOR THE PP11 investigate the involvement of K important inregulatingneuronal excitability. Thus, weaimedto knowledge ofmoleculesandpathwaysinvolvedinPNpathology. analyses ofthedataareunderwayandmayprovideanevendeeper NGF,by Further others. and envelope cornified the of formation in variouspathwayslikesignallingbyinterleukins, analysis revealedDEGsofthelattercomparisontobeenriched HH (n=9)andPL vs.PH/HH(n=223)werecalculated.Pathway and HH.Different settingsforoverlappingDEGslikePL/PHvs. 58 geneswerefound to bedifferentially expressedbetweenPH and Women’s Hospital,Boston, ,USA at doseof400µg/siteinducedthe scratchingbehavior. The K and itch.MaterialsMethods: Intradermal(id)injectionofCQ which mayalsorevealalinkage betweenmetabolicstateofcells mad-Reza Dehpour Department ofMicrobiology and Immunobiology, Harvard Medical 2 2 , IsaacM.Chiu Division of Rheumatology, Immunonology, and Allergy, Brigham 1 , Amelie Bouvier 1 Sattar Ostadhadi, ATP 1 , Yoshihide Kanaoka channels in CQ-induced itch channels in CQ-induced itch Acta DermVenereol 2017 Poster abstracts Arash Foroutan, ATP channels) are channels)are 2 , K. Frank 1037 Ah- ATP - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta We suggestthatK expression ofKcnj8isdecreasedafterCQinjection.Conclusion: the that show also qRT-PCR analysis of findings Our MIN. and DZX of effects anti-pruritic the reversed significantly IP) mg/kg, scratching behaviorinmice.Moreover, pretreatmentwithGLI(3 kg, IP) or MIN (10 mg/kg, IP) significantly attenuated CQ-induced Piotr Kupczyk IN TRANSMISSION OF ITCH TERMINALS SNDEPIDERMAL KERATINOCYTES INTERPLAYS BETWEEN AXONAL NERVE HYDROLASE L1/PGP9.5IN PSORIASIS: EXPRESSION OF UBIQUITINC-TERMINAL PP13 involved inclinicallyobserveditchsensitization. rather distinct and perhaps prolonged inflammatory that processes are and dermatoses inflammatory of sensitization itch mimic observed. This suggeststhatthesemodelsdonotappropriately Contrarily, significant increases specifically for pain ratings were of themodelsincreasesitchratingtochemicalprovocations. hyperalgesia (p<0.01)andmildhyperknesis<0.05),butneither Both theUVB- and theNGF-modelinducesrobust primary painful analog scale. Hyperknesis was measured with von Frey filaments. primary hyperalgesicareasanditch/painwasscoredonavisual itch was evoked using histamine (1%) and cowhage spicules in the measurements wereconductedtovalidatemodels.Subsequently, volar forearms,whilesalinewereusedascontrol.Painsensitivity both into areas) diameter cm 2 in blebs μl (4x50 injected were NGF of μg (5F/11M)2 volunteers and healthy included 16 were dose) andtwospotsactedascontrols.FortheNGF-experiment ated withincreasingUVB-doses(upto2xminimalerythemal included. Six volar forearm spots (2cm in diameter) were irradi For theUVBexperiment,20healthyvolunteers(10F/10M)were chemical (histamineandcowhage)mechanically-evokeditch. (induced byintradermal NGF-injections) altered sensitivity to sensitization pain neurotrophic non-inflammatory and damage) established unspecific inflammation (induced by epidermalUVB- human modelsofnociceptivesensitizationtoexplorehowpre- as wellspontaneousitchandpain. We usedtwowell-established inflammatory perturbations to cause pain and/or itch sensitization of ability the influencing circumstances the is as unclear are tion dermatitis. The precisemechanisms behindsuchitchsensitiza stimuli hasbeenfoundinpatientswithchronicitch,e.g.atopic Itch sensitization to pruritic chemical provocations and mechanical 1 Silvia Lo Vecchio COWHAGE BUT NOT ITCH,ELICITEDBY HISTAMINE AND SENSITIZATION SELECTIVELY INCREASEPAIN, ITCH? –BOTHUVB- AND NGF-INDUCED HISTAMINERGICNON-HISTAMINERGIC AND MODELING OF ITCHSENSITIZATION FOR PP12 the genesencodingK the possiblechangesindermalexpressionofKcnj8andKcnj11, reverse transcription-PCR(qRT-PCR) wasalsousedtoinvestigate of hindpawscratchingboutstowardstheinjectionsite.Quantitative toneally (IP) before CQ. Then, itch was assessed by quantification channel openers, diazoxide (DZX) and (MIN), and a K 1038 channel blocker, glibenclamide(GLI),were administered intraperi Hospital, Gentofte,Copenhagen,Denmark Arendt-Nielsen Jacek C.Szepietowski University, ment ofHealth Science and Technology, Faculty of Medicine, Aalborg Laboratory forExperimental Cutaneous PainResearch, SMI®,Depart- 9 th 2 WorldCongressofItch Department ofDermato-allergology, CopenhagenUniversity 1 1 , acn Hołysz Marcin 1 ATP , Hjalte H. Andersen Hjalte channelsareinvolvedinCQ-induceditch. 4 ATP channels.Results:EitherDZX(10mg/ 2 , Mariusz Gajda Mariusz 1 , Jesper Elberling 3 , Adam Reich 2 , Lars ATP 4 - - - ,

item reduction, the Itch-Controlled-Days (ICD)questionnaire (p= 89CP patients). After itemgeneration,feasibility-check and day controlled itch an defining parameters the identify to helped the developmentpartofstudy structuredpatientinterviews of pruritus within clinical routine and research. a varietyofpruritus-relevantsymptoms andtoevaluatethecontrol (CP) patients. A newly developed questionnaire aimes to measure to affect thediseaseburdenandqualityoflifechronicpruritus symptoms assleepingorscratchingbehaviorhavebeenshown Background: Besides pruritus intensity different associated Department ofDermatology, UniversityHospitalMünster, Germany thias Augustin, Nani Osada,LaurieBurke,ChristineBlome,ClaudiaZeidler, Mat- Sabine Steinke CONTROLLED-DAYS SCORE” PRURITUS SYMPTOMS SCORE– THE “ITCH- OFDEVELOPMENT ANEW, ALL-ENCOMPASSING BEHAVIOR BESIDESPRURITUSINTENSITY: MEASURING SCRATCHING AND SLEEPING PP14 in molecularaspectofpsoriaticitch. about peripheralinnervationsandneuro-immune-endocrinecells transcript and its protein PGP 9.5 may demonstrate new findings that thisunusualandimpairedexpressionpatternbetweenUCHL1 to skinwithoutitchandcontrolgroup.Conclusions:Webelieved, mRNA innon-lesionalandlesionalskinitchygroupcompare pression results demonstrate significant downregulation of UCHL1 with itchwerealsoobserved.Incontrast,real-timePCRgeneex expression withinbasalkeratinocytesandsuprabasal Additionally, significant relations between non-neuronal PGP9.5 on VAS score) comparing toskinwithoutitchandcontrolgroup. tion ofPGP9.5nervesinnon-lesionandlesionsitchyskin(basing level was estimated by immunofluorescence microscopy. expression wasperformedusingreal-timePCR,whereasprotein psoriasis patientsand20normalskinofhealthyindividuals.Gene non-lesional andlesionalsiteoftheskinwereobtainedfrom itch. might controlskinneuro-immune-endocrinestatusandescalate and non-neuronalcellsviacommonUCH-L1/PGP9.5expression sensations. Itseemsthatdisorderedinterplaysbetweenneuronal cancer, impairedimmunefunctions,tissueinjuryandpain-related (CNS), whileitsdisordersarelinkedwithneurodegeneration, PGP9.5 iswidelyexpressedintheCentralNervousSysytem terminally conjugatedubiquitinfromsubstrateproteins.UCHL1/ responsible forcleaveofC-terminalpeptideadductsaswellN- belongs tothedeubiquitinaseenzyme(DUBs)family, whichis UCHL1 geneandPGP9.5protein(UCHL1/PGP9.5system) Ubiquitin C-terminalhydrolaseL1(UCHL1)iscommonlyused. biochemically proteingeneproduct9.5(PGP9.5), endocrine cells neuro-immune- well as fibers, nerve skin of distribution and identification For keratinocytes. and melanocytes, Langerhance, fibroblasts, cells: neuro-immune-endocrine of activity abnormal nerveterminals,butadditionalmodulatevia anddisordering wing enhanced transmissionofitchmightbyinducednotonlyoutgro lion (DRG) neurons. However, in chronic skin neuroinflammation mediated via skin C-fibers, axonal terminals of dorsal root gang multisystem immunegeneticskindisease.Itchtransmissionis Introduction: Itchisunpleasantsensationoccurringinpsoriasis, 1 Fluorescence microscopy imaging demonstrate impaired distribu lonian University, Krakow, Allergology, SilesianPiastWroclaw MedicalUniversity, Wroclaw, Poland Poznan, Molecular Biology, Karol Marcinkowski UniversityofMedicalSciences, Wroclaw Medical University, Wroclaw, Department ofPathomorphology, Faculty of Medicine, Silesian Piast Material andMethods: The 20skinpunchbiopsiesfrom 3 Department of Histology, Jagiellonian Medical College, Jagiel , Sonja Ständer Henk Wassmann, Frederik Braun, KirstinMenne, 4 Department ofDermatology, Venereology and 2 Department ofBiochemistry and Methods: Within Results: - - - - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV dieux forms of , referred for medical care in the first quarter of quarter first the in care medical for referred vitiligo, of forms cards andapplication-questionnaires ofthepatientswithvarious and Methods:Materialusedinthisresearchincluded ambulatory characteristics ofpruritusinthe patientswithvitiligo.Material Purpose of research: Identification of the prevalence rate and basic Republican Scientific-Research InstituteofDermatologyand Venereology Elkham Karaev VITILIGO IN ITCH ASACCOMPANYINGSYMPTOM PP16 easy touse. pruritus. This productcanbeconsideredaseffective, safeand diseases: atopicdermatitis,psoriasis,chronicurticariaandsenile skin chronic in spray antipruritic an use to interest the confirms study was well-toleratedin99.2%ofsubjects.Conclusions:This patients). of (98% product the by satisfied very product the And, half adayin56%ofsubjects. The majorityofthesubjectswere It relievespruritusin21secondsonaverageandtheeffect lasts (–52%), roughness(–53%),scales(–58%),suppleness(+26%). In parallel, a significant improvement of skin conditions: dryness sensations ofitching(–63%)wasobservedbetweenD0andD21. average. A significant decrease of 5-D pruritus scale (–40%) and of 41yearsold(±27). The productwasapplied 2.5timesadayon included 118 subjects(63malesand55females)withameanage Tolerance wasalsoassessed.Results: The analyzedpopulation sensations and skin conditions with numerical scale (0 to 9). and D21byusing5-Dpruritusscale(5to25),scoringitching D0 at performed were pruritus on assessments Efficacy days. 21 was sprayedmanytimesasneededonthebodyandfaceduring including 120patients(30subjectsineachgroup). The product nal, prospectiveandmulticentrestudywasperformedinPoland urticaria and . 4 dermatologicaldiseases:atopicdermatitis,psoriasis,chronic including Skinrelief™technology. This productwastestedin itching the calm quickly to spray antipruritic an of efficacy the assess to was the context, this In activation. fibre nerve reduces Lymphopoietin, NerveGrowthFactorandhistamine. And so,it It inhibitsthereleaseofpruriticmediatorslike Thymic Stromal enoxolone were developed to have a significant action on pruritus. case forsenilepruritus. The SkinRelief™technology associated to and urticaria.Itissometimesrelatedtocutaneousdryness,asthe related tovariousskindiseasessuchasatopicdermatitis,psoriasis Pruritus maybeoccasionalorchronic,localwidespread,and in dermatology, affecting overone-thirdoftheworldpopulation. ting inanurge toscratch.Pruritusisthemostcommonsymptom Introduction: Pruritus is defined as an unpleasant sensation resul 1 Sandrine Virassamynaik OBSERVATIONAL STUDY PRURITUS RELATED TO SKINDISEASES: AN THE USEOF A DERMOCOSMETIC TO MANAGE PP15 helps toassesstheitchcontroleasilyandsystematically. of different pruritus- relevant symptoms within one single score measurement to calculateascorefrom022.Conclusion:The DLQI) (allp<0.01). The 9itemsoftheICDquestionnaireallow intensity values(VAS, VRS, NRS)andqualityoflife(ItchyQoL, U testing showed moderate to strong convergence of pruritus >0.8). Spearman-Rho correlation analysis and Mann-Whitney- alpha >0.95; intraclass correlation coefficient > 0.9; Cohen’s kappa patients. behavior.scratching The scorewastestedandvalidatedin60 was created with nine items onpruritus intensity, sleepingand NAOS, Laboratoire Bioderma, 2 , JulieRiviere Results: Retest-reliabilitywasexcellent(Cronbach’s 2 , MichèleSayag 1 , Bernard Chadoutaud 2 ClinReal Online An observatio Material/Methods: An 1 2 , Charlène Ey- - - with atopicdermatitis.On2016,1 Nearly halfofthesubjectswithatopicdermatitishad 13.2 %ofstudents had a history ofdiagnosed as atopic dermatitis. manner. Finally, 3,135sheetswereeffectively analyzed.Intotal, history ofallergies andthedemographic factorsinaretrospective answered theself-completedquestionnaireaboutbothpast university entranceexam. lower thanweexpected,probablybecauseoftheirsuccesssin evaluated byvisual analogue scale. Magnitude was somewhat examination byspecialistindermatology. Magnitudeofitchwas disappeared onthebasisofmaindiseasetreatment. sed lookinglikeepisodic,limited,gradually females, developedonthebackgroundofdepigmentation,expres on thebasisofvitiligopruritusmostlyfrequentoccurredin pruritus. skin of elimination the of influence disappearance of pruritus, in 33 the treatment of vitiligo had no the background of the basic disease treatment 85 patients noted and 12fromdiseasesofurinaryexcretivesystemothers.On diabetes mellitus), 24 – from diseases of hepatobiliary system, system (all 3 patients with generalized pruritus suffered of various stage of severity, 47 – with pathology of endocrine accompanying disease revealed 58patients suffering from anemia at thenightorafternervous-psychologicalstress. Analysis ofthe pruritus of intensification/appearance observed patients 78 time observed in85patients,cyclicitywasnoted33,atthesame the prurituswasfoundrarely. Episodicpruritusappearancewas progressive skinprurituswasnotedin97patients,21patients found onlyin3attheageof44,53and55years. The gradually of prurituswasrevealedin115 patients,generalizedformwas 24 patientsafterformationofvitiligofocuses.Localizedform mented spots,in38patientsthepruritusappearedbeforeand This diseaseistransmittedthrough thebiteofaninfectedfemale ferent speciesoftheobligateintracellular protozoaLeishmania. Cutaneous leishmaniasis is aparasitic infection caused by dif pia Dermatology,of Department University, Abbid Ababa Ethio Addis Ababa, Tizita YosefKidane LEISHMANIASIS? IS ITCH A SYMPTOM OF CUTANEOUS PP18 1 ted clinicalcoursesincechildhood. At thehealthexaminationof and toevaluatethemagnitudeofitchin1 prevalence of Japanese adolescent subjects with atopic dermatitis, Thus, weconductedthequestionnairesurveytoinvestigate adolescent subjectswithatopicdermatitisispoorlyunderstood. withatopicdermatitis. adolescent subjects The pictureofJapanese Recent epidemiologicalstudiesrevealedtheincreasednumberof 1 Yosuke Okuda UNIVERSITY STUDENTS RETROSPECTIVE SURVEY OF FIRST-YEAR IN ADOLESCENT ATOPICDERMATITIS: PREVALENCE AND MAGNITUDEOF ITCH PPI7 noted appearanceofpruritusatthebasisoccurrencedepig 101 patients, generalized form – in 17 patients. Fifty-six patients women – 79 (about 67%). Localizedform of vitiligo occurred in symptom indisease.Of118 patientsmenwere39(about33%), them 118 (95%)patientsnotedskinpruritusasaccompanying questionnaires were obtained from 124 patients with vitiligo, of 2017. cine, and tayama Department ofDermatology, OsakaUniversity Graduate School of Medi- st -year students,allstudentswithatopicdermatitisgotclinical Results ofresearch: The ambulatorycardsandapplication- 1 , KeikoYamauchi-Takihara 2 Health Care Centre, OsakaUniversity, Osaka,Japan 1 , Mayuko Tahara 1 st , -year students of our university -year studentsofouruniversity 2 Hiroyuki Murota st Acta DermVenereol 2017 Poster abstracts -year university students -year universitystudents intensifying form and intensifying formand Conclusion: Thus, 1 , the protrac Ichiro Ka- due to 1039 - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta ess Hptlg ad curd mue Deficiencies, Immune Acquired and Hepatology seases, berling of Social and Behavioral Sciences, Leiden University, The Netherlands, evoke conditioned modulation ofitch. We systematically assessed is knownaboutdescendinginhibition ofitchandtechniquesto endogenous descending inhibition of itch(CIM) and pain, but little ficacy. In parallel, patients with chronic itch may exhibit decreased states signified by lowered conditioned pain modulation (CPM) ef Endogenous descendingpaininhibition isreducedinchronicpain 3 1 Holm Andersen Hjalte EFFICACY ASSESSING ENDOGENOUSITCHINHIBITION IN HUMANS–EXPERIMENTAL PARADIGMS FOR DESCENDING INHIBITIONOF ITCH AND PAIN PP20 with long-termdiseasedurationandsignificantliverfailure. of patients with viral hepatitis, most commonly in those subjects noted in the morning. Conclusions: occurrence was night andevening,the least common pruritus was found in14(63.6%)people. The mostcommon periodofpruritus was observedin3(13.6%)patients.Secondaryskinlesionswere site ofprurituswasthetrunk(n=13,59.1%),generalized patient suffered from hepatocellular carcinoma. The mostcommon In 15(68.2%)patientslivercirrhosiswasdocumented;one(4.5%) was stated. The duration of liver disease ranged from 3 to 22 years. ere diagnosed with type B hepatitis, whereas in 13 hepatitis type C medications and pruritus. liver diseaseanditsclinicalpicture,accompanyingillnesses, tionnaire containingquestionsabout general health, duration of included for furtheranalysis. The study wasbasedonanques A totalof22(20%)patientsaged25–68yearswithprurituswere performed among110 peopleinfectedwithHBV, HCV orboth. viral hepatitisBandC.MaterialMethods:Screeningwas of thestudywasclinicalcharacteristicsitchaccompanying aim may alsooccurinvarioussystemicdiseases.Objective:The leads toscratching.Itisacommonsymptomofskindiseasesbut Introduction: Itchingisanunpleasantsubjectivesensationthat 1 Anna Biernacka WITH VIRAL HEPATITIS B AND C ASSESSMENT OF PRURITUS AMONG PATIENTS PP19 although rarely, maybeasymptomofthedisease. of clinicalvariantscutaneousleishmaniasiscanoccurandicth, sociated withitch.Itshould bekeptinmindthatthewidespectrum patient clinicallymimickedsquamouscellcarcinomaandwereas forms ofcutaneousleishmaniasis.Inourcase,thelesion leishmaniasis. This case report alerts to the existence of atypical associated with itch, resembling squamous cell carcinoma-like report, Idescribeararevariantofcutaneousleishmaniasisinitially clinical features of the disease are being reported these days. In this which isusuallynonitchyentity, severalunusualandatypical status ofthehost.Inadditiontoclassicalclinicalpresentation, subspecies oftheLeishmaniainvolved,andimmunological the on depending forms clinical of variety a sandfly. in occurs It 1040 Wroclaw, Poland Dermatology, Venereology and Allergology, Wroclaw Medical University, Herlev-Gentofte, Copenhagen,Denmark versity, Denmark, of HealthScience and Technology, Faculty of Medicine, Aalborg Uni- Dermatology, Venereology and Allergology, Reich Department ofDermato-Allergology, CopenhagenUniversity Hospital, Laboratory forExperimental Cutaneous Pain Research, SMI, Department of Department Dermatology, Experimental of Circle Scientific Students’ 3 3 , LarsArendt-Nielsen 9 th WorldCongressofItch 2 1 Health, MedicalandNeuropsychology Unit,Faculty , ai Niżyński Dawid 1 , In the analyzed group, 9 patients Results: In the analyzed group, 9 patients Antoinette vanLaarhoven 1 Pruritus affects about one fifth 1 , agraa Inglot Małgorzata 2 Department ofInfectiousDi- 3 1,2 Department of , Jesper El- 2 , Adam - - - COLLEGE - ATHERAPEUTIC APPROACH COLLEGE JAGIELLONIAN UNIVERSITY MEDICAL THE DEPARTMENT OF DERMATOLOGY, PRURITUS INPATIENTS HOSPITALIZED IN PP21 (“pain inhibitingitch”paradigm). vourably applyadesignassessingpain-evokeditchmodulation fa could itch chronic with patients in itch of efficacy inhibition itch andpaininhumans.Futurestudiesassessingendogenous in favourofpain-inducedcentraldescendinginhibitionboth pain stimulation. These results suggest a hierarchical prioritization conditioning with evoked efficiently be can but stimulation, itch conditioning by evoked significantly be not could inhibition itch stimulus, butnotbytheconditioningitchstimulus.Descending pain conditioning the by reduced significantly were ratings pain pain stimulation,signifyingapain-evokedCIM-effect. Mean decreased bybothcontra-andipsilaterallyappliedconditioning was observed), however, the mean itch intensity was significantly cantly affect the mean itch ratings (although an insignificant trend signifi not did stimulation itch Conditioning condition). control condition), and 5)painmodulationbycontralateralitch (negative contralateral pain(i.e.astandardCPM-paradigm;positivecontrol pain; 3)itchmodulationbyipsilateral4)pain dulation bycontralateralitch;2)itchmodulation atment. Useofantihistaminesrequires carefulassessmentofthe (15.7%). 50%ofpatients weretreated withoralantihistamines (1 were allergic diseases(45.1%),mostcommonlyatopicdermatitis by elderlypatients(31.4%). The mostcommoncauseofitch were middle-aged(35–64yearold)individuals(45%),followed 18–86. (32.9%) presentedwithpruritus– Poland betweenJanuaryandMarch2016.102of310patients Dermatology, CollegeinKrakow, Medical University Jagiellonian clinical dataof310patientshospitalizedintheDepartment the treatmentofthissymptom.MaterialandMethods:We analyzed highlight theneedforspecialcautionsthatshouldbetakenduring study wastoassesstherangeofproblempruritusand consideration whenimplyingthetreatment.Aim: The aimofthe concomitant disease-relatedlimitationsshouldbetakeninto effective intreatingtheitchsensation,however theage-and as welltopicalandsystemicdrugs. Antihistamines areoften gical patients. The treatmentofitchinvolvesmoisturizingagents, Introduction: The presence of pruritusiscommonindermatolo 1 Spałkowska Magdalena and/or 2 nian UniversityMedicalCollegeinCracow, Poland patients morecautionshouldbe takenwhenimplyingsuchtre in themanagementofpruritus. However, inthegroupofelderly (p<0.05 each).Conclusions: Antihistamines arefrequentlyused glucose and urea creatinine, of levels higher significantly had p=0.035; 44%vs23%forotherdrugs; p=0.03).Elderlysubjects systemic drugsmoreoften (97% vs81% for topicaltreatment; receivedtopicaltreatment andhavebeentreatedwithother patients with intensepruritusvs42%nonintense;p=0.04).Elderly and thosepatientsreceivedantihistaminesmorecommonly(64% with generalizedthanlocalizeditch(56%vs29%;p=0.013) pruritus assevere.Intensityofwashigherinpatients of patients,generalizedin24.5%.35.5%patientsdescribed evoke itchorpain.Fiveconditionswereinvestigated;1)mo Test stimuliwereconductedwithelectricalparadigmsdesignedto comprised coldpressor-induced painandhistamine-evokeditch. six healthy volunteers weretested. Conditioning stimulations CPM and CIM ofexperimentallyeliciteditch and pain. Twenty- Małgorzata Werynowska Department ofDermatology, and Results: The mostcommongroupofpatientswithpruritus nd generation).Localizedprurituswasobservedin75.5% 2 , 1 Anna Wojas-Pelc , Agata Radko 2 Scientific Students’ Society, Jagiello Society, Students’ Scientific 66 womenand36men,aged 1 2 , Maciej Nowak 2 st ------,

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV sity, Seoul, National UniversityMedicalSchool, Gwangju,Korea partment of Dermatology, Kosin UniversityCollege of Medicine, Busan, Jang versity School of Medicine, Seoul, Allergology, Wroclaw MedicalUniversity, Wroclaw, Poland of Dermatology, PusanNationalUniversitySchoolofMedicine, Busan, Won Lee logy and Hepatology, and Hospital, HallymUniversityCollegeofMedicine,Hwaseong, 9 6 4 1 Yong HyunJang KOREA A PROSPECTIVE,MULTICENTER STUDY IN MENT INPATIENTS WITH CHRONICPRURITUS: INSTRUMENTS FORITCHINTENSITY MEASURE­ VALIDITY AND RELIABILITY OF VARIOUS PP23 vising patientswithIBD should beincludedinthediagnosticandtherapeuticteamsuper require proper evaluation of skin problems and the dermatologist problematic forpatient.ItisthereasonwhypatientswithIBD be neglectedbythegastroenterologistorGP butitcanbevery of IBD.Conclusions:Such “trivial” problem as itchingmight for dermatologicalconsultationsduringdiagnosisandtreatment (46.5%) and hair loss (20.9%). Patients also stressed the need dermatological ailmentinthispopulationofpatientsafterxerosis suffered frompruritus(19.5%),which thethirdmostcommon IBD with patients of 20% About disease. bowel inflammatory with patients in problems dermatological significant identify that questionnaireisavaluableresearchtoolwhichallowto All datawereanalyzedstatistically. Results: The resultsshowed condition, and previous treatment was completed byinvestigators. skin their evaluating questionnaire stratified the data achieved thorough medicalhistoryandphysicalexamination.Basedon zed in gastroenterological department. All patients underwent a and Methods: The studyincludedpatients with IBD hospitali in patientswithIBDspecialemphasisonpruritus.Materials study wastoanalyzetheprevalenceofdermatologicalconditions which canbeveryheavyforpatients.Objective: may resultinvariousdermatologicalcomplicationsasitching often requiresprolongedimmunosuppression.Suchtreatment (IBD) diseases bowel inflammatory with Introduction:Patients 1 Marta Idzior DISEASE: ISPRURITUS A MAJORFINDING? PATIENTS WITH INFLAMMATORY BOWEL ASSESSMENT OF SKINPROBLEMS AMONG PP22 adjusted tothehepaticandkidneyfunction. nervous system. The choiceofthedruganditsdosageshouldbe risk ofpharmacologicalinteractionsandtheireffects oncentral Li Biology Research Institute, Yonsei University College of Medicine, Seoul, College of Medicine, Seoul, Daegu, cheon St. Mary’s Hospital, The Catholic University of Korea, Incheon, University CollegeofMedicine, Seoul, Medicine, Daegu, Dermatology, Venereology and Allergology, Neubauer Department ofDermatology, College ofMedicine, Catholic University of Department ofDermatology, Kangnam Sacred HeartHospital,Hallym Department ofDermatology, College of Medicine, Chung-Ang Univer Department ofDermatology, Kyungpook National University School of of Department Dermatology, Experimental of Circle Scientific Students’ 4 , Chang OokPark 8 , Kyung DuckPark 11 2 , SeongJinKim 5 , Department ofDermatology, Severance Hospital,Cutaneous Adam Reich 1 , 10 Department ofDermatology, SeoulNational University et Jastrząb Beata 2 1 Department ofDermatology, DongtanSacred Heart , Gyeong-Hun Park 5 , 3 3 Hye OneKim Department of Dermatology, Venereology and 9 12 , 11 , DoWon Kim Eun JinDoh Department ofDermatology, Konkuk Uni- 12 Department of Dermatology, Chonnam 1 , Marta Laskowska 7 Department ofDermatology, In - 2 6 , , 2 Byung-Soo Kim Department of Gastroentero- 10 Hei SungKim 1 , Dong HunLee The aimofthis 1 , 3 7 Department Katarzyna 3 , , Min Soo Kap-sok 10 , Yang 8 De- - - - way toassesstheitchintensityshouldbestudied. multifactorial trait, its assessment may be challenging. The best than ISS.Conclusion:Sincepruritusisasubjectivesymptomof Re-test reliabilityof VAS, NRSand VRS wassimilarandlower tion ofthethreehours’ difference wasalsothehighestinISS. IchyQoL comparedto VAS, NRS,and VRS. Statisticalcorrela with thesethreetools. However, ISScorrelated stronglywith significant high values. ISS showed a low intercorrelation validity statistically showed coefficient correlation Spearman’s by VRS conducted onallpatients.Results:Correlationof VAS, NRSand was analyzedafterthreehours.Inaddition,IcthyQoL surveywas NRS (0–10), VRS (four-point) andISSscales.Re-testreliability years) recordedtheirpruritusintensityon VAS (100-mmline), with chronicpruritus(215males,214females,meanage46.58 of lifeinstrument,IcthyQoL.Methods: A totalof419patients VAS, NRS, VRS and ISS and relation to a pruritus-specific quality Objective: In thisstudy, weevaluatedvalidityandreliabilityof date, nosinglemethodhasbeenrecognizedasagoldstandard. questionnaires includingItchSeverityScale(ISS).However, to (NRS), Verbal RatingScale(VRS),andvariousmultidimensional red using the Visual Analog Scale(VAS), NumericRatingScale accurate evaluationofpruritus.Pruritusintensitycanbemeasu tools havebeenusedovertimetoprovideamorereliableand elusive duetoitssubjectivityandmultifactorialnature. Various on quality of life, a valid assessment of chronic pruritus remains impact significant and prevalence high its Despite Background: for theevaluationofpsoriaticpruritus. patients with psoriasis. The 5-D should be useful as a new tool multidimensional measureofitching thathasbeenvalidatedin QOL in Japanese patients with psoriasis. The 5-D is a reliable, acterization andcorrelationofpruritus, thediseaseseverityand currently underanalysisandwillbeexpectedtogivethechar 6.4±7.3 withthe scores ranging between 0 and 28. Our data are the scoresrangingbetween5and22. The meanPASI scorewas mean and standarddeviation of 5-D score was10.1±4.3with and thedermatologylifequalityindex(DLQI),respectively. severity ofpsoriasis(psoriasisareaandindex[PASI]) evaluated thediseaseseverityandqualityoflife(QOL)by 5-D itchscalewasadministeredtothesepatients.Inaddition,we in this study (mean±SD; 54.6±15.6). The Japanese version of the and 25women),allbetween2380yearsofage,participated the 5-Ditchscale. A totalof69patientswithpsoriasis(44men pruritus inpatientswithpsoriasisusingtheJapaneseversionof distribution ofitching. To examinetheclinicalcharacteristicsof sections thatmeasureduration,degree,direction,disabilityand is a new simple self-administered questionnaire. It consists of five obtain themultidimensionalaspectsofpruritus. The 5-Ditchscale are available to measure pruritus. However, these scales do not choice ofappropriatetreatments.Currently, onlyafewresources ing. Itisneededtoassesspruritusinthepsoriaticpatientsfor pruritus isimportanttoavoidaggravationofpsoriasisbyscratch scratch and it may trigger new eruptions. Thus, the management of from 64%to97%.Pruritusleadsthepatientswithpsoriasis The prevalence of pruritus in the patients with psoriasis has ranged 1 Yozo Ishiuji ITCH SCALE SIS USING THE JAPANESE VERSION OF THE 5-D TICS OF PRURITUSINPATIENTS WITH PSORIA­ EVALUATION OF THE CLINICAL CHARACTERIS­ PP24 funa DermatologyClinic,Japan chi Nakagawa Department ofDermatologyJikei University SchoolofMedicine, 1 , Akihiko Asahina 1 1 , Yoshinori Umezawa 1 , Koichi Yanaba 1 , Norie Aizawa 1 , Acta DermVenereol 2017 Poster abstracts Toshiya Ebata 1 , Sanae Inoku- 2 , Hidemi 2 Chito- 1041 The - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Area andSeverityIndex(PASI), Body SurfaceIndex(BSA) examination oftheskinincluding theevaluationofPsoriasis vulgaris. to psoriasis A taken. was detailedhistory A physical Venereology and Allergology, Wroclaw MedicalUniversity due cutive inpatientshospitalizedin theDepartmentofDermatology, age status.MaterialandMethods: The study included67conse ristic in patients with psoriasis vulgaris with a special emphasis on common dermatosis.Objective: To assessdetaileditchcharacte constitute importantissueinelderlypatientssuffering fromthis As the frequency of chronic itch increases with the age, it will dermatology presentinthemajorityofpatientswithpsoriasis. creased in recent years. Itch is the most common symptom in Introduction: The suspectedlifespanofthepopulationhasin cal University, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Radomir Reszke,RafałBiałynicki-Birula, FACTOR? ITCH INPSORIASIS–IS AGE AN IMPORTANT PP26 of Dr. LeoOdongo,thegirlwasrescuedfromtormentofitch. of peoplewhoaretormentedwithitch. With thevoluntarywork respective capacity we can all contributesomething to the care and herqualityoflifehadimprovedgreatly. Conclusion:Inour improvement inhersymptoms.Itchinghadceasedcompletely reviewed the girlaftertwo weeks of treatmentand she hadmarked eating ofthefoodsshehadbeenwronglystoppedfromeating. We ghee andcowmilkapplicationonthegirl’s skinandresumptionof twice daily. We recommendedstoppageofuseherbalproducts, two-weeks course of topical betamethasone ointment 0.1% applied fossae). Atopic dermatitiswasdiagnosed. We treatedthegirlwith flexure surfaces (especially the antecubital fossae and the popliteal with the face less affected. There was marked lichenification at the of skinwithmultiplescratchmarksonthetrunkandextremities Findings onphysicalexamination: We foundthegirlhaddryness opened inKabalewhereshebroughtthegirltousfortreatment. the girl. The motherwasthentoldofthenewclinic thathadbeen rashes keptonrecurringwithincreasingitchanddiscomfortfor ghee andcowmilkonthegirlasremedy. Despiteallthese,theitchy several fooditems. She was advised to smear herbal products, cow She wasthengivenwrongadviceandwronglystoppedfromeating girl frommanyhealth workers, noneofwhomwas a dermatologist. is positive family history of . Mother sought treatment for the associated withitchyeyes.Nohistoryofasthma.However, there rashes onthebodysinceearlychildhood. The itchyrashwaslater 13-year-old girlinwhomthemother reportsveryitchyrecurrent until shewasrescuedbythenewskinclinicinKabale.History:A has suffered from the itch without getting access to a dermatologist tion in Dermatology. We reporthereabout a 13 -year-old girl who and whoalsosupervised Gerold Jäger, who established the field of dermatology in Uganda fifteen trained dermatologists. The clinic is named after Prof. Dr. Referral Hospital inSouth-Western Uganda. Uganda is currentlyvolunteeringasadermatologistinKabaleRegional establishing of work voluntary doing been has months, five last the in who, Dr. LeoOdongo,a33-year-old Ugandantraineddermatologist Background: GeroldJägerskinclinicinKabaleisaninitiativeof Gerold JägerSkinClinicinKabaleRegionalReferralHospital,Uganda Leo Odongo IN KABALE,UGANDA FROM THE NEW GEROLDJÄGERSKINCLINIC SEEING A DERMATOLOGIST: A CASEREPORT THIRTEEN YEARS OF ITCHY RASHES WITHOUT A UGANDANGIRL WHO HAD TO ENDURE PP25 1042 9 th WorldCongressofItch the fourthuniversityskinclinicinUganda,wherehe Dr. Odongo´sMaster´sdegreeDisserta Jacek C.Szepietowski has less than has less than - - - - for pruritus assessment in the patients with psoriasis. for pruritusassessmentinthepatients withpsoriasis. riasis patients.SerumLCN2levels maybeausefulclinicalmarker findings suggest that LCN2 is associated with the pruritus of pso VAS, SCORADin atopicdermatitispatients.Conclusion:These there wasnocorrelationbetween serumLCN2concentrationand significantly correlated with VAS, but not with PASI. In contrast, controls. Inthepsoriaticpatients,serumLCN2concentrationswere riatic patientsandatopicdermatitiscomparedtohealthy between serumLCN2with VAS, PASI and SCORAD. scoring atopicdermatitis(SCORAD).Correlationwasexamined was measuredbypsoriasisareaandseverityindex(PASI) and assessed withvisualanalogscale(VAS), andthedisease severity linked immunosorbentassay(ELISA). The itchintensitywas atopic dermatitispatientsandhealthycontrolsusingenzyme- Serum LCN2concentrationsweremeasuredinpsoriasispatients, and pruritusinpsoriasisoratopicdermatitispatients.Methods: performed toexaminethecorrelationbetweenserumLCN2level been reported in patients with psoriasis. Objective: This study was relationships between serum LCN2concentration and pruritus have spinal itchinthemousemodelofatopicdermatitis.Recently shows thatastrocyte-derivedLCN2isinvolvedinenhancementon decreases inpatientswithatopicdermatitis. A previousstudyalso that serum LCN2 concentration increases in psoriasis patients, and cancer metastasis and inflammatory responses. It has been reported neutrophils andisknowntobeassociatedwithneurodegeneration, binding lipocalin(NGAL).Itismainlysecretedfromactivated rogeneous secretoryproteinalsoknownasneutrophilgelatinase- Background: Lipocalin-2(LCN2)isamemberofthehighlyhete 1 Norie Aizawa PSORIASIS SERUM LIPOCALIN-2INPATIENTS WITH RELATIONSHIP BETWEENPRURITUS AND PP27 Serum LCN2 concentrations were significantly elevated in pso in elevated significantly were concentrations LCN2 Serum 65 years and over 65years; p respectively (nostatisticaldifferences between groups agedbelow the meanPASI, BSA andPGA scoreswere15.9,32%and2.1, The meantimeoftheonsetdiseasewas19.5years,whereas were agedlessthan65years,while29.9%andover. men. The meanagewas55.5±15.3years;70.1%ofparticipants Results: Among 67patients,31.3%werewomenand68.7% performed. was analysis statistical patient. A the by filled were (DLQI) and6ItemStigmatizationScale(6ISS)questionnaires on dailyactivitiesandsleep.DermatologyLifeQualityIndex severity, variation during the day, influencing factors and impact presence ofchronicitchwasassessed,includingthelocation, and Physician’s Global Assessment (PGA)wasperformed. The of itchinpsoriaticsubjects. were different, implying that aging may influence clinical features not differ accordingtotheage group,whileseveralaspectsofitch psoriasis vulgaris.Inthemajorityofaspectsitscharacteristicdid is acommonandrelevantphenomenoninpeoplesuffering from group (73.3%vs.60.6%;respectively;p=0.02). decrease duetoitchwasalsomoreprevalentintheformerage below 65(86.7%vs.24.2%;respectively;p itch intensitystatisticallymorecommonthaninindividualsaged patients aged65andovercoldambienttemperaturereducedthe between agegroups(5.6vs.6.1points;respectively;p=0.46).In in thelast3dayswas5.7points;nodifferences wereobserved were observedbetweenagegroups. The meanpruritusintensity Chronic prurituswaspresentin71.6%patients;nodifferences shinori Umezawa University GraduateSchoolofMedicine.Chiba,Japan kyo, utoshi Tominaga Department of Dermatology, The Jikei University School of Medicine. To- 2 Institute for Environmental and Gender Specific Medicine, Juntendo Medicine, Specific Gender and Environmental for Institute 1 , Yozo Ishiuji 2 , KenjiTakamori 1 , Akihiko Asahina 1 , =0.68; Sanae Inokuchi 2 , HidemiNakagawa p 1 =0.92; , Nobuaki Takahashi p 1 , =0.80; respectively). Koichi Yanaba =0.01); themood Conclusion: Itch 1 Results: 2 , Mits- 1 , Yo - - - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Hospital, Brest, France to validatetranslationsofquestionnaires inallstudiedlanguages. that woulddescribetheirsymptoms intheirownlanguageorder tionnaires. The nextstepwillbeastudy with interviewsofpatients proposes amethodforthecreation ofstandard and validatedques and need the confirms study preliminary presented The research. into qualityoflife,psychological studiesandpathophysiological relationship and indispensable for clinical trials, investigations experienced bypatientsisundeniablycrucialinthepatient-doctor included inourstudy. The adequateunderstandingofthesensations are families language 6 into classified languages Twenty-seven questionnaires considering cross-cultural and linguistic adaptations. is apreliminaryframeworkforthecreationofstandardandvalidated these sensationsarethesameinalllanguages. The presentedstudy tightness or stinging,and it is not obvious that the borders between close sensationssuchaspain,burning,tingling,tickling,prickling, and evendoctors,itisnotalwaysevidenttodifferentiate itchfrom pending onlanguages,culturesandhistoricalperiods.Forpatients scratch. Nonetheless,themeaningisnotnecessarilysamede to need the to leading sensation unpleasant an as defined is Itch 1 Deok-Hee Kim-Dufor PRELIMINARY STUDY AND PERSPECTIVES ITCH: TO ASSESS QUESTIONNAIRES CULTURALLYSTANDARD ADAPTED THE NEEDFORLINGUISTICALLY AND PP29 pruritus inJapanesepatientswithDM. will beexpectedtogivetheprevalenceandcharacterizationof of internalmalignancy. Ourdataare currentlyunderanalysisand also examinetherelationshipbetweenpruritusandpresence ies. Inaddition,DMisassociatedwithinternalmalignancy. We autoantibod andmyositis-associated pruritus between relationship associated gene5product(MDA5)antibody. We examinethe factor 1 gamma (TIF1γ) antibody, anti- differentiation- antibody, anti-Mi-2antibody, anti-transcriptionalintermediary the variousmyositis-associatedautoantibodiessuchasanti-Jo-1 DM hasbeencategorizedintoseveraldiseasesubsetsbasedon degree, direction,disabilityanddistributionofitching.Recently, duration, measure that sections five of consists It questionnaire. itch scale. The 5-Ditchscale isanewsimpleself-administered tients withDM.PrurituswasassessedbyJapaneseversionof5-D study istoevaluatetheclinicalcharacteristicsofpruritusinpa of pruritusinpatientswithDMareunknown. The aimofcurrent improve theirqualityoflife.However, theprecisecharacteristics a worsequalityoflife. To evaluatepruritusisveryimportantto with correlates and life daily affect significantly to known is It is oneofthecardinalsymptomsthatDMpatientsoftencomplain. overgrowth, mechanic’s hands,photosensitivityandsoon.Pruritus , poikiloderma,the V-neck sign,theshawlcuticular various suchasheliotroperash,Gottron’s ,paronychium are themostimportantsymptomsofthisdisease. The skinsignsare affecting skinandmuscle. The cutaneous manifestationsofDM opathy. The pathogenesisisconsidered tobemicroangiopathy Dermatomyositis (DM) is a type of idiopathic inflammatory my 1 Yozo Ishiuji OF THE 5-DITCHSCALE JAPANESEUSING THE TOMYOSITIS VERSION TICS OF PRURITUSINPATIENTS WITH DERMA­ EVALUATION OF THE CLINICAL CHARACTERIS ­ PP28 funa DermatologyClinic,Japan chi Nakagawa CNRS, UMR6285Lab-STICC, Department ofDermatologyJikei University SchoolofMedicine, 1 , Akihiko Asahina 1 1 , Yoshinori Umezawa 1 1 , , Adèle Poulaliou Koichi Yanaba 2 Department ofDermatology, University 1 , Norie Aizawa 1 2 , , LaurentMisery Toshiya Ebata 1 , Sanae Inoku- 2 , 2 Hidemi 2 Chito------kamatsu-cho Mental and SkinClinic, Tokyo, Japan, matology, Emory University, Atlanta, USA information insomepatients,Prospectivestudiesindicatingcor additional provide deposits fibrinogen and C1q C3c, IgM, IgA, Our findingsshow that presence of tissue-bound IgG1-IgG4, IgE, patients) andlichenplanus-likelesions(1patient).Conclusion: like lesions(3patients),dermatitisherpetiformis-like(2 lesions (8patients),urticaria-like(5eczema- was itchwithnoskinlesions(14patients),prurigonodularis-like were present in 1patient. The most common clinical presentation C1q in 4 patients. Deposits of C3c and C3c, IgG1 and fibrinogen Deposits ofIgEinepidermiswerefound3patients,IgMand IgG4, IgEindermoepidermaljunctionwerepresent1patient. and were localized in epidermis. Deposits of IgG2 and IgG3, Results: IgG1-IgG4 and IgE deposits were present in 1 patient other knowndermatologicaldisorderwereincludedtothestudy. had neverexperiencedblistersandpatientswhodidn’t haveany Patients withacuteorchronic,mildtointensepruritus,who years old).Clinicalfeaturesattimeofdiagnosiswerenoted. of skinbiopsyspeciemensobtainedfrom33elderypatients(>60 microscopy immunofluorescence direct by detected as deposits presence of IgG1-IgG4, IgE, IgM, IgA, C3c, C1q and fibrinogen terials andMethods:Inthisretrospectivestudyweassessedthe , andtheircorrelationwithdistinctclinicalfeatures.Ma pruritic dermatoseswhohadneverexperiencedclinicallyapparent C3c, C1q and fibrinogen deposits in eldery patients with various to assessthepresenceoftissue-boundIgG1-IgG4,IgE,IgM, IgA, bodies remains unclear. Objectives: The purposeofthestudy was 180 kDahasbeendemonstratedinBP, theroleofIgEautoanti the disease. While thepathogenicityofIgGautoantibodiestoBP Early recognitionof prodromal BP maydecrease progression of eczema-like papulesanddermatitisherpetiformis-likelesions. ofpolymorphicappearenceandurticaria-likeplaques, skin lesions (BP) shouldbeconsideredinpatientswithextensivepruritusand and therapeutic challenge. Prodromal phase ofbullous pemphigoid Background: Pruriticdermatosesoftheelderyposeadiagnostic Olsztyn, Poland , UniversityofWarmia andMasuria,MunicipalHospitalin Department ofDermatology, Sexually Transmitted DiseasesandClinical Czerwińska, MartynaBieniek-Kobuszewska, Natalia Zdanowska, PRURITIC DERMATOSES STAINING INELDERY PATIENTS WITH UNDER DIRECT IMMUNOFLUORESCENCE IGM, C3C,C1Q AND FIBRINOGENDEPOSITS DETECTION OF PRESENCEIGG1-IGG4,IGE,IGA, PP30 Toshiya Ebata ITCHYQOL INCHRONIC PRURITUSPATIENTS VALIDATION OF JAPANESE VERSION OF PP31 course ofdisease. of specificity of autoantibodies with distinct clinical features and bound deposits of autoantibodies are needed, same as designation relation betweenpresenceofcirculatingIgEandIgGwithtissue- including backwardtranslation. A totalof100adultpatientswith JPN). ItchyQoL-JPN was created through the standard protocol report avalidationoftheJapanese versionofItchyQoL (ItchyQoL- dely usedintheEnglishandGerman speakingcountries. We here first pruritus-specific QoL instrument developed in 2008 and wi QoL impairmentinthecourseoftreatment CP. ItchyQoL isthe (QoL) ofthe patients. Hence, it isimportant to monitor theextent of Chronic pruritus(CP)hassuchanegativeimpactonqualityoflife 1 Suephy C.Chen Chitofuna Dermatology Clinic, Tokyo, 1 , 4 Yuko Hayakawa Agnieszka Owczarczyk-Saczonek, 1 , Akishi Momose 2 Jusendo Clinic, Fukushima, Acta DermVenereol 2017 Poster abstracts Waldemar Placek 4 Department ofDer 2 , Yuko Higak Joanna 1043 3 Wa 3 ------,

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta lanta Veterans Administration Medical Center, icine & Women’s CenterofExcellence for Specialty Care Education, At- partment ofPsychiatry and BehavioralScience, Morehouse SchoolofMed- sandra Quave Atlanta Veterans Administration MedicalCenter, USA these disparitiesinpruritus. API ethnicitiesandrelatedsociocultural factorsthatmaymediate results meritfurtherexploration ofpotentialdifferences between p treatment, theirdoctorwouldtry tohideitfromthem”(Z–2.08, know” (Z–2.55,p “their physicianspretendedto know somethinghe/shedidnot p felt lesscomfortabletellingtheirphysicians“anything”(Z–2.34, non-itchy subjects; compared tothe non-itchy API, itchy subjects found differences inmedicalsystemdistrustbetweenitchyand pruritus wouldlastforeverforemotionalimpact.Finally, we sleep disturbanceforfunctionalimpact;andconcernthattheir scratching and seasonal aggravation forsymptomatic impact; to bedriversundereachsubscale. APIs hadhigherconcernfor three subscales.Qualitatively, wefoundcertainItchyQoL items API andveteransofdifferent raceswerealsofoundamongall differences inindividualItchyQoL itemmeansbetweenitchy symptomatic impact on QoL among API. Statistically significant had disproportionately higher emotional rather than functional or sex foremotionalimpact(p immigration wasanadditionalpredictorforfunctionalimpact,and However, QoL. of predictor ficant the in since years group, API (5.2, SD2.3). As intheveterangroup,itchseveritywasasigni score of 4.19 (SD 2.62), which is lowerthanthat of theveterans distrust toallsubjects. The API grouphadameanitchseverity were given toitchy subjects, anddemographics and medical subjects. SurveysassessingQoL (ItchyQoL)anditchseverity this disparityinan API populationof43itchyand29non-itchy heterogeneous group. We investigated potential factors mediating into onepopulationorgroupedas“Other”,butareinrealitya of thisdisparityremainsunclear. API aretraditionallygrouped conditions andseekmedicalcareforpruritus,buttheetiology pruritic certain report commonly more (API) Islanders Pacific QoL or impact. pruritus-specific Asian greater have non-whites reported. Ourdatafromaveteranspopulationindicatedthat Racial disparitiesinpruritusqualityoflife(QoL)havebeen 1 Kevin Luk AMERICANS AND OTHERRACES PRURITUS QUALITY OF LIFEBETWEEN ASIAN DIFFERENCES INFACTORS THAT DRIVE PP32 patients withCP. make itpossibletoevaluatetheQoL impairmentoftheJapanese results fromthepresentstudysuggestthatItchyQoL-JPNmay in VAS(r=0.70, over thecourseof2to3monthscorrelatedwellwithchanges instrument ofskindiseasesinJapan.ChangesItchyQoL-JPN p<0.001) andSkindex-16(r=0.85,<0.001),awidelyusedQoL scale (VAS, 0=noitchand10=the worst itchimaginable)(r=0.46, avisualanalogue withitchintensitymeasured ItchyQoL-JPN Convergent validity was demonstrated by positive correlation of 0.89, coefficient: correlation (intraclass reproducibility test-retest and was demonstrated by internal consistency (Cronbach alpha: 0.81) liability, Reliability ofItchyQoL-JPN. validityandresponsiveness prurigo 4,chronicurticarial4)participatedinthestudytotestre CP (atopicdermatitis68,uremicpruritus18,other6, 1044 Department of Dermatology, Emory University School of Medicine, =0.037). Despiteasmallhomogenous cohort,thesepreliminary =0.019). Interestingly, itchy API morestronglydisagreedthat p<0.001). ItchyQoL-JPNshowedfaceandcontentvalidity. 9 th 1 WorldCongressofItch , Alix Pijeaux 1 , SarahChisolm p<0.001) showingagoodresponsiveness. The =0.011) or“ifamistakewasmade in their 1 , Kuang-Ho Chen <0.05). As intheveteransgroup,itch 1 , SeemaKini 3 2 Division of Dermatology, , GlendaWrenn 1 , SuephyChen 2 1,3 , Cas- 2 De- - - involvement ofsupraspinalcontrol cannotbeexcluded. by neuralmodulationatthespinal cordlevel,althoughpossible to pruritogenchallengesareeffective todiminishitchresponses cervical spinaldorsalhorn. Taken together, noxiousstimuliprior DRG neuronsandenhancedc-Fos expressioninlaminaIIofthe scratching of mice led to phosphorylation of ERK in cervical for morethan20minutes. The antipruriticeffect producedbybriefnoxiousstimulilasted intradermal injectionofcapsaicinwasgivenpriortoprutinogen. reduction wasobservedinthenapeandcheekskinmodels,when prutrinogen could significantly reduce itch response. Similar itch sive scratching)onthenapeskinofmildanesthetizedpriorto We demonstratedthatapplicationofnoxiousstimuli(e.g.,pas mouse skinpriortopruritogen. This effect wasaccomplishedby antipruritic effect producedbybriefnoxiousstimuliappliedon could effectively reducetheitchsensation.Hereweobserved clear whetherthenoxiousstimulipriortoinjectionofpruritogen and painful sensations relieve the itch sensation. However, it is not scratching andvariablenoxiouscounterstimulilikeheat center, whicheventuallyinducesthedesiretoscratch. The actof sensory neurons to the spinal dorsal horn and then to higher brain Itch is an unpleasant sensation caused by pruritogen transmitted by nal Yang-Ming Universityand Academia Sinica,Taipei, Taiwan International GraduateProgramin Interdisciplinary Neuroscience, Natio- Institute of Biomedical Sciences, Academia Sinica, Taipei, Taiwan /Taiwan Ravi ChandraKopparaju,Chih-ChengChen TRANSMISSION? DOES PRE-SCRATCHING REDUCE THE ITCH PP34 res thesymptomatic,emotional,andfunctional in adults, with non-whites reporting worse of chronicpruritus(CP, >6weeks)havepreviouslybeenreported Introduction: of life(QoL)impact disparities inthequality Racial Emory UniversitySchoolofMedicine, Atlanta, GA,USA Chen, SuephyChen Alix Pijeaux, GraceLee,Shelby Smith, SandyFrancois,Kuang-Ho PATIENTS PRURITUS QUALITY OF LIFEINPEDIATRIC INVESTIGATING RACIAL DISPARITIES IN PP33 1.258–6.981). Innoneoftheother itchy skin, compared toBlackchildren(Odds report havingfeltdifferent fromotherkidstheirage,becauseof Nonblack. Nonblackchildrenwerenearly3timesmorelikelyto Results: A totalof153patientswererecruitedwhich89 guardian, and subsequently categorized as “Black” or “Nonblack”. itchy skininchildren(validationpending).Racewasreportedby in impact remain unclear. This study investigates racial differences prevalence have been described in children, differences in after adjustingforitchseverity. Although racialdisparitiesinCP cultural perceptionandsocialimplicationsofitchinchildren. as such findings, initial these for etiologies possible elucidate Whites in their Hispanic and Asian populationsmaynotdiffer of White vs.Nonwhite didnotyielddifferences suggestthatthe their friendsitchasmuchtheydo. The factthatcategorization atopic dermatitisinblackchildren.Blackchildrenwouldseethat peers that nonblackchildrenweremorelikelytofeeldifferent fact items.Conclusion:The the of any in differences significant race wascategorizedas“White”and“Nonwhite”,therewereno when Interestingly, blacks. from differ significantly children completed thepediatric with CP wererecruitedfromtheEmoryClinic(n=153).Subjects QoL than blackchildrenmaybeduetothehighprevalenceof impact inchildrenwithCP. Methods:8-17yearolds QoLimpact. Further investigation is indicated to ItchyQoL, a35-itemsurveythatmeasu We furtherdemonstratedthatpassive ItchyQoL

items didnonblack QoL Ratio significantly QoL impact even 2.9; 95%CI impact of from from QoL - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV gology, Justus-Liebig-University, Gießen,Germany, agonist, hasinhibitoryeffects onserotonin-induceditchinmice. investigated ifsumatriptan,a selective 5-HT1B/1Dreceptors 5-HT1B/1D receptorsinhibitsneurotransmission. Therefore, we receptors. Previousstudieshave demonstratedthatactivationof induces scratchingbehaviorinmice throughstimulationof5-HT linked tovarietyofitchconditions. Intradermalinjectionof5-HT rotransmitter initch.In Addition, impairedserotoninsignalingis Introduction: Serotonin (5-hydroxytryptamine or 5-HT) is a neu 1 Nazgol-Sadat Haddadi SYSTEM POSSIBLE INVOLVEMENT OF OPIOIDERGIC SUPPRESSES SEROTONIN-INDUCED ITCH: THE SUMATRIPTAN,DRUG, THE ANTI-MIGRANOUS PP36 distinguish betweenitchrelatedandnon-itchskindiseases. skin disease could partly be explained by the fact that we did not that stress and itch intensity were not related in students with a skin disease, no matter if they had chronic or acute itch. The finding relationships betweenstressanditchintensityinstudentswithouta with acute or chronic itch. Interestingly, we only found significant ferentiating between students with and without skin diseases and the relationshipbetweenstressanditchinGermanstudents,dif significant (r=0.053; with aclinicaldiagnosisofskindiseaseandacuteitchwasnot (r=0.166; significant been diagnosedwithaskindiseaseandhadchronicitchwasnot correlation between stress and itch intensityinstudentswhohave skin disease,butreportedchronicitch(r=0.367;p=0.033).The acute itch(r=0.196;p=0.002)aswellinstudentswhohadno stress anditchintensityinstudentswhohadnoskindisease (66 with skin disease). We found a significant relationship between 442 hadacuteitch(139withskindisease),100chronic month (35withskindisease).Ofthestudentswhoreporteditch, itch. in studentswithandwithoutskindiseasesacuteorchronic to investigatetherelationshipbetweenstressanditchintensity scale rangingfrom0–10.Correlationanalyseswereconducted sity duringthelastfourweekswasmeasuredbyavisualanalog to measuredifferent skinsymptoms,includingitch.Itchinten modified version of the Self-Reported SkinQuestionnaire (SRSQ) (PSQ) tomeasureperceivedstressduringthelastmonthanda in aweb-basedversionofthePerceivedStressQuestionnaire filled male) (135 students 794 between thesegroups.Methods: vestigate whethertherelationshipbetweenstressanditchdiffers or chronicitch. Therefore, theaimofcurrentstudyistoin between studentswithandwithoutskindiseasesacute sity students.However, thepreviousstudydidnotdifferentiate recent US-studyfoundthatstressanditcharelinkedinuniver itch andstressarerelatedinpatientswithatopicdermatitis. A addition, In strain. financial or exams taking like stressors ferent Background: Attending universityisoftenaccompaniedbydif 1 Stephanie Kiupel ITCH INGERMANUNIVERSITY STUDENTS THE RELATIONSHIP BETWEENSTRESS AND PP35 logy, RaziHospital, Tehran UniversityofMedicalSciences,Tehran, Iran of Miami,USA matology andCutaneousSurgery, Miller SchoolofMedicineatUniversity Ahmad-Reza Dehpour Saeed Shakiba Gil Yosipovich Experimental Medicine Research Center, and Institute of Medical Psychology, and Results: In252students,itchdidnotoccurduringthelast 3 1 , ChristinaSchut , Khashayar Afshari 1 , Joerg Kupfer p p=0.186). Also, therelationshipinstudents 1 =0.57). 1 , Arash Foroutan Discussion: This studyinvestigated 1 1 , 2 Clinics forDermatologyand Aller Uwe Gieler 1 , Maryam Daneshpazhooh 2 Department ofDermato- 1 , Sattar Ostadhadi 2 3 , Department ofDer Sophia Kottlors 1 2 1 ------, , , Guildford, UK ticals, Inc., Tarrytown, USA, ney ( FROM RANDOMIZED TRIALS OF DUPILUMAB ATOPIC DERMATITIS: DETAILED ANALYSIS IN PATIENTS WITH MODERATE-TO-SEVERE PRURITUS NUMERICAL RATING SCALE(NRS) DEFINING A RESPONDERON THE PEAK PP37 of pathologicitchconditionswithimpairedserotonergic system. 5-HT1B/1D receptorsagonistsmaybeusefultotreatavariety sumatriptan seemtoinvolvetheperipheralopioidsystem. Thus, have roleinserotonin-induceditch,andanti-pruriticeffects of 5-HT1B/1D receptors.Moreover, peripheralopioidreceptors triptan inhibits 5-HT-induced itch by activating the peripheral −7 (dupilumab qw) to 0). In SOLO 2, a similar separation was separation similar a 2, SOLO In 0). to qw) (dupilumab −7 q2w)/ (dupilumab −8 W16: 0; to –4 (W2: thresholds response groups andtheplacebogroupacross thefullrangeofobserved CDF plotsshowedclearseparation betweenthetwodupilumab one-half SDestimatewasmuch lowerat0.76.InSOLO1,the most stringent clinical criteria (EASI 90–100 and IGA 0/1). The from 2.2to 4.2,with the highest estimates derived from the based onclinician-reportedanchors(EASIandIGA)ranged estimate basedonthepatient-reportedPCSwas2.6;estimates definition responder The SOLO 2: NCT02277769). Results: placebo-controlled trialsofdupilumab(SOLO1:NCT02277743; (qw) (n moderate-to-severe AD receiving dupilumab 300mgeveryweek Peak Pruritus NRS at W2 and W16 were plotted for patients with was used.Post-hoccumulativedistributionfunctions(CDFs)of one half-SDofthemeanPeakPruritusNRSscoreatbaseline method, distribution-based the For points. ≥2 of improvement IGA an or 0/1), (IGA ≤1 of score (IGA) Assessment Global EASI 90−100, respectively); patients 75−89, achieving an EASI Investigator’s 50−74, (EASI (EASI) Index Severity and Area Eczema in improvement 90%−100% 75%−89%, 50%−74%, on thePruritusCategoricalScale(PCS);patientsachieving the followinganchorsat Week (W)16:1-pointimprovement of dupilumab (NCT01859988). The anchor-based analysis used distribution-based methodsfromaphase2brandomizedstudy and anchor- using computed were estimates definition sponder itch. on dupilumab of benefit determine to these in moderate-to-severeatopicdermatitis(AD),andtoapply nitions forthePeakPruritusNumericalRatingScale(NRS) defi responder of estimates derive empirically To Rationale: 1 Eric Simpson decreases 5-HT-evoked scratchingactivity. Conclusion:Suma doses ofsumatriptanandanopioidreceptorantagonist,naltrexone, behavior. Additionally, combinedtreatmentwithsub-effective scratching 5-HT-induced the decrease significantly antagonist, methylnaltrexone (MNTX),aperipherallyactingopioidreceptor naltrexone (NTX), a non-specific opioid receptor antagonist, and intraperitoneal and intradermal that show findings our addition, GR-127935 reversestheanti-pruriticeffects ofsumatriptan.In scratching behaviorinmice. While intradermalinjectionof administration of sumatriptan significantly reduces 5-HT-induced induced itchwasassessed.Results:Intradermalandintraperitoneal receptors antagonist,andopioidreceptorantagonistson5-HT- the effect of sumatriptan, GR-127935, a selective 5-HT1B/1D of hindpawscratchingboutstowardstheinjectionsite. Then, quantification by assessed was itch and mice, of back rostral the Materials and Methods: Oregon Health & Science University, Portland, n =460) usingdatafromtwophase3randomized,double-blind, 4 , MariusArdeleanu =462) oreveryotherweek(q2w)(n 1 , Abhijit Gadkari 2 , Serotonin was injected intradermally into Adeline Abbé 3 Sanofi, Chilly-Mazarin, France, Chilly-Mazarin, Sanofi, 2 , Laurent Eckert 3 , Michael Andria Acta DermVenereol 2017 Poster abstracts 2 Regeneron Pharmaceu- =457), orplacebo 3 , Methods: Re Matthew Rea- 2 4 Sanofi, 1045 - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Pathology, MedicalUniversityofGdańsk,Poland 5-hydroxytryptamine 1b/1dreceptors (5-HTR1b/1d)agonist, activity toover-producing NOintheskin.Sumatriptan, Chloroquine stimulatesneuronal nitricoxidesynthase(nNOS) (cGMP) pathwayinCQ-evoked scratchingbehaviorinmice. tradermal nitricoxide(NO)/cyclic guanosine monophosphate itch inhumanandmice. We recentlyreportedtheroleofin Introduction: Chloroquine(CQ)induceshistamine-independent ences, Tehran, Iran Experimental Medicine Research Center, Tehran University of Medical Sci- Saeed Shakiba, Afshari, Khashayar SCRATCHINGNO-PATHWAY THROUGH SUMATRIPTAN ATTENUATESCQ-INDUCED PP39 pruritus andstageofthedisease. the correlationbetweenIL-31skinlevels,serum research overasolidgroupofCTCL patients. We investigated data wewereabletoverifydiagnosesoncemoreandconduct to repeattheresearch.Fouryearsaftergarneringsamplesand knowledge aboutroleofIL-31inpruritusCTCL,wedecided of state current with line in not are that results conflicting our between IL-31serum,skinlevelandpruritusseverity. Dueto between pruriticandnon-pruriticMFpatientsnocorrelation found lack of significant difference in IL-31serum andskin level group. CTCL control in in higher than significantly patients We bent assaymethodology. The IL-31serumandskinlevelwas patients were determined by the enzyme-linked immunosor of immunohistochemicalstaining.SerumIL-31levelsinCTCL specimens from CTCL patients and healthy individuals by means IL-31 was evaluated in formalin-fixed paraffin-embedded biopsy of collectingskinbiopsiesandbloodspecimens.Expression thy volunteers.Majority of CTCLs were diagnosed at the time research overstudygroupof51patientswithMFand40heal ought to develop the subject of IL-31 in CTCL. We conducted of IL-31inpathogenesispruritusaccompanyingCTCL,we understood. but alsothepathomechanismofpruritusinCTCL innotfully dermatitis oreczema.Notonlythepathogenesisofdisease atopic as such dermatoses inflammatory resemble it as difficult Diagnosing especiallyearlystageofmycosisfungoides(MF)is antihistamines and therefore significantly reduces quality of life. accompanied bypersistentprurituswhichrespondspoorlyto Primary cutaneous T-cell lymphoma(CTCL)isachronicdisease 1 Berenika Olszewska PRURITUS INCTCLS AND INSERUMPATOMECHANISM OF SIGNIFICANCE OF IL-31EXPRESSIONINSKIN PP38 impact onitchinmoderate-to-severe AD patients. CDFs demonstratethatdupilumabhadaclinicallymeaningful NRS response can be defined as a reduction of ≥3–4 points. The bations andinjection-sitereactions.Conclusions:PeakPruritus 2: 65%–72%).Commonly-occurring TEAEs were AD exacer emergent adverse events (TEAEs) (SOLO 1: 65%–73%; SOLO phase 2b study. Treatment groups had similar rates of treatment- responders at W2 and W16 using thresholds derivedfromthe asclassified were patients placebo-treated vs dupilumab- more observed (W2: −5 to 0; W16: −7 to 0). Across both phase 3 trials, 1046 at Gleń lanta Sokołowska- Wojdyło Clinic of Dermatology, Venerology and Allergology, and 9 th WorldCongressofItch 1 ,

Due to unclear and conflicting reports about role about reports conflicting and unclear to Due Magdalena Lange Arash Foroutan, 1 1 Nazgol-Sadat Haddadi,SattarOstadhadi, , no Żawrocki Anton 1 Ahmad-Reza Dehpour , Roman Nowicki 2 , Marta Malek 1 2 , Department of Małgorzata 1 , Jo- - - - -

Poland pernicus University Ludwik Rydygier Collegium Medicum inBydgoszcz, Department of Cosmetology and Aesthetic Dermatology, Nicolaus Co- Dominika Ragin,KatarzynaNowacka,BarbaraZegarska PATIENTS RECEIVINGEGFRI THERAPY REDUCTION OF PRURITUSINONCOLOGICAL PP40 through NOpathway. by activating5-HT1b/1d receptors. This effect probably mediates behavior. sumatriptan and L-NAME significantly decreased the scratching 5-HTR1d antagonist.Co-administrationofsub-effective dosesof reversed byintradermal GR-127935,the selective 5-HTR1b, and administration ofsumatriptanattenuatesCQ-induceditchwhich before intradermalCQ.Results:Intraperitonealand L-N-nitro arginine methylester(L-NAME),wasadministered doses ofsumatriptanandanon-selectiveNOsynthaseinhibitor, tan onscratchingbehaviorwasassessed.Finally, sub-effective in providingpruriticrelief. Research is being conducted on efficiency of antiepileptic agents atment includesnon-sedatingsecond-generation antihistamines. efficient enough,thustheyare notrecommended.Systemictre Antihistamines andlidocaineappliedtopicallyareprobablynot reducing thecoexistingpapulopustularrashshouldbeselected. commonly used, yet first of all, topically applied drugs aimed at various etiologies exist. Topical steroids or 1–3% menthol are of pruritus,different recommendations for reducing itchingof UV, syntheticclothingandperfumes.Dependingonthe severity ded. Moreover, patients are expected to avoid overexposuretothe alkaline soapsoralcoholcontainingmixtures,shouldbeexclu metics whichdehydrateandirritatetheskin,suchasretinoids, and humectants would diminish transepidermal water loss. Cos physiological lipidmixtures,substanceswithocclusiveproperties components, aswellemollients,shouldbeused.Delivering epidermal barrier. Cosmeticsrichingreasingandmoisturizing decreasing the pruritus by regaining the proper structure of the tients ontheproperskincare.Basicmanagementisfocused itching usingtopicalandsystemictreatmenttoinstructpa decreases QoL ofthepatients. As aresult,it isvitaltoreduce significantly it Nevertheless, change. drug a or alteration dose effect of EGFRI treatment. Pruritus is unlikely to require EGFRI areas affected withpapulopustular -themostcommonside often occursduringthetreatment.Itislikelytobelocatedin of pruritus.Itchingmayaccompanyxerosis,asideeffect which substance P activation, which is one ofthe major neuromediators likely associated with the EGFRI drugs due to their influence on therapy inapproximatelyhalfofthepatients.Itchingismost of months three first the during occurs usually pruritus EGFRI, number ofsideeffects, including pruritus. While treatingwith tiation andgrowthofepithelialcells,EGFRinhibitorsinducea cancer or head and neck cancer. Due to the impact on differen e.g. colorectal,pancreaticandbreastcancer, non-smallcelllung lignancies characterisedbyoverexpressionofEGFreceptor. EGFR inhibitorsaretargeted agentsusedfortreatmentofma Then, the effect oflocal and systemic administration ofsumatrip was evaluatedbymeasuringthenumberofboutsin30minutes. intradermally intothenapeofneckandscratchingbehavior rostral backmodelofitchwasused.Chloroquineinjected on CQ-induced scratching behavior. Materials andMethods: The neurotransmission. Thus, we investigated the effect ofsumatriptan previous studies,sumatriptaninhibitsNOSactivityand is usedtotreatmigraineandclusterheadaches. According to Conclusion: SumatriptansuppressesCQ-induceditch ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV logy, and Pharmacology, MedicalUniversityofVienna, Austria small noduleslocalizedonthehead orneck,andtheearsarea. A or papules orviolaceous red-brown agroupofseveral as presents disorder that typically occurs in young adults. ALHE usually inflammatory and vascular benign uncommon an is (ALHE) Background: Angiolymphoid hyperplasiawitheosinophilia 1 Patrycja Gajda PRURITUS OF THE SCALP EOSINOPHILIA – A CASEOF PERSISTENT ANGIOLYMPHOIDHYPERPLASIA WITH PP42 mediated perceptions. i.e. histamine-responsiveCMi,couldbefurtherinvolvedinLPA accounts fortheitchsensation. A smallsubgroupofnociceptors, activation ofnociceptorsaccordingtothespatialcontrasttheory depending onthe mode ofapplication. Presumably the focal CMi. tivated humannociceptorsandproduceditchpaininhumans histamine-responsive mainly fibres, or strong responses to the injection could be observed in few LPA injection. While CMwereexcitedratherweakly, medium mechano-insensitive (CMi,n=9of11), werebothactivatedby human nociceptors,mechano-sensitive(CM,n healthy volunteersandcholestaticpatients.Inmicroneurography, contrast, neither TC nor TLC inducedanysubstantialsensationin cold, mechanicalandelectricalstimuliremainedunchanged.In of pain.LPA induced asensitizationtoheat,whileresponses patients withPBCandPSC,LPA injectioncauseditchinginstead blocker A967079 reduced LPA-mediated symptoms. Insome hyperalgesia. Neitherthe TRPV1 inhibitorBCTCnorthe TRPA1 whereas the injection ofLPA induced dose-dependent pain and heat of LPA caused itch(mean±SEM;1.4±0.4vs.0.3±0.2;p<0.001), the peronealnerve.Results:Inpsychophysics,focalapplication at subjects human healthy in performed were C-fibres primary and electricalstimuli.Electrophysiologicalrecordingsofsingle nerve endings by LPA were tested using thermal, mechanical by laser Doppler imaging. Sensitization and desensitization of served as control applications. The flare reaction was determined intradermal injections.Histamine,capsaicinandthevehicleSIF applied intradermallyviaheat-inactivatedcowhagespiculesor the bile salts, taurocholate (TC) and taurolithocholate (TLC), were biliary cholangitisandprimarysclerosingcholangitis.LPA and 32 healthyvolunteers and 22cholestaticpatientswithprimary Psychophysical testing and microneurography were performed on signalling usingpsychophysicsandmicroneurography. Methods: to further investigate the involvement of LPA and bile saltsinitch of LPA inducedscratchingbehaviourinmice. This studyaimed ted with itch intensityin pruritic patients and intradermalinjection symptom. SerumlevelsoftheLPA formingenzyme ATX correla has recently been identified as potential mediator of this agonizing frequently accompanied by pruritus. Lysophosphatidic acid (LPA) Introduction: involvingcholestasisare disorders Hepatobiliary 1 Margareta Miriam Düll APPLICATION PAIN INHUMANSDEPENDINGON THE MODEOF LYSOPHOSPHATIDICITCH AND INDUCES ACID PP41 Stengel der-University Erlangen-Nürnberg, Germany, Sikora Andreas E.Kremer Specialist MedicalPracticeMałgorzataJabłońska,Poland Department ofDermatologyMedical University of Warsaw, Department ofMedicine 1 andInstitute ofPhysiology and Pathophysio 1 , MałgorzataJabłońska 1 , 2 Institute of Physiology and Pathophysiology, Friedrich-Alexan Peter W. Reeh 1 , Adriana Rakowska 1 2 , 1 , Michael J.Fischer Lina Wurm 2 1 , Joanna Czuwara 1 , 3 Center for Physiology and Vivien Ries Conclusion: LPA 3 , Barbara Namer =22 of34)and 2 1 , 2 , Individual Martina Mariusz

ac 2 - - - - , TREATMENT? ABOUT THE PREVENTION,DIAGNOSIS AND ONCOLOGY -DO WE KNOW EVERYTHING THE PROBLEMOF THE ITCHINSURGICAL PP43 pruritus stoppedtheprogressionofdisease. was mostlikelystimulatedbypersistentitch.Reductionofthe gest thatitisanunusualreactiveprocess.Inourcase,thedisease considered anatypicalvasculartumorbutnumerousfactorssug is and partialresolveofthepreviousones.Conclusion:ALHE tus wasachieved,whichstoppedappearanceofnewskinlesions were used for the treatment. A significant reduction of the pruri of eosinophils. number Triamcinolonemg/ml10 injectionsof the bloodvessels, proliferating capillaries andcellular background. Histopathologicalexaminationrevealedclustersof a normal hair-shafts and cloud-vessels on a homogenous pink mechanical . The trichoscopyshowednoduleswith nodular lesionswerefoundinthescalp,stronglybleedingafter cryotherapy. mitant persistentpruritusnotrespondingtotopicalsteroidsand should beperformedinthefuture. resolved. More specific scientific analyzis and targeted programs itch insurgical oncologypatientsisstillimportantandnotfully bases. data scientific open the The mostcommonanddetailed materialshasbeenfoundusing oncology. surgical of field the in deliberations dermatological itch hasbeenreportedandwhichshouldbeimortantinfuther we havepresentedthemostcommontypesofcasesinwhich sible development in this problematic field. our analyziswehavealsosearchedtheinformationsaboutpos Our materialconcernedthetimeperiodof2002and2017.During of patientsinwhichtheproblemitchhasbeendiagnosed. the clinicaldatafromreferencecenterforsurgical oncology of the itch in surgical oncology. In this study we have collect also papers, recomendationsandgudelinesreffering totheproblem scientific of analyzis review comperhesive an performed have important innexyyears.MaterialandMethods:Inthisstudywe future development ways and new creatingideaswhichcouldbe to resolvethisproblem.Additionalywehaveassedthepossible possible diagnostic and therapeutic options developedglobaly the generalincidenceofitchinsurgical oncologypatientsalike in oncologicpatients.Aim: The aimofthis studywastoanylze oncology becomes the still not fully resolved problem of the Itch options. To the one of such problematic fields in current surgcal speciality anewtypesandformsofsuportivecaretreatment medical specific this in create to need big a stiil is there results Beside thestillobtainedbetterprognosticandgeneralovercome alike diagnostic options has been introduced into the clinic. cent years a significant number of new and innovative treatment Introduction: The surgical oncologyisstiilldeveloping.Inre 1 Katarzyna Nowacka diameter of1cmintheoccipitalandparietalregionwithconco 2014, progressivelyincreasingnodularlesionswithamaximum and theyspontaneouslyresolvedafterafewmonths.Since first report: Case pruritus. accompanyingpersistent area with The female withseveralnodulesinvolvingtheoccipitalandparietal injury. probably roleinthepathogenesisofdiseaseisamechanical Professor Franciszek Łukaszczyk Memorial Hospital in Bydgoszcz, Poland Bydgoszcz, NicolausCopernicusUniversityinTorun,Oncology Centre - partment ofSurgical Oncology, LudwikRydygier’s Collegium Medicum in minika Ragin Chair of Cosmetology and Aesthetic Dermatology, and violaceus nodulesintheoccipitalareaappeared2011 Objective: We reporta rare case of ALHE in a38-year-old 1 Results: Inthephysicalexaminationanumberof , BarbaraZegarska composed mainlyof 1 , Maciej Nowacki Conclusion: The problemofthe 1 infiltrate, localized around localized infiltrate, 2 , Acta DermVenereol 2017 Poster abstracts Wojciech Zegarski lymphocytes Results: Inthisstudy 2 Chair andDe- and large 2 , 1047 Do------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta nal Dermatology, UniversityHospital Heidelberg, Weisshaar Dermatology, Kuenzelsau, neurography revealedaseveresensomotoric polyneuropathy. To Electro developed nausea,vomitingand neurologicalsymptoms. reluctant to do. Four months later he had lost 10 kg of weight and full body check-up (Internal Medicine, Neurology)which he was of systemiccorticosteroidsapplied once.Hewasadvisedtogeta The patient’s historyrevealedagoodresponseofCItocourse and sharp character and was suspected as possible neuropathic itch. shoulder, thighs)inDecember2015.CIwasofburning,stinging developed chronicitch(CI)onnormallookingskin(head,arms, logical disorders,mayoccur. We presenta68-year-old malewho neurological syndromes (PNS), defined as a group of rare neuro haematological and/orsolidtumourmalignancies.Paraneoplastic “Paraneoplastic itch”isusedtodescribeitchinpatientswith malignancy. underlying an of sign first the be may and lignancy or symptoms. They canbecausedbyanindirecteffect ofma Malignancies canbeaccompaniedby paraneoplastic syndromes 1 Minaya Beigi SENSOMOTORIC NEUROPATHY MALIGNANCY RESEMBLINGPARANEOPLASTIC (CI): GENERALIZEDCI AS A FIRST SIGNOF THE FATAL COURSEOF CHRONICITCH PP45 mechanism ofpathophysiologyCKD-aP. that thereceptorsaremoreimportantthanpruritogeninperipheral indicates that the unique pruritogens of CKD-aP may not exist and β-endolphin, IL-6 and calpain between studied groups. This study was nodifference intheintensity ofexpressions Ach, NGF, the skin of CKD patients withandwithoutCKD-aP. But, there in stained positively were calpain and IL-6 β-endorphin, NGF, in theskinwerestudiedaspruritogens. The expressionsof Ach, tive intestinal peptide (VIP), leukotriene B4 (LTB4) and calpain β-endorphin, adenosine triphosphate (ATP), substance P, vasoac (Ach), nervegrowthfactor(NGF),histamine,interleukin6(IL-6), with immunohistochemistry. The expressions of acethylcholine surgeons. The expressionofpruritogenintheskinwasstudied fistula arteriovenous the of formation during elbow or forearm the at obtained were samples Skin japan. in itch of classification 2013 to2016. The degreeof prurituswasscoredwithShiratori’s and 20subjects(10withCKD-aP and10withoutpruritus)from (14 withCKD-aP and15withoutpruritus)from2010to2012 CKD-aP and10withoutpruritus)from2007to2009,29subjects and 6withoutpruritus)from2004to2006,23subjects(13with study included16subjectsonCKDstage5(10withCKD-aP gens intheskinofCKDpatientswithandwithoutCKD-aP. The This studywasundertakentoanalyzetheexpressionsofprurito many skindiseases(e.g.,atopicdermatitis) havebeendiscovered. mast cell,lymphocyteandsoforthintheskinofpatientswith many pruritogens originated keratinocyte, macrophage/monocyte, modulators andthereceptorsofCKD-aP areimportant. To date, disease (CKD)associatedpruritus(CKD-aP),thepruritogens, In peripheralmechanismofpathophysiologychronickidney 1 Akishi Momose ASSOCIATEDDISEASE PRURITUS WHAT ARE PRURITOGENS OF CHRONICKIDNEY PP44 1048 Kumakawa kami logy, Aomori GeneralHospital, Mergentheim, Germany Medicine, Hirosaki UniversityGraduateSchoolofMedicine,Japan Department ofClinical Social Medicine, Environmental andOccupatio Department of Urology, Jusendo General Hospital, 3 9 th 1 WorldCongressofItch 1 , Yasauo Shiraiwa 1 , Michael Haeberle 1 , Michihiro Yabe 3 Institute of Pathology, CaritasHospital,Bad 3 Department ofPathology and Molecular 1 , Tomomi Kusumi 2 1 , , Andreas Gschwendtner Shigetoshi Chiba 2 Department of Patho- 2 Private Practice for 2 , Hiroki Mizu- 1 , Kenjirou 3 , Elke ------the seedregionsleftposteriorinsulaforexploringan“input”net Individual meanMRI(BOLD)timecourseswereextractedfrom BA8 andBA45thechangeswerealsocorrelatedwithindivi predominantly increasedtofrontalareas(BA8,BA9,BA45).In conditions. UnderitchtheFCwithposteriorinsularcortex contrasts werecalculatedbetweenrestingstateanditchorpain Weiden, Germany NETWORKS FORITCH AND BURNINGPAIN FUNCTIONAL CHANGESIN THE CEREBRAL PP46 by ayetundiagnosedmalignancy. skin changesfollowedbyneurologicalsymptomscanbecaused steroids. ItshouldberememberedthatCIwithoutconcomitant also explainthegoodresponseofCItoatherapywithsystemic humoral mechanisms. A falselyinitiatedimmunereactioncould an indirecteffect throughvariousmediators including immune and tumour. The mostprobablecauseofparaneoplasticsymptomsis the first paraneoplastic symptom, triggered by the neuroendocrine therapy, thepatientdiedin mostlikelythatCIwas April 2017.Itis location was never detected in our patient. In spite of chemo was demonstratedinourcase.However, theprimarycarcinoma granin A, synaptophysin,CD 56) inimmunohistochemistrywhich (pACC) andthe left amygdalawhile the coupling decreased to the regions (BA 10),posteriorpartsoftheanteriorcingular cortex input. Enhanced FCwas found of the PAG withmedial frontal feedback betweenendogenous pain inhibitionandcortical brain regionsbutdecreasedwith thePAG, indicatinganegative 6). UnderpaintheFCofposterior insulaincreasedwithmany nectivity decreasedtothecaudatebodyandfrontallobe(BA subgenual partsofthe ACC, andtheleftamygdala,whilecon dual ratings ofitch. The FCwith the PAG increased within pACC, and otherregionsinawholebrainstudy. Ina2 correlation coefficients were calculated between the seed regions work andthePAG forexploringthe“output”network.Pearson’s of lessthan50 (0.05% for30minutes). This leadtoheatpainbytemperatures healthy subjectswaspretreatedbytopicalapplicationofcapsaicin during itchandpain.Forpaintheskinofrightforearm18 our hypothesis thebehavior oftheresting state networkis changed bination with functional connectivity (FC)analyses. According to modulation ofthosenetworksusingfunctionalimagingincom changes incerebralnetworks.Inthisstudywefocusedonthe that theprocessingofpainfuloritchyinputisbasedonactivity From manyfunctionalimagingstudiesageneralnotionevolved 1 Clemens Forster respectively.2 The the secondfMRIsequenceitchorpainstimuliwereapplied, free fromstimulationtodetectthedefaultmodenetwork.During a connectivity fMRI-design with EPI sequences. The first run was forearm. IntwofMRIsessionsitchandpainwereassessedusing induced byiontophoresisofhistamineintotheskinvolar temperature was1 and apositivestainingwithneuroendocrinemarkers(chromo The diagnosisrequiresthepresenceofaneuroendocrinepattern high gradeneuroendocrinetumors,typicallyofpulmonaryorigin. neuroendocrine carcinoma(LCNEC)whichisararesubgroupof lymph nodebiopsyprovedmetastasisbyalarge cell detect the underlying malignancy. In November 2016, mediastinal antibodies. Therefore, aclosefollow-upschemewassetupto Anti-Hu antibodies, the most frequently identified paraneoplastic evidence ofatumour, lumbarpuncturerevealedthepresenceof and lumbarpuncturewereperformed. While imagingshowedno (e.g. chestX-ray, ultrasoundoftheabdomen,pelvisCT scan) detect apotentialunderlyingmalignancy, imagingexaminations Hermann O.Handwerker Physiology 1, FAU Erlangen, o C duetothermalhyperalgesia. The stimulation 1 , o C above the individual pain threshold. Itch was C abovetheindividualpainthreshold.Itchwas Verena Vierow nd sessionwasnotearlierthan2weekslater. 1 2 University of Applied Science Amberg-of Applied University 1 , Miriam Rank nd 1 , levelanalysis Ralf Ringler 2 ­ - - - - - , Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Juntendo UniversityUrayasuHospital,Chiba,Japan Takamori TGI significantly reduced the itch intensity (p<0.05), while inno analogue scale(VAS 0–10, 0noitch,10worstitchimaginable). intensity wasrecordedovertime forupto15minutesonavisual years) withastandardskinprick lancetonthevolarforearm.Itch (age24±0.38 appliedin8healthysubjects Reinbek, Germany)was investigated. Histaminedihydrochloride (1.0%, Allergopharma, effect ofcoldapplicationalone(18°C)onitchintensitywasalso thermal grillon histamine-evoked itch in healthyvolunteers. The thermal stimuli of 18°C and41°C)produced by acustom-made was toinvestigatetheeffect ofmixedtemperatures(notnoxious thermal grillillusion(TGI).Hence,theaimofthispilotstudy within non-noxiousthermalrange. This canbeachievedbyusing at clinic. Therefore, it would be optimal to use counter stimuli can lead to skin damage and therefore would not be suitable bition hasbeenelucidated.Noxiousthermalstimuli,however, itch. Recently, centralneuronalprocessingunderlyingthisinhi that counter-stimuli includingnoxiousthermalstimulicaninhibit effective andsafetreatmentforitchisstilllacking.Itknown Itch is an unpleasant sensation that causes a desire to scratch. An borg University, Denmark Department ofHealthScience and Technology, Faculty of Medicine, Aal- Daniele Riccio HUMANS ILLUSION ONHISTAMINE-EVOKED ITCHIN ANTIPRURITIC EFFECT OF THERMAL GRILL PP48 are associatedwiththepathologicalprocessofpsoriasis. from day 2 to day 3. These findings suggest that spinal microglia control mice.Hypertrophiedmicrogliaweretransientlyincreased spinal microgliaintheIMQ-treatedmicecomparedwiththat immunohistochemical analyses showed morphologicalchangesof manner, withthesevaluesreachingapeakatday4or5.Our behavior and transdermal water loss (TEWL) in atime-dependent exhibited worseningscoresofdermatitisandincreasedscratching They days. five for skin back rostral their to IMQ of application mouse (IMQ-treatedmice). C57BL/6Jmice received daily topical model dermatitis psoriasis-like an imiquimod(IMQ)-induced and astrocytes in the pathological process of psoriatic itch using this studywasperformedtoinvestigatetherolesofspinalmicroglia roles ofspinalglialcellsinpsoriaticitchremainunclear. Therefore, cement ofitchinatopicdermatitis-likemodelmice.However, the such as microglia and astrocytes, in the sensitization and enhan Recent studieshaverevealedtheinvolvementofspinalglialcells, quality of life, for which existing treatmentis largely ineffective. Intractable itchisasymptomofpsoriasisthatimpairspatients’ 1 Ryohei Kosaka PSORIASIS-LIKE DERMATITIS MODEL MICE THE PATHOGENESIS OF IMIQUIMOD-INDUCED INVOLVEMENT OF SPINAL MICROGLIA IN PP47 networks processingpainanditcharenotidentical. output ofthepaincontrolsystem,ourresultsindicate thatcerebral a negativefeedbackbetweenpaininput(butnotitchinput)and thalamus andS2(BA 40).Besidestheinterestingresultindicating ronori Matsuda Tokyo UniversityofScience,Katsushika-ku, Science and Technology, Faculty of IndustrialScience and Technology, versity GraduateSchoolofMedicine, Chiba, Nielsen, Nørgaard, Janne DjernisChristensen,MiaBirkholmLausten, Institute for Environmental and Gender Specific Medicine, Juntendo Uni- Juntendo Medicine, Specific EnvironmentalGender for and Institute Parisa Gazerani 1,3 Hjalte Holm Andersen, Hjalte 1 1 , , , Mitsutoshi Tominaga Mark Brendstrup Bødker, Justina Rusteikaitè, Yasuhiro Tomooka 2 Laura Petrini, , Chiharu Nishiyama 1 , 3 Department ofDermatology, Nobuaki Takahashi 2 Department ofBiological Anders Lindby Lars Arendt- 2 , 1 Kenji , Hi- - - - Nashan University-Hospital Münster, Germany generalization ofthepruritus. with gabapentincouldprobablyhavepreventedthesecondary the patient.Itcouldbespeculatedthatanearliersystemictherapy density. Gabapentin wasaneffective andwelltoleratedtherapyin fiber nerve intraepidermal via demonstrated was pruritus the of pruritus whichsubsequentlygeneralized. The neuropathicnature brachioradial trigger can stroke apoplectic an that time first the tolerated andtheNRSreducedto3. This case reportshowsfor could beslowlyincreasedupto1200mg/d. This therapywaswell Therefore westartedasystemictreatmentwithgabapentinwhich reduced. significantly was leg lower the of density fiber nerve reduced and sleeping was disturbed; NRSwas 8-10. Intraepidermal disease for the generalization could be found. Quality of life was came even worse and generalizedtothewhole body. No underlying corticosteroids andantihistamineswithoutsuccess,pruritusbe stroke. After someyearsofdifferent topicaltreatments,systemic the dorsolateralsidesofbotharmsoccurringafteranapoplectic on 79-year-old manwhosuffered fromsevereprurituslocatedon is usuallylocalizedatthedorsolateralpartofarms. We report Brachioradialpruritus(BRP)isararetypeofchronicthat 1 Małgorzata Małek GABAPENTIN SUCCESSFULLYPRURITUS TREATED WITH SECONDARY GENERALIZEDBRACHIORADIAL PP49 thermal grilldevice. test thishypothesiswithapplicationofanewlydevelopedmobile itch reliefatclinic.Furtherstudiesareplannedinourgroupto in beneficial be would grill thermal that proposed therefore is It fect ofthermalgrill on histamine-evokeditchmodel in humans. ef itch-relieving the presenting report first the is This (p>0.05). effect significant any show not did alone application cold cuous than weexpected. These resultssuggestthatneuralnetworks that GRP components manypostsynaptic connectedwith terminals formation in the spinal dorsal horn. The 3-D SEM analysis revealed to analyzethe3-Dultrastructure oftheitch-mediatingsynaptic microscopy (3-D SEM) combined with immunohistochemistry vesicles. Furthermore, we used 3-dimentional scanningelectron terminals containmanyclearroundvesiclesanddense-cored in rats.ImmunoelectronmicroscopyshowedthatGRP-positive regions where GRP immunoreactive fibers appeared to terminate system. GRP receptormRNA andproteinwereexpressedinthe somatosensory systembutalsointhetrigeminal important neuropeptide foritch transmission not only in the spinal spinal dorsal horn in rats. These findings suggested that GRP is an the caudalpartofspinaltrigeminalnucleusandalllevel was expressedinthesmall-sizedprimaryafferents andprojectedto neuronal marker in the somatosensory system. We found that GRP rodents and 27 residues in primates. We focused on GRP as an itch Gastrin-releasing peptide (GRP) is a 29-amino acid peptide in 1 moto Keiko Takanami IN MAMMALS ON THE GASTRIN-RELEASINGPEPTIDE SYSTEM EVOLUTIONAL ANALYSES OF ITCHFOCUSED MORPHOLOGICALMOLECULAR AND PP50 Japan nal Institute for Physiological Sciences, Nishigonaka, Myodaiji, Okazaki, Technology, OkayamaUniversity, Ushimado,Setouchi, Okayama, Hautklinik, Klinikzentrum Mitte, Dortmund, Ushimado MarineInstitute, Graduate School of NaturalScience and 1 , Hirotaka Sakamoto 1 , HartmutStänder 1 , Keita Satoh 1 , Laura vonDücker 1 1 1 , Kazuyoshi Murata 1 , 2 Center forChronic Pruritus, Sonja Ständer Acta DermVenereol 2017 Poster abstracts 2 , Tatsuya Saka- 2 , Dorothée 2 Natio- 1049 - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Dermatology and Allergology, Tenon Hospital,Paris,France, cine, Section ofDermatology, University ofFlorence, Italy, ment of Dermatology, Wakayama Medical University, Japan, logy, University Hospital of Brest, France, sery Shimada Municipal Hospital, Shimada, Japan, of DermatologyandVenereology, Chittagong Medical College, Pakistan, of Dermatology, PoznanUniversity of Medical Sciences, Poland, 7 1 Hasegawa Dominik Samotij ERYTHEMATOSUS: AN OVERVIEW PRESENTATION OF PRURITUSINCUTANEOUS STUDY ON THE PREVALENCE AND CLINICAL A MULTINATIONAL CROSS-SECTIONAL PP52 of nervoussystematthelevelcervicalspine. pruritus isanexampleofneuropathicitchrelatedtothedamage Our casepresentationfurthersupportstheideathatbrachioradial weeks. several within symptoms the of improvement significant C6 levelweredescribed.Patientstartedpregabalintreatmentwith then levelifC6/C7.Inaddition,herniateddiscsatC3/C4andC5/ resonance ofcervicalspinerevealedapressureonduralsacat also complained about severe pain of cervical spine. Magnetic with sun exposure. Although the patient was a young woman, she cording topatienthistory, pruritus exacerbationswereconnected all skinlesionswereassessedassecondarytoscratching. Ac periodically visible pruritic papules ontheupperarms. Clinically, sion tothehospital.Patientreportedpresenceofsevereitchwith First symptomsofthediseaseappeared10yearsbeforeadmis skin overlyingtheproximalheadofbrachioradialismuscles. woman suffering frompruritus oftheupperarmsaffecting the Caucasian 29-year-old a itch. report neurologic We as classified disease remainsunclear, however, thistypeofpruritusisfrequently the first time by Waisman in 1968. Up to date the etiology of this Brachioradial pruritusisararepruriticcondition,describedfor cal University, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Justyna Szczęch, CERVICAL RADICULOPATHY OFWOMAN ASASYMPTOM CAUCASIAN BRACHIORADIAL PRURITUSIN A YOUNG PP51 itch-mediating functioninmammals. results suggestthatthissystemmaybeaconservedpropertyfor mals suchasprimitiveeutherians,rodents,andprimates. These expression anddistributionofGRP wereconsistentacrossmam among mammals.Immunohistochemicalanalysisshowedthatthe C-terminal-fragment ofmatureGRP hadhighlybeenconserved the deducedaminoacidsequenceofGRP-10whichisapossible musk shrews,mice,ratsandmacaquemonkeys. We found that the phylogeneticandcomparativeanalysesusing Asian house unpleasant itchsensation. To addressthesequestions,weutilized quires theitchsensationduringevolutionandwhywepossessan the spinalcord.Next,wehadquestionofhoworganism ac controlling theitchtransmissionareextraordinarycomplexin 1050 Adamski Aminul Islam cal Sciences, UniversityofFukui,Japan, USA, ical University, Poland, Werth Chasset Perelman SchoolofMedicine, University ofPennsylvania, Philadelphia, Department ofDermatology, Venereology and Allergology, Wroclaw Med- 10 8 , 14 Department ofDermatology, Schoolof Medicine, Faculty of Medi- Mohammad Rafiqul Mowla , 3 9 Adam Reich 4 , , th Aleksandra Dańczak-Pazdrowska Aleksandra 8 WorldCongressofItch , Jacek C. Szepietowski Hideo Hashizume 6 , Carolyn Kushner Adam Reich 1 , 1 utn Szczęch Justyna 2 Department ofSurgery andTranslational Medi- 9 , Adriana Polańska Adriana 11 1 7 , , , Aleksandra Lesiak Daisuke Tsuruta Takaharu Ikedam 1 , 9 11 Department ofDermatology, Emiliano Antiga Department of Dermatology 10 4 Department of Dermato- , Fukumi Furukawa 4 , 3 Department of Laurent Mi- 13 12 6 4 Department Department 5 , , , Zygmunt 2 Victoria , 5 Minoru Depart- Adam 5 - - - - , Osaka City University, Japan, Medical University of Lodz,Poland, of Dermatology, Pediatric Dermatology and Dermatological Oncology, during thecongress. data caption.Preliminaryfromthestudywillbepresented the facilitate to file database electronic an with along centers Ethic Committee.Subsequently, it was senttoallparticipating final version of the questionnaire which was approved by Local for comments. After includingallcommentswehaveprepareda The preliminary questionnairewas sent to participating centers (DLQI) andEuroQolFiveDimensionsQuestionnaire(EQ-5D). of lifewasdeterminedusingDermatologyQualityLifeIndex SLEDAI). The subjects’ well-beingandhealth-relatedquality and SeverityIndex)aswellsystemicsymptoms(SELENA- on the subtypes of CLE and severity of cutaneous (with CLE Area pects ofpruritus as well as including sociodemographic data, data study wehavedevelopedaquestionnaireassessingvariousas the of step first centers). the and (5 As center) Asia (1 America between racesandclimateincludingEurope(6centers),North in CLEdiagnosticsandtreatmenttocoverpossibledifferences continentswithspecialinterestselected centersfromvarious adult patientssuffering fromvarioussubtypesofCLE. We have prevalence, intensity, andclinicalcharacteristicsofpruritusin prospective, cross-sectionalstudyin order to precisely assess the very limited. true prevalence and clinical characteristics of pruritus in CLE are cutaneous lupuserythematosus(CLE),however, studiesonthe tissue diseases,includingsystemicsclerosis,dermatomyositisand ted, thatitmayalsobeassociatedwithautoimmuneconnective ous inflammatory skin conditions. Some recent data have indica Pruritus is an important symptom frequently accompanying vari case (itch,n 16 white, age range 47–85 years). The sample was divided between serum were obtained from 21 patients with venous ulcers (14 male, have notbeendetermined. Methods: Specimens of wound fluid and ulcers. The pathophysiologyandetiologyofwound-relateditch which canresultingreatdistressforpersonswithchronicvenous clinical problem whichhas been inadequatelycharacterized and of developingitch.Background: Venous ulceritchisarecognized while uncoveringpotentialbiomarkersforthoseatgreatestrisk overall understandingofthebiochemistrywoundrelateditch, cant differences inthemetabolome ofbiomatrices,increasingour hypothesized that using metabolomics we would identify signifi venous ulcersthatitchedcomparedtothosedidnot. We with persons from serum and fluid wound of profiling chemical Purpose/Hypothesis: 1 Julia Paul ANALYSIS OF WOUND FLUID AND SERUM PILOT STUDY OF VENOUS ULCERITCH: PP53 Michigan, USA of Pennsylvania,Philadelphia,USA and Venereology, ChittagongMedicalCollege, Pakistan, wound fluid produced a predictive algorithm with AUC = 0.919, for wound fluid (p Selected compoundsconverged toformpredictivemodelsof itch of wound-relateditchepisodes rangedfrom2to10(mean=8). analyzed usingLC-MS/MS(Biocrates p180).Results:Intensity was Woundfluid NMR). (1H spectroscopy resonance magnetic chromatography (LC-MS/MS; Biocrates p180)andproton nuclear conducted using targeted mass spectrometry coupled with liquid without wound-relateditch.Metabolomicanalysisofserumwas comparison ofwoundcharacteristicsbetweenpersonswithand Wound assessmentsandpatientinterviewswereconductedfor Oakland University, Rochester, 1 , StewartGraham =10) and controls (no itch, For that reason we have organized a multinational, <0.3) and serum(p We aimed to use metabolomics forbio 14 2 Perelman School of Medicine, University 1 Beaumont Research Institute, Royal Oak, <0.2). Logistic regression for <0.2). Logistic regression for n 13 =11) based on self-report. Department ofDermatology, 12 Department - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV mingham, Alabama, Care, Worcester, Massachusetts, University ofMassachusettsMedical School andUMassMemorialHealth were analyzed using SPSS, version 17 (T12) were compared with the initial treatment phase (T0). Data Dermatology Index).DatafromSCORAD andDLQIat12months SCORAD (Scoring Atopic Dermatitis)andDLQI(Quality of Life- was assessedbythetherapyusedandquestionnaires: evaluated fortreatmentwithomalizumab. The clinicalresponse Pts withsevere AD refractorytotherecommendedtherapy, were evaluate the efficacy and QoL of pts under omalizumab. in patients(pts)withatopicdermatitis(AD). This studyaimsto improvement incutaneoussymptomsandqualityoflife(QoL) despite theoptimization oftherapy. Omalizumab isassociatedwith Introduction: Controllingsevereeczemaisnotalwayspossible Hospital DeSantaMariaCHLN,Portugal Rita Aquiar, DEPARTMENT PORTUGUESE IMMUNOALLERGOLOGY WITH OMALIZUMAB:EXPERIENCEOF A TREATMENT OF SEVERE ATOPIC DERMATITIS PP55 highest h-index,whichmeasuresanauthor’s cumulativeimpact. lowed by Schmelz and Kuraishi. Yosipovitch is the author with the total citations,isthemostcitedauthorofitcharticlesoverall,fol compared to10papersduring2011–2012. Yosipovitch, with2,201 Nature orNEJM,foratotalof15publishedinkeyjournals,as Pain, twiceinPNAS,onceScience,andnotatallLancet, in NatureCommunications,twiceMedicine,8times 85, 1289–1304).During2015–2016,itchpapersappearedtwice cited itch article of papers published in 2015–2016 (Neuron, 2015, 8003–8008), whereasFosterandcolleaguespublishedthemost most citeditcharticleduring2015–2016(JNeurosci,1997,17, the was colleagues’ paper and 1997 Schmelz Reports. Scientific in Dermatology, Handbookof ExperimentalPharmacologyand the largest numberofitcharticles, followedbyCurrentProblems During 2015–2016, Acta Dermato-Venereologica againpublished pruritis –stillmanagestoevadecorrectionfromtimetime. frequently thanitchinarticletitles. The commonmisspelling- high of198 articles in2015.Prurituscontinuestobeusedmore 1834, 23,59–62);thisnumberhasincreasedsubstantiallytoa In 1834,only1articleaboutitch/prurituswaspublished(Lancet, 1 Melissa McEnery-Stonelake THE BIBLIOMETRICSOF ITCH:2017UPDATE PP54 allow ustodeveloptherapeuticagentsforstrategicintervention. understanding ofhowandwhysomepatientsdevelopitchwill the pathophysiologyofwoundrelateditch. developing venousulceritchwhileincreasingourunderstandingof potential of using metabolomics for identification of those at risk of and tyrosine metabolism. Conclusion: This study demonstrates the serum includeglycolysis/gluconeogenesis,nitrogenmetabolism, predictive accuracy of 82.6%. Pathways significantly perturbed in to produceamodelforserumusingbetaineandPCaeC424,with cyanoamino acid,andsulfurmetabolism. Pathways significantly perturbed in wound fluid include methane, using concentrations of citrulline, threonine, serine and asparagine. Surgery, Shrewsbury, Massachusetts,USA inhibitors andanti-H1antihistamines. 7patientssensitizedto 10 mg/day, topicalandoralcorticosteroids,calcineurin IgE 8835(2296–21691)KU/l. All patients weregivenmontelukast atopic patients(14men)withsevere meanage31years. AD, Total la Alonso,AméliaSpínola, Department of Dermatology, University of Alabama at Birmingham, Bir Ana Mendes, 2 Division of Dermatology, DepartmentofMedicine, Ana CéliaCosta,FátimaDuarte,Estrel- Elisa Pedro, ManuelPereira-Barbosa 1 , Jeffrey D.Bernhard 3 Kuchnir Dermatology & Dermatologic ® , p -value <0.05. ROC analysiswasused A morecomprehensive 2,3 24 Results: 24 Methods: - -

Ständer BULLOUS PEMPHIGOID CHRONIC PRURIGOMASKS THE FINDINGOF A PP56 an improvementinQoL inpatients’ perception. AD arerefractorytoothertherapies. The treatmentdemonstrated AD andappearstobeasafealternativewhenpatientswithsevere p Omalizumab, of duration with correlation significant a show not of 21),whichhadanextremelysevereimpactonQoL.QoL did patients’ QoL (meanscoreof6.6)comparedto T0 (meanscore pts. In T12 the AQLQ showedthat AD hadamoderateeffect on a moderate-severe QoL effect in12outof24pts,ie50% Analysis oftheDLQIscoreshowedthatcutaneouspathology. has temic adversereactionsand1patienthadexuberantlocalreaction order to unmask potential associated diseases. order tounmaskpotentialassociated diseases. our casealsoadvocatesthorough diagnosticsofCPGpatientsin not sufficient to cure CPG. This needs an own approach. However, Once CPG is established, the therapy of the underlying etiology is asinthiscase bullouspemphigoid. gered byotherpruriticdiseases demonstrates thatchronicprurigo isadiseasewhichcanbetrig pruritus intensitydecreasedfrominitial10to1. This casereport erapy withcyclosporineandnaloxoneintravenous.Duetothis,the the CPGandassociatedprurituspersisted. We initiatedath controlled and antibodies could no longer be detected. However, 1.5 yearsanddapsone100mgdailythebullouspemphigoidwas 500mgfor3dayseveryfourweeksandover doxycycline 200mgdaily. Underacyclictherapywithintravenous discontinued duetopancreatitis),minocycline200mgdailyand goid. Previoustherapyconsistedofazathioprine50mgdaily(this titer of1:8,000,thusleadingtothediagnosisbullouspemphi membrane, while the indirect basal immunofluorescence showed the an IgG in deposits C3 and IgG showed immunofluorescence examination revealedalterationstypicallyfoundinCPG.Direct nic pancreatitisandspondylosiswithchronicpain. A histological not present. Concomitant diseases included stomach ulcers, chro displayed pruriginousnodules;otherlesionssuchasblisterswere on thevisualanalogscale).Oninspectionwholeintegument Additionally, thepatientreporteda highly intensepruritus(10/10 months later, itbecamegeneralizedtotheremainingintegument. The CPGwasinitiallylocalizedattheleftfoot;however, afew burning andpainfulsensationsintheskintriggeredbywarmth. more than 6 years. In addition to itch, she reported experiencing we presentacaseof61-year-old femalepatientwithCPGfor a chronicitch-scratch-cycleleadingtoCPG. To illustratethis, pruritus which results in scratching of the skin finally establishing or unknowncauses. All thesediseaseshaveincommontoinduce neurological, psychiatric/psychsomatic,multifactorialdisorders by avarietyofdiseasessuchasdermatological,butalsosystemic, Chronic prurigo(CPG)isaseverediseasewhichmightbetriggered versity HospitalMünster, Germany Competence Center Chronic Pruritus,DepartementofDermatology, Uni- Caroline-Donata Forner, was variable. 1 patient(4.3%)didnotimprove. There werenosys treatment timefrominitiationoftoinitialimprovement and 6(26.1%)patientshadapartialresponse,althoughthemean 28.5 (T12).15of24patientshadacompleteimprovement(65.2%) re-referral andthemeanSCORADincreasedfrom65.5(T0)to systemic corticosteroidtherapywassuspendedwithoutclinical medication wasreducedindoseandthenumberofdrugs, From thecomparisonbetween T0 and T12 itwasfoundthatthe 300–600 mgevery2weeksinanaverageof16(12–73)months. and 1withIgGunresponsive.Omalizumabwasadministeredsc, 12 patientsreceivingcyclosporine,2withazathioprine, (6–36) monthspriortotreatmentwithoutclinicalimprovement. Dermatophagoid mitesunderwentImmunotherapy(IT)for16 =0.04. Conclusion: Omalizumabwaseffective inthetreatmentof Jan Ehrchen, Acta DermVenereol 2017 Poster abstracts Claudia Zeidler, Sonja 1051 - - - - -

Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta stitute ofOncology, Warsaw, Poland of Uro-Oncology, M.Sklodowska-Curie MemorialCancerCenterandIn- Olszewska basic characteristicsandskincare behaviorswereanalyzed.Re pruritus-related skinproperties and associatedfactorsincluding microscopy, stratumcorneum(SC)hydration,andskinpH. The skin blotting, skin by examination direct were inflammation by interview, and skin properties including barrier function and Indonesia. Basiccharacteristics and itching datawere obtained conducted inPanti Werdha, public nursing homesforelderlyin associated withthem.Methods: This cross-sectionalstudywas skin propertiesrelatedtopruritusandidentifythefactors abnormalities. The purposesofthisstudyweretoexplorethe macroscopic of lack the to due pruritus of cases assess to ficult the bedriddenandcognitivelyimpairedelderlypatients,itisdif Background: Pruritusisacrucialprobleminagingsocieties.In 1 Dianis WulanSari INDONESIA PANTI WERDHA, PUBLICNURSINGHOMESIN FACTORS AMONG ELDERLY RESIDENTSOF PROPERTIES OF PRURITUS AND RELATED PP58 tegies shouldincludethecontrolofitch. Conclusion: InpatientswithNethertonsyndrometreatmentstra IgE (732IU/ml).Emollientswererecommendedtoreduceitch. Laboratory investigationsrevealedincreasedserumleveloftotal associated withitch(5in VAS, 5pointsinItchquestionnaire). were presented in the genitoanal area. The anogenital lesions were eyelashes wasobserved.Hyperplasticpapillomatousskinlesions the entireskinsurface.Completelossofscalphair, eyebrowsand During admission, the patient had scaling involving carcinoma. cell squamous of diagnosis confirmed and infection revealed cytopathiceffect (HPV) Papillomavirus relatedtoHuman mediately. Histopathological examination of the surgical specimen developed attheageof14andwideexcisionwasperformedim been growingprogressively. Nodular skinlesionsonthescrotum papillomatous skin lesions occurred in the groin area and have persisted throughouthislife. At theageof8,itching,hyperplastic Ichthyosiform erythroderma appeared immediately after birth and patient withNethertonsyndromewasreferredtoourhospital. 18-year-oldted bysquamouscellcarcinoma.Casereport: An papillomatous skinlesionsassociatedwithitchandcomplica We presentapatientwithNethertonsyndromeandhyperplastic melanoma skincancers weredescribed inthe literature. Aim: with associatedhyperplasticpapillomatousskinlesionsornon- („bamboo hair“). Cases of patients with Netherton syndrome linearis circumflexa, atopic diathesis and trichorrhexis invaginata syndrome is characterized bycongenital ichthyosiform dermatitis, bitor (LEKTI) in the epidermis and stratified epithelia. Netherton of theencodedproteinlymphoepithelialKazal-type-relatedinhi mutations which result in absence or, rarely, decreased expression disease isserineproteaseinhibitorKazal-type5(SPINK5)gene disorder in the group of inherited ichthyoses. The case of the Introduction: Nethertonsyndromeisarareautosomalrecessive 1 Anna Waśkiel WITH NETHERTON SYNDROME BY SQUAMOUSCELL CARCINOMA IN A PATIENT PAPILLOMATOUS SKINLESIONSCOMPLICATED HYPERPLASTIC ITCH ASSOCIATEDWITH PP57 1052 satoshi cine, TheUniversityofTokyo 3Sapporo SkinClinic,Hokkaido,Japan versity of Tokyo, Department of gerontological nursing/wound care management, The Uni- Department ofDermatology, Medical University of Warsaw, 3 , Hiromi Sanada 9 th 1 WorldCongressofItch , LidiaRudnicka 1 , 2 Adriana Rakowska Department skincare science, Graduate schoolofMedi- 1 , Takeo Minematsu 1 1 1 , TomaszDemkow 2 , Mikako Yoshida 2 , Małgorzata 2 Department 1 , Abe Ma------

commercially available IL-31 antibodies. There was no signifi no was There antibodies. IL-31 available commercially expression was demonstrated byimmunohistochemistry using of patientsfreefromitchinginchronickidneydisease).IL-31 (21 skinbiopsiesfromadultpatientswithpruritusand20 The study was based on archived collection of biopsy material the expression of IL-31 in the skin of patients with uraemic itch. from uraemia. Therefore, thisresearchprojectaimstodetermine studies suggestelevatedserumIL-31levelsinpatientssuffering pruritus, especiallyinpatientswithatopicdermatitis.Preliminary the roleofinterleukin31(IL-31)inpathogenesischronic beenpaidto attentionhas not fullyexplained.Inrecentyears tients undergoing dialysistherapy. Itsetiopathogenesisremains Uraemic pruritusisabothersomesymptominabout40%ofpa ical University, Wroclaw, Poland Department ofDermatology, Venereoology and Allergology, Wroclaw Med- Marta Pelc EXPRESSION OF IL-31INURAEMICPRURITUS PP59 method forpruritus. NGFb inskinblottingwerepossibleindicatorsofassessment and frequency (AOR3.3,95%CI1.3–8.0).Conclusion:Albumin CI 0.1–0.8).Skinwithsweatglandwasassociatedbathing with scales was associated with bathing frequency(AOR0.3,95% 0.5, 95%CI0.3–0.9)andsex(AOR1.8,1.0–3.2).Skin Skin microscopy;skinwithhairwasassociatedage(AOR (β=0.145, was associatedwithcumulativelifetimesunexposureatwork Albumin was associated with age (β=–0.130, ( with scales, and skin with sweat gland were related with pruritus pH, albumin, nerve growth factor β (NGFβ), skin with hair, skin itching onthe left forearm diagnosed pruritus. SChydration, skin itching onwholebodywas69.1%,and50.3%ofthosemanifesting sults: The average participant age was 74 years. Prevalence of resonance tomography(MRT) suchasnervecompressionorda described. A highcorrelationbetweenchangesseenonmagnetic dermatomes oftheskin.Secondary generalizationofCIhasbeen burning andsharpsensationsusually affecting thecorresponding Neuropathic itchmeanslocalized chronicitch(CI)withstinging, Germany Department ofClinical Social Medicine, University Hospital Heidelberg, Matthias Fischer, ElkeWeisshaar ITCH - A PRELIMINARY STUDY EXERCISE TREATMENT FORNEUROPATHIC DIFFERENTIATEDRESISTANCEAND TRAINING PP60 role ofIL-31inuraemicpruritus. symptom, but there is a need for further studies to clarify the exact patients with uraemicprurituscomparedtothosefree from this conclusion it seems that IL-31 expression is more pronounced in according tovisualanalogscale(VAS) wasnoted (p=0.09).In the relationship of IL-31 expression and severity of itch assessed of patientsandhemodialysisdurationwasfound. A trendtowards No significant relationship between IL-31 expression and sex, age epidermis than limited to the suprabasal layers of the epidermis. (p=0.01)acrossthewhole common more significantly was sion of theepidermis.InpatientswithuraemicpruritusIL-31expres through thewholeepidermisandmainlyinsuprabasallayers groups. IL-31expressionshowedtwopatternsbeingexpressed was notedinthedistributionofIL-31expressionbothstudied (p difference significant However, pruritus. without and cant difference in overall IL-31 expression between patients with β=–0.137, and =0.135 (β frequency change clothing respectively). SC hydration and skin pH were associated with p =0.007,0.012,<0.001,0.049,<0.001and p , MariaKozioł,JacekC.Szepietowski =0.026) and bathing duration (β=–0.151, duration bathing and =0.026) p = 0.044). NGFβ p p =0.022). <0.05). =0.02) - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV patterns ofPsoriasis,andsite Psoriasis. and severityofPsoriasis,duration ofPsoriasis,morphological There was no significant association found between Pruritus score NoofPt204850302 BRSScore01234 According toBRS(max5)followingscorewereobserved: NoofPt52252213721 Score3456891011 19, followingpruritusscoreswererecorded: to Four-item itchquestionnaire(FIIQ)outofamaximumscore dryness. unsightly appearanceoflesionsandassociated According rity. 20 patients hadno pruritus at all and 130/150 (86.67%)patientswerehavingpruritusofvariableseve 49 patientswerehavingmoderatetoseverepsoriasis(PASI >10). years. 101 patients were having mild psoriasis (PASI ≤ 10) whereas 1- erythroderma. Age atpresentationrangedfrom2yearsto76 (3 exclusivelyscalpinvolvement),8-palmoplantar, 1–pustular, 91 patientswere having plaquetype,32-guttate, 14 sebo-psoriasis rating scale).Results: Total 150patients(91M,59F)wereenrolled. assessment scales (Four-item itch questionnaire and Behaviour of prurituswasdonebyusingpreformedquestionnaireanditch Psoriasis Area SeverityIndex(PASI) score. The globalassessment was performedtoknowtheextentandseverityofpsoriasisusing were includedinthestudy. A detailedhistoryandexamination diagnosed patientsofPsoriasisnotonanyantipsoriasistreatment from psoriasis . Materials and Methods: Objective: To assesstheburden of RNT MedicalCollege, Udaipur Asit Mittal A TERTIARY CAREHOSPITAL PSORIASIS ATTENDING DERMATOLOGY OPDOF A STUDY OF PRURITUSINPATIENTS WITH PP61 results ofthefirstpatients. progress ofatrainingprogramforneuropathicitchandreport strength andmobility. We presentthedesign,development and outcome measures are general well-being (SFSF-12),muscle quality, itch-related qualityoflife(ItchyQol)). The secondary (latissimus dorsi). The primary outcome measure is itch (severity, full extension ofthe spine (erector spinae) and arm adduction scapula elevationanddepression,aswellretraction, such as lateral flexion, flexion and extension of the cervical spine, the patientstogothroughaseriesofresistancetrainingexercises, as apreparationfortheactualstrengthtraining.Steptworequires and thoracicspineactivelywarminguptheshouldergirdle loosening upsofttissue(musclesandfascia)aroundthecervical itch. As afirststep,thetrainingdesignhaspatientspassively ment ofthespine(focusingonback)fortreatingneuropathic the effect ofdifferentiated resistancetrainingandexercisetreat with itchresearch,apreliminarystudywasstartedtoinvestigate focusing onthespine.Bycombiningnewresultsofsportsscience so-called differentiated resistancetrainingandexercisetreatment ments arelacking.Recently, strengthtrainingwasintroducedasa for neuropathicitcharelimitedandnon-pharmacologicaltreat pressure onnervesbyextensionofthespine.Effective therapies volved, reductionintheangleofaffected nervesandreducingthe muscles byeithershorteningorlengtheningofbeingin a casereport.Potentialexplanationsincludechangesofaffected another variantofneuropathicitch,byexerciseswasdescribedin e.g. herniateddisc.Improvementofnotalgiaparesthetica(NP), muscles is a main strategyoftreatingneuropathicpain caused by range of motion and strengthening of muscles as well as stretching demonstrated. Exercisinginvolvinganon-pharmacologicactive symptoms oflocalizedCIlikebrachioradialpruritus(BRP)was mage due to e.g. spinal pathology, degenerative changes and the , ManjuMeena 1415161718 pruritus inpatientssuffering All the consecutive newly their major concern was - - - - Münster, Germany mean reductioninsizetheinterventiongroupwasalsosigni reduced intheinterventiongroupafter4weeksoftreatment. The significantly was size mean the that revealed analyses patients (24males)wererecruitedbutonedefaulted.Preliminary pain anditchscoresonnumericalscales.Results:Twenty-eight objectivelydeterminedbya3-dimensionalscannerand(ii) 4 weeksand8weeks.Outcomemeasureswere(i)volumeofthe treatment after4weeks.Evaluationswereperformedatbaseline, no intervention.Fortheinterventiongroup,subjectsweretostop loaded, dissolvinghyaluronicacidmicroneedlesor(ii)controlwith (i) once-daily, triamcinolone- with injections self-administered 1cm apartwererecruited. Two keloidsweretreatedwitheither keloids onthetrunkorlimbswithadiameterof1-2cmandatleast clinicaltrial.Patientswithintra-individual controlled8-week and itch.MaterialsMethods: The studywasasingle-blind, determine the effects of a 1-month therapy on keloidal size, pain dissolving microneedlesasanoveltherapyforkeloids. We aimto tability ortolerability. We developedtriamcinolone-embedded therapies arelimitedbycost,inconvenienceandalackofaccep painful andprecludestreatmentinmanypatients.Otheravailable injectionswhich,duetothesensitivityofkeloids,is intra-lesional is option first-line The limited. are options peutic thera Current patients. of life of quality the impact significantly Background: Itchandpainarecommonsymptomsofkeloids National SkinCentre, Singapore Hong LiangTey, ColinWeixuan Tan PAINITCH AND KELOIDS: EFFECTSONLESIONAL VOLUME, NOVEL MICRONEEDLE TREATMENT FOR PP62 could beperformedinthepractice, whereitisalsopossibleto appropriate bloodtests,microbiological swabsandskinbiopsies with aspecializedcenter. Furthermore,abasic examination and for additionaldiagnosticsandserves asabasisforcooperation This simpleprocedureprovides a time-saving,standardizedbasis questionnaires, intensity scales orquestionnaires forquality oflife. viapruritus ofthepatientmedicalhistory establishment structured rable. Another areacanbeeasilyfollowedsuchasforexamplea off-label. A collaborationwithspecialists oritchcentersisdesi of the guideline as therapies require experience and are frequently Germany, itischallenging to followthetherapyrecommendations economic conditionsoftheprivatedermatologicalpracticein completed in 2016.Underthe current healthcare policies and whatwas GuidelineforChronicPruritus S2kGerman revised practice. The medicalcareofthesepatientscanbebasedonthe be considered a frequent symptom in the private dermatological Chronic pruritushasa 1 Hartmut Ständer LIMITATIONS PRACTICE INGERMANY –POSSIBILITIES AND PRURITUS IN THE PRIVATE DERMATOLOGICAL MEDICAL CAREOF PATIENTS WITH CHRONIC PP63 significant reduction in the size and pain and itch scores of keloids. with triamcinolone-embeddeddissolvingmicroneedlesresultedin There werenosideeffects registered. Conclusions:Treatment baseline. to compared weeks 8 and 4 at scores lower significant and itch, the intervention groupdemonstrated progressive and group increasedtonearthatatthebaseline. With respecttopain stopping treatmentfor4weeks),themeansizeinintervention (after weeks 8 group. At control the in that than greater ficantly Dermatology, Dermatology BadBentheim / Clinical Center Dortmund,Departmentof 2 University HospitalMünster, CenterforChronic Pruritus, 1 , SonjaStänder high pointprevalenceof36.2%andcan 2 Acta DermVenereol 2017 Poster abstracts 1053 - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta kowski row Transplantation, Wroclaw MedicalUniversity, Wrocław, Poland Wroclaw, Poland ment of Endocrinology and Diabetology, Wroclaw Medical University, pietowski with uremicpruritus. seems thatpolymorphismsofthe CNR1genearenotassociated rs806381s wasrevealedversus thecontrolgroup(p type andlowerincidenceinGG genotypeinthepolymorphism GA geno of incidence higher significantly a patients HD all of patients with UP and the control group. However, in the group diabetes anddyslipidemia. There werenodifferences between patients withandwithoutUP, evenafterexcludingpatientswith tionship wasfoundinanyoftheevaluatedgenotypesbetween rela significant statistically No technique. mini-sequencing controls using two multiplex polymerase chain reactions the were genotypedin159hemodialysispatientsand150healthy rs6454674, andrs2023239polymorphismsoftheCNR1gene The rs12720071, rs806368, rs1049353, rs806381, rs10485170, in theendocannabinoidreceptor1(CNR1)genecanaffect UP. and pruritus. We aimedtoevaluateweathergeneticvariations reliable evidence on the association between cannabinoid system plays aroleinmanypathologicalconditions.Moreover, thereis system endocannabinoid The treatment. specific no is there patients. Itsetiologyisstillnotfullyunderstoodandthatwhy Uremic pruritus (UP) is a common symptom in hemodialysis 1 Monika Heisig WITH UREMICPRURITUS POLYMORPHISMS HAVE NO ASSOCIATION ENDOCANNABINOID RECEPTOR 1GENE PP65 (ItchyQoL). QoLitch-specific questionnaire and EQ-5D (HADS), Scale sion aspects of AP wereassessedwithHospital Anxiety andDepres (VRS) anda4-itemItchQuestionnaire.Moreover, psychosocial evaluated withvisualanaloguescale(VAS), verbalratingscale 102 patientswithpolycythemiavera(PV).Pruritusintensitywas study analyzedanimpactof AP onpatientwell-beingamong on sufferers’ quality of life (QoL). influence significant has pruritus(AP) Aquagenic Background: 2 1 Edyta Lelonek, POLYCYTHEMIA VERA THE BURDENOF AQUAGENIC PRURITUSIN PP64 between caregivers. as teledermatologicaltechniqueswillfacilitatethecollaboration be implementedinindividualcases.Innovativeapproachessuch support ofaspecializedcenterand,intheprivatepractice,canonly the GermanGuideline.Nonetheless,furthermeasuresrequire commence basic stage 1 therapeutic measures in accordance with 1054 ( was influenced by AP extent (p=0.01) and duration of its episodes EQ-5D-VAS wasfound. The ItchyQolscoreof37.3±12.3points burden inPV patients negativelyinfluencingtheirQoL ( had higher HADS-anxietyscoringthanpatientswithoutpruritus more frequent in AP group (vs. non-AP). Moreover, AP sufferers patients was 23.8%and9.5%,respectively. The depressionwas individuals. The prevalence ofdepressionandanxietyamong AP intensity assessedas 4.8±1.9 points (VAS) was present in 42/102 Department ofDermatology, Venereology and Allergology, and Department and Clinic of Hematology, Blood Neoplasms andBone Mar Department andClinicofDermatology, Venereology and Allergology, and p p =0.02). =0.005). The negativecorrelationbetween AP durationand 2 , JacekC.Szepietowski 9 1 th Conclusions: Summarizing, AP meansanadditional WorldCongressofItch Results: 1 , Łukasz Matusiak Łukasz Łukasz Łaczmański Łukasz AP of mean duration 6.6±8.6 years and 1 1 , TomaszWróbel 2 Material and Methods: This , Adam Reich 1 2 , , Jacek C.Sze- Jacek Kwiat- =0.04). It 2 Depart- - - - - Clinical HospitalofDermatologyandVenerology, Russia doctor shouldthinkaboutthediagnosisofcutaneouslymphoma. itch thatdoesnotlenditselftotraditionaltherapy, foralongtime, at theclinicalandhistologicallevels.Ifpatienthasanintense that cutaneouslymphomascanmimicmanybenigndermatoses progressing course was diagnosed. This clinical case demonstrates lesions, withaffected axillarylymphnodes,characterizedbyslow In February2017,afungalmycosis T4N2MxB0 was performed,whichshowedalymphoproliferativedisease. diagnosis ofclinicalcutaneouslymphoma,alymphnodebiopsy pathological abnormalities.InNovember2016,theboardissueda again indicatedchronicdermatitis. A bonemarrowbiopsywithno made onthebasisofaclinicalpicture,butrepeatedskinbiopsy In March2016,adiagnosisofclinicalcutaneouslymphomawas examination of the skin showed a picture of chronic dermatitis. erythroderma accompaniedbyintenseitching. A histological fective. Bytheendof2015,rashestookformauniversal dermatitis, butthetraditionaltherapyforthesediseaseswasinef persisted, thepatientwasdiagnosedwithchroniceczema,atopic prescribed, theeffect wasnotgiven.Duringtheyear, theitching gic dermatitiswasestablished,treatmentwithantihistamines surfaces oftheelbowjoints,abdomen. The diagnosisofaller form of inflammatory papules on the skin of the thighs, the flexural July 2014,againstabackgroundofitching,rashesappearedinthe skin itching.Onexamination,theisclean. A yearlater, in and Venerology Clinic in January 2013with complaints ofintense Dermatology Regional Novosibirsk the to applied first 1937, in years withawiderangeofdifferential diagnosis A woman,born a clinicalcaseofpatientsuffering fromchronicitchingfor4 cases isstoppeduptoseveralmonthsandevenyears. We present accompanied byintenseitching,however, thediagnosisinmost , ,atopicdermatitis.Lymphomas oftheskinarealso usually is diagnosis first The found. often are pruritus specified In dermatologicalpractice,patientssuffering fromchronicun 1 Anastasiia Titenko UNSPECIFIED ITCHINGFOR4 YEARS MYCOSIS FUNGOIDES AS THE CAUSEOF PP66 tings. The chainofinfectionmusttobeinterruptedassoon treatments, follow-ups,quarantine periodandinformativemee the healthauthoritiesestablisha timescheduleforexaminations, strategy isessential: The dermatologist, management, staff and is mandatoryasrequiredbyGerman legislation. A sophisticated tion tolocalhealthauthoritiesof outbreaksofinfectionsdiseases notifica Immediate ointment. greasy a in permethrin 5% using 9 pminordertocoverallshifts. Topical therapywasperformed examined forscabies.Clinicswereorganized at6am,1pmand 18 elderlycarenurses,6contactpersonsund10residentswere dure, whichexplainsclinicalsignsonabdominalskin.Overall, by lifting.Intensiveskincontactisinevitableduringthisproce transferring themfrombedtoarmchairandback,twicedaily, Elderly peoplesuffering fromdementianeedaregularprocedure, the infection.Shehadbeentreatedforeczemaofsomemonths. of source the as identified was earlier, months 6 home nursing and biopsy. One seniorresident, whohad moved from another the abdomenandarms.Scabieswasdiagnosedbydermatoscopy home simultaneouslydevelopeditchingrashes,especiallyon Ten employeesand6residentswithdementiainanoldfolks 1 Michael Häberle OCCUPATIONAL ASPECTS OF SCABIES PP67 Bodensee, DermatologicalPracticeKünzelsau,Germany Pahomova Novosibirsk State National Research University, Dermatological Practice Künzelsau, 2 , IrinaSergeeva 1 , 1 Arno Rütten , Yulia Krinitsina 1 2 2 Dermatopathology Friedrichshafen/ 1 , Viktoria Onipchenko 2 Novosibirsk Regional with totalskin 2 , Vera ------Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Medical UniversityofWarsaw, Poland Disease, 4thMilitary Hospital, University, Wroclaw, Poland the natural microflora. Indeed, microflora. natural the of and otherregionsofthehuman bodyshowselectiveexpansion cation ofpruritus.Numerousreports suggestthatbothskinlesions damage, increased local and systemic inflammation and intensifi is proposedasoneofthefactors contributingtoepithelialbarrier remains unclear. Nevertheless,alteredmicrobiomecomposition Introduction: Pathogenesisofitchinatopicdermatitis(AD) 1 Leszek Blicharz ITCH PATHOGENESIS? DERMATITIS PATIENTS –IS THERE A LINK WITH MEMBRANES BY S. AUREUS IN ATOPIC COLONIZATION OF SKIN AND MUCOUS PP69 ficant connectionbetweenpruritusandHF. Based onourstudyandclinicalexperiencewedonotseeasigni factors areproventocontributethedevelopmentofpruritus. andhalfofthisgroupsuffered fromanemia.Boththese out of16patientsthatexperienceditchinghadincreasedlevel of theskin,mostlylowerandupperlimbs(50%).Noteworthy, 9 majority (71%)ofpatientsprurituswaslimitedtoacertainarea entire cardiacdisease,butnotatthepresenthospitalization.In stated that itching occurred at some point in the past during the scored at5.4on VAS and5.5 onNRS. The remaining4subjects occurring duringthelast3days–inthosesubjectsprurituswas 87 subjects).Fromthatgroup10outof14patientsreporteditch of itchingduringtheentirecardiacdiseasewas16%(14out prevalence matology LifeQualityIndex(DLQI).Results:The and cardiacdisease,therapyotherfactors,aswellDer constructed questionnaireregardingconnectionbetweenpruritus analogue scale(VAS), numeralratingscale(NRS),specially before hospitaldischarge. Pruritus wasassessedusingthevisual who received standard cardio-vasculartherapyandwere studied mean age:67±5years,leftventricularejectionfraction:36±5%) cruited 87 consecutive patients withacuteHF (65 (74.7%) men, underlying causes.MaterialandMethods: We prospectivelyre characteristics ofpatientsreportingpruritusandexplorepotential of CardiologyduetoacuteHF. We alsoaimedtoprovideclinical the prevalenceofpruritusinpatientsadmittedtoDepartment reaching 40%.Objectives:Ourstudywasset-uptoinvestigate prevalence ofitchingatsomepoint3-monthfollow-upperiod among patientswithstable,chronicheartfailure(HF)the 2015;172:1541-6.) pruritus was postulated to also be common ders. As previouslyreported(NiklassonOetal,BrJDermatol as chronickidneydisease,hepatobiliaryorhematologicaldisor often complicating non-dermatological systemic diseases such Background: Pruritusisacommonanddistressingsymptom, 1 Malgorzata Ponikowska FAILURE PRURITUS INPATIENTS WITH ACUTE HEART PP68 legislation. Scabiesislistedasanoccupationaldisease(BK3101). compensations for infected staff members as required by German are helpful for cooperation. Statutory accident insurance provides at 60°C,protectiveclothingisprovidedforthestaff. Handouts be treated simultaneously. Contaminatedtextilesmust be washed possible. Staff interrupted,andallaffected rotationis personsmust C. Szepietowski cal University. Wroclaw, Department of Dermatology, and Dermatology,of Department Venerology and Allergology.Wrocław Medi- S. aureus andsimultaneousreductionofother componentsof 1 1 , ZbigniewSamochocki 2 1 Departmentof Cardiology, Centre for Heart 1 , Jan Biegus 2 Department ofHeartDiseases,Medical 2 Department of Clinical Microbiology, S. aureus strainscanbeasource 2 , 1 Robert Zymlinski , PaulinaUsarek 2 2 , Jacek - - - - - the intensityofsymptoms.Rhowasremarkablyhighforex also calculatedtoassesstheimpactofcolonyconcentrationon higher valuesoftheseparameters.Spearmancorrelationratiowas sleep lossandpruritus).PatientscolonizedbyS.aureus showed scale related with itch (excoriation and subjective evaluation of microbiological testsandselectedparametersoftheSCORAD group). We aimedtoestablishtheassociation betweenresultsof for lesionalskinand58%non-lesional(vs6%incontrol group was64%foranteriornares(vs11% incontrolgroup),79% Overall percentageofculturespositiveforS.aureusinthestudy healthy individuals.Resultswereanalyzedstatistically. Results: of 0-3 points). Control group consisted of 33 sex- and age-matched assessed concentration ofS.aureus colonies in the cultures (a scale of mass spectrometry. Additionally, a professional microbiologist help the with identified were colonies distinct Morphologically nares. Bacterial cultures on Chapman mediawerethenperformed. were taken from lesional and non-lesional skin and from anterior disease severity assessment based onSCORADscale). Swabs interview and clinical examination (confirmation of AD diagnosis, with AD wereenrolledinthetrial.Everysubjectpresentedforan A totalof33patients(19males/14females,meanage=31years) between itch. and inflammation of local and systemic factors that potentially exacerbate skin pruritus. Furthermore, colonization intensity is positively cor S. aureus colonizationof AD patientsisassociatedwithincreased correlation withcolonyconcentrationofS.aureus. coriation. In case of subjective parameters rho reflected moderate AD and7.4±5.2points,8.1±4.8 pointsand7.1±4.8inPs, aires were10.5±5.5points,8.3±4.2 pointsand7.9±4.8in points. The scoresforparticularsleepabnormalitiesquestionn QoL as: assessed was 12.8±7.5 andPs: 16.4±7.9points AD: and Ps:6.4±2.8points1.2±3.0 points,respectively. The mean last days was estimated as: AD: 7.1±2.7 points and 5.3±2.9 points 16%, respectively. The mean itchandpainseveritywithinthree patients andPs: itch – 95% vs. patients andpain– 18% vs. group: AD: itch – 100% vs. 100% patients; pain – 43% vs. 38% last days subjective symptoms were experienced by the following Scale (ESS).Results:Duringthecourseofdiseaseandwithinthree Pittsburgh Sleep Quality Index (PSQI) and Epworth Sleepiness abnormalities wereestimatedwith Athens InsomniaScale(AIS), (VAS). The quality of life was assessed by DLQI. Moreover, sleep Itch andpain intensity were evaluatedwithvisualanaloguescale matitis) andPASI (Psoriasis Area SeverityIndex),respectively. 13.5±8.4 pointsaccording toSCORAD(Scoring Atopic Der The meandiseaseseveritywasassessedas33.6±10.7pointsand females, 61males)Pspatientswithmeanage44.1±15.8years. males) AD patients with mean age of39.2±15.4 years and 100(39 and Methods: The studygroup consistedof100(42females,58 quality oflifeatopicdermatitisandpsoriasispatients.Material study was undertaken to evaluate the influence of itch and pain on a important,activeprocessofliveshuman.Objectives:This AD andPshavegreatimpactonpatients’ qualityoflife.Sleepis are accompaniedbysubjectivesymptoms,suchasitchandpain. mon chronic, inflammatory and recurrent skin diseases. They both Background: Atopic dermatitis(AD)andpsoriasis(Ps)arecom cal University, Wroclaw, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Karolina Kaaz,ŁukaszMatusiak,JacekC.Szepietowski PATIENTS LIFE OF ATOPIC DERMATITIS AND PSORIASIS ITCH AND PAIN INFLUENCEONQUALITY OF PP70 are neededtoimproveitchcontrolinatopiceczema. research suggests that newtherapeutic and prophylactic measures related with SCORADscale parameters expressing itch. Our S. aureus colonizationanditchseverityin AD. Methods: Aim ofthestudy: To assesstherelation Acta DermVenereol 2017 Poster abstracts Conclusions: 1055 - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta ta Krecisz of itch and superficial type of BCC, extrafacial location and males. pain. Itseemsthereisrelationship betweenpresenceandintensity but only29%female).61%patients withSCCreporteditchand/or in lesionwasreported37%ptients withBCC(45%malepatients and 86men). In90.3%the histological diagnosis was BCC.Itching were included175patientsoperated becauseofNMSC(89women University betweenJune2016andMay2017.Fortheanalysis of Dermatology, Venereology and Allergology, Wroclaw Medical skin cancer(NMSC)in Ward ofPlasticSurgery inDepartment ment. The mterialarepatientstreatedbecauseofnon-melanoma of cancer, ageofpatients,locationlesionandprevioustreat of thisstudyexamcorrelationbetweenintensityitchandtype important symptominpatientswithBCCandSCC. The authors many studiesexaminingprevalence,intensity, type,durationthis years were defined as non-itching disorders. However there are not presence has been proven in many diseases which during many Itch isoneofthemostimportantsymptomsindermatology. Its cal University, Wroclaw, Poland Department ofDermatology, Venereology and Allergology, Wroclaw Medi- Iwona Chlebicka,JacekC.Szepietowski ITCH INNON-MELANOMA SKINCANCERS. PP72 mg sertralineoncedailywithrapidandsignificantimprovement. to sideeffect, rifampinwas stoped. The patientthenreceived50 After 4weeksoftherapy, patientdeveloped hepatotoxicity. Due with rifampin150mgoncedailyameliorationoftheitch. Department. Diagnosis of PBCwas conifrmed. We start therapy prurigo. Patientwasexaminedandreffered doInfectiousDiseases enzymes, IgM and AMA cholestatic antibodies. and Skin biopsy liver confirmed nodular elevation significant found we procedures veloped over thepast2years. After widespectrum of diagnostic with pruriticpapulesandnodulesonherlegs,armstrunkde case series. We reportthecaseofa42-year-old womanpresent line agentinPBC. Antipruritic effect hasbeendemonstratedina of patientstreatedforcholestaticliverdisease.Serotoninisfourth therapy inthePBC.Rifampicincancausehepatitisabout7% with chroniccholestaticliverdisease.Itisusedasasecondlineof gest thatrifampicin isaneffective treatment forpruritusin patients affects thequalityoflifepatient There isevidencetosug significantly and treatments, multiple to refractory and severe be most difficult symptoms to treat in the course of PBC. Often, it can is causedbyavarietyofpathomechanismsPruritusonethe defined clinical symptoms and histopathological findings. Disorder nodularis is characterized byextremely pruritic nodules with well- cholestatic liverdiseasewithaslowlyprogressivecoursePrurigo Primary biliarycholangitis(PBC)isanimmune-mediatedchronic 1 Piotr Parcheta SERTRALINE SUCCESSFULLY TREATEDRIFAMPIN WITH AND OF PRIMARY BILIARY CHOLANGITIS NODULAR PRURIGO AS FIRST MANIFESTATION PP71 quality ofdermatologicalpatientsmay improve theirqualityof life. affect thequalityofsleep AD andPspatients.Improvingsleep p<0.001), (r=0.5, (r=0.45, pain AD and itch of severity with significantly correlated QoL decreased and (r=0.24,p (r=0.44, AIS the by obtained scores with correlated significantly itch of with regard to AIS, PSQI and ESS, respectively. The severity 1056 Kielce Voivodeship Hospital,Kielce,Poland Department ofDermatology, and 9 p<0.001) and(r=0.34,<0.001),ESS(r=0.35, th 1 WorldCongressofItch 1 =0.014), for AD andPsrespectively. Moreover, , Piotr Stepien p<0.001), respectively. p<0.001), (r=0.36,=0.026)andPs(r=0.32, 2 , Dorota Zarebska-Michaluk 2 Department ofInfectious Diseases, Conclusions: Itch can 2 , Bea- - - - gel needed tofurtherassesstheseconcepts. embarrassment andworryinoldergirls. A larger scaledstudyis to theseconceptsmaybehelpful,payingparticularattention from chronicpruritusinchildren.Emotionalsupporttailored elicited aspects emotional the on insight us give findings These crazy and embarrassment were not tested in the younger group. concepts tested were specific to each age group; frustration, driven embarrassment and worrythan boys.It should be noted that certain younger group. In the (pre)adolescent group, girls expressed more experienced frustration. There werenogenderdifferences inthe of allsubjectsvoicedangerandthemajority(pre)adolescents percentage of(pre)adolescentsexpressedthosefeelings. A third group wassaddenedandscaredduetotheirchronicitch;alower worried (p=0.03)thanboys.Conclusion: A thirdoftheyounger 8–17 agegroup,girlsweremoreembarrassed(p=0.02)and the For group. age 6–7 the difference in significant no was there and 39%wereembarrassedbytheiritchyskin.Betweengenders, in theoldergroup,65%werefrustrated,50%drivencrazy 23% weresad,33%angryand12%scared.Ofnote 15% were scared due to their itchy skin. For the older children, For the 6–7 year-olds, 34 % expressed sadness, 30% were mad and and 38 girlsand164 (8–17-year-olds) with102 girls and 62 boys. age groups.Results: There were67(6–7year-olds) with29boys used toassessthepossibledifference betweengendersinthetwo ctive emotionalconcepts.Chi-squareandFisher’s exacttestwere impact wereanalyzed.Proportionsusedtodeterminedistin validating. Forthis analysis, onlytheitems related to emotional years) andolderchild(8–17versionthatwearecurrently QoL impactfromchronicpruritus. There isayoungerchild(6–7 including pediatricversionsoftheItchyQoL,aself-report or longer)were recruited andadministered apanel ofsurveys ren between the ages of 6–17 who experience chronic itch (6 weeks emotional impact from chronic pruritus than boys.Methods: Child girls vs.boys. We hypothesizedthatgirlswoulddemonstratehigher is publishedliteratureregardinggreateremotiveexpressivityof psychosocial effects ofchronicitchonchildren.Moreover, there impact on the qualityoflife(QoL)butlittle is known about the Background: 1 Sandy François EFFECT OF CHRONICITCHONCHILDREN GENDER DISPARITY IN THE PSYCHOSOCIAL PP73 reducing prurituse.g.,inpatients withRIorCPR,therehasnot Though, clinical experience suggests NB-UVB to be effective in BB-UVB in phototherapy units and private dermatological offices. dermatitis, andvitiligo,NB-UVB hasalmostcompletelyreplaced (NB)-UVB overBB-UVBinthe treatmentofpsoriasis,atopic narrowband of efficacy superior to due however, years, recent In (RI). insufficiency renal with patients in CP reduce to shown Phototherapy withbroadband(BB)-UVBhaspreviouslybeen and, todate,therearenolicensedtreatmentsforCP orCPR. difficult is CP of Treatment nodules. and papules pruriginous an “itch-scratchcycle”mayleadtochronicprurigo(CPR)with tients’ qualityoflife.Repeatedscratchinganddevelopment of pa the reduces significantly weeks) 6 (> (CP) pruritus Chronic 1 Franz J.Legat ITCH INCHRONICPRURITUSPATIENTS UVB ARE EQUALLY EFFECTIVEINREDUCING BOTH NARROWBAND-UVB AND BROADBAND- PP74 Ho Chen tistics andDocumentation,MedicalUniversityGraz, Austria Emory University, Department ofDermatology, and 1 , FranzQuehenberger 1 , JamesRoberts Dermatologic conditions can have a significant a have can conditions Dermatologic 1 1 , , 2 Grace Lee Georgia InstituteofTechnology, USA Angelika Hofer 2 2 , SuephyChen , KlaraWaltner 1 , Shelby Smith 2 Institute forMedical Informatics, Sta- 1 , Alexandra Gruber-Wackerna- 1 1 1 , PeterWolf , Alix Pijeaux 1 1 , Kuang- - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV needs andtreatment expectations. and ItchyQol are correlating with each other influencing patient’s psoriasis vulgarisare highly burdened by pruritus.Itch intensity Conclusion: ItchyQolassessmentdemonstrated thatpatientswith Index). Benefit Patient of (part Questionnaire Need Patient the duration ofPV and health-related patientneedsasmeasuredby 5.81 ItchyQol-pointsworseQoL thanmales), VAS average24h, ItchyQol forparameterasfollows:femalegender(estimateof by measured QoL as of dependency significant showed analysis worst, VAS average,andDLQI. The multiplelinearregression 18.5). ItchyQolshowedmoderatetostrongcorrelationswith VAS 83); DLQIrangedfrom3.0to30(mean:17.8,SD7.9;median: ranged from33to110 withameanof78.7(SD17.4;median: 8.1 (median); VAS ItchyQol score 7.2 (median). was h 24 average psoriasis arthritis.PASI was20.9(median), VAS worst24 hwas Patients suffered since18.5years(median)fromPV; 13.8%had 46 (34.5%)females;agerange24–75years,median:49years. demographic data.Results:130patientswithPV wereincluded: the ItchyQolquestionnaire,itchintensity VAS, comorbiditiesand assessment ofPSORITUSbaselinedataincludingtheresults trial (PSORITUS). The present correlation analysis comprised to treatment with Secukinumab within a randomized controlled with moderatetoseverePV andintenseprurituswereassigned itch-specific QoL instrument, ItchyQol, in PV. intensity inpsoriasis.Sofarnodataareavailableonuseofan DLQI isdiscussedtoshowcorrelationsofQoL withthepruritus The DLQIisastandardinstrumentcommonlyusedinpsoriasis. ris (PV)andhasimpactonthequalityoflife(QoL)patients. Background: Pruritusisafrequentcomplaintinpsoriasisvulga pital Münster, Germany Center for Chronic Pruritus, Department of Dermatology, University Hos- Sonja Ständer, RANDOMIZED CONTROLLED TRIAL (PSORITUS) OF PATIENT BASELINEDATA FROM A CORRELATIONVULGARIS: ANALYSIS ITCHYQOL ASSESSMENT INPSORIASIS PP75 administered inCP patientswithgreatoverallefficacy. nowadays. Thus, likeinotherconditions NB-UVBcanalsobe that is hardly reached byany other treatment option available strong antipruriticactivityatagrade(itchreductionby70–80%) in CP patientsandbothphototherapeuticmodalitiesshowedvery proofed tobeequallyeffective asBB-UVBinreducingpruritus ability toreduce pruritus( Test) indicatedthatNB-UVBwasnotinferiortoBB-UVBinthe the relativetreatmenteffect, asymptotic Wilcoxon-Mann-Whitney 80.7%). Testing fornon-inferiority(equalityrangeupto20%of NB-UVB from6.75(1.1–10)to1.20(0–8.7)(medianreduction from 6.05(2.2–10)to2.10(0–7.5)(medianreduction67.2%),and lesions, and 3had noskin lesions. BB-UVB reduced pruritus VAS tion. Ofthese38patients,35hadeitherCPRorsecondaryscratch evalua final for eligible were and 20) NB-UVB: 18; (BB-UVB: range 20–85years)receivedatleast4weeksofUV-treatment imaginable itch).38patientswithCP (23F, 15M;medianage65y, analogue scale(VAS) rangingfrom0(=noitch)to10(=worst the endoftreatment,patientsevaluatedtheirpruritususingavisual UV-dose increments20%perweek).Before,weeklyduring,andat looking BB-UVBorNB-UVBcabins(startingdose50%MED, were whole-body UV-treated 3x per week for 6 weeks in equally erythema dose(MED)withtherespectivelightsource,patients ned to BB-UVBorNB-UVB. After testing forindividual minimal patients with CP. 49 patients consented and were randomly assig the effects ofBB-UVBversusNB-UVBinreducingpruritus been astudycomparingitwithBB-UVB. Thus, weinvestigated Thomas A. Luger Thomas A. Karin Loser, DieterMetze, p=0.0037). Inconclusion, NB-UVB Jürgen Zimmermann, Methods: Patients - - - to themselvesaswellboys. aggregated over items. It appears that girls can relate the instrument a genderdifference intheItchyQOL propertiesofinterestwhen depicted bycartoonsofyoungboys,theredoesnotappeartobe majority oftheitemsinItchyQoL andtheItchyQuantwere the group, analogousresultswerefound.Conclusion:Although girls (0.56and0.49,p<0.01forboth).Inthe4–5-year-old age and boys between similarly and ItchyQoLsignificantly the with 49% abovethemedianscore). The ItchyQuantscores correlated vs (51% test median the did nor differences, significant reveal different accordingtoan ANOVA. The RankSumtestdidnot for boys and girls was 5.59 and 5.37, which was not significantly and 0.84, respectively) in the 6–7-year-old group. The overall mean not differ substantially betweenboys,girls,andoverall(0.81,0.86, completed theinstruments. The ItchyQoL’s Cronbach’s alphadid (32 boysand38girls)334–5-year-old (13boysand20girls) significant. statistically considered was gender usingSpearmanrankordercorrelations. A p-value<0.05 between ItchyQuantandItchyQoL scoreswereexploredforeach above theoverallmedianscore(i.e.,atest).Correlation a testof the mean number of scores per gender group which were ANOVA for comparison of means, a Wilcoxon Rank Sum test, and ces incentraltendencybetweengenderswereevaluatedusingan then separatelybygenderwithinthatsameagecohort.Differen Cronbach’s alphaacrossallchildreninagivenagecohortand CP. InternalconsistencyfortheItchyQoL wascalculatedusing administered to6–7-year-old and to4–5-year-old childrenwith Method: etc.) oftheItchyQOL. in theinternalconsistencyandcentraltendencies(mean,median, ments. Inthisstudy, wesoughttodiscernanygenderdifferences ItchyQoL, leadingtoworrythatgirlsmaynotrelatetheinstru A cartoonofayoungboydominatesboththeItchyQuantand life (QoL)impactofchronicpruritus(CP, itchlasting>6weeks). derstand the concepts behind self-rated itch severity and quality of cartoon-annotated inanattempttoassistyoungchildrenun The ItchyQuantandthepediatricversionsofItchyQoL are 1 Suephy Chen OUTCOMES ANNOTATION INSELF REPORTED PRURITUS IMPERVIOUSNESS TO GENDERCARTOON PP76 different sensations of the skin and mucous membrane without or patients (averageage41.94years old)appliedwithcomplainson anxiety symptoms(DaviesS.J. etal.,2016).In2016-201717 drome maybeassociatedwith higher scoresfordepressiveand sensory disorder(GuptaM.A.et al.,2013).Burningmouthsyn innervation ismoresusceptible for thedevelopmentofcutaneous Vellappally S.,2016). Skinwithagreaterdensityofepidermal and gabapentinarementionedinliterature(Liu YF. etal.,2017, therapeutic approachesclonazepam,psychotherapy, capsaicin with dysgeusia,paresthesia,dysesthesia,xerostomia,amongthe salgia andglossopyrosisorBurningmouthsyndromeisassociated skin andmucousmembranebecomesmoreoften.Glos Recently theapplicationofpatientswithcomplainsonitch is ratherwideandcauseproblemsindiagnosticstreatment. The varietyofskinsensationsassociatedwithmentaldisorders tology, Russia Moscow research andpracticalcenterofdermatovenereology andcosme- Bobko Andrey Lvov, DmitryRomanov, PHENOMENON? MUCOUS MEMBRANE:ISIT A PSYCHOSOMATIC «PSEUDOALLERGIC» REACTIONSONSKIN AND PP77 Emory University, 1 , JamesRoberts 2 Georgia InstituteofTechnology, USA 2 The ItchyQuantandItchyQoL were Anastasia Tereshenko, Svetlana Results: 706–7-year-old Acta DermVenereol 2017 Poster abstracts 1057 - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Yvergnaux with Fucogel modified the pH of the medium. of SP releaseontwocellulartypesandin co-culturewithout lactic acid, 0.1% of polysaccharide induced a significant decrease whereas prior pHneutralization did not. At these concentrations of keratinocytes, 0.1%lacticacidinducedacytosoliccalciumentry pH wasneutralized,lacticaciddoidnotprovokeSP release. On acid withouttoxicityforPC12cellsandkeratinocytes. When lactic acid. The release of SP was significant from 0.1% of lactic and PC12 cells. We showed a release of SP for all conditions with determined toreleaseSP withoutcytotoxicityonkeratinocytes 0.5%, 0.4%,0.3%,0.2%,0.1%,0.07%,0.04%,0%)hasbeen both. Firstly, idealconcentration ofacidlactic(10%,5%,1%, medium beforeapplicationoflacticacidorpolysaccharide days andkeratinocytesweremaintainedonedayinproliferation a 96-wellsplate.PC12cellsweredifferentiated usingNGFfor3 our polysaccharide presentinFucogel cells. Inordertopredictacalmingeffect, weusedabacterial substance P (SP)releaseusinghumankeratinocytesandPC12 a cultureandco-culturemodelbasedonacidlactictest in vivotestingandtomodelizeeffect on theskin,wedeveloped To predict the probable soothing sensation of a product before deposited ononesideandpotentialsoothingtheotherside. face ofvolunteers. After beginastingingsensation,placebois foldrightandleftoftheat 10or5percent%placedonnasolabial thing sensation.Inpractice,stingingtestismadeusinglacticacid skin andtestsmolecules,actives,formulaoringredientsonsoo Stinging test is an in vivo classic protocol that evaluates sensitive 1 Mehdi Sakka POLYSACCHARIDE WITH IN VIVO RESULTS USING A BACTERIAL TEST IN VITRO: A COMPARATIVE EVALUATION A NEW TOOL FORMODELLINGSTINGING PP78 such casesandshowsitsefficacy. psychotropic drugs(antipsychoticsandothers)isnecessaryin reactions» informofurticum,papuleswasnoticed. The useof manifestation ofrashasavariantpsychogenic«pseudoallergic the sign of different psychodermatological interventions. The tightness, stingingandothers)werewidelypresented other sensations(burning,tingling,tickling,pricking,prickling, the baseofatopicdermatitis.Psychiatricequivalentsitchand at itch amplified – patients 2 and itch somatoform – patients 2 the diagnosis8patientshadglossalgia,5urticaria, logist andpsychiatristindetailexaminedthepatients. Among and otherspecialistdirectedtoourcenter. Dermatovenereo with rashonskin. The patientswereconsultedbyallergologists 1058 Nicolas Lebonvallet Olivier Gouin Brest, Laboratory of Neurosciences of Brest, University of Western Brittany, in vitro model.KeratinocytesandPC12cellswereplacedon 2 BioEurope –Groupe Solabia, Anet, France 9 th 2 WorldCongressofItch , Thibaut Saguet 1 ® , 1 applicationwasfollowedbyadecrease30%of , Raphael Leschiera Killian L’herondelle 1 2 , Jean-Luc Carré In vivo,stingingtestassociated 1 ® , invivostingingtestand 1 Christelle Le Gall-Ianotto , Jean-Luc Philbé 1 , Laurent Misery 2 , Florent 1 1 - - , , matology, UniversityofMiamiSchoolMedicine, Miami, Florida,USA; vitro stingingtestbasedonSP release. soothing activityrevealedbyinvivostingingtestandournew show evidencethattheonsetofantipruriticeffects withserlopi tolerated in a phase 2clinical trial (NCT01951274). Here, we daily for6weekscomparedwithplaceboandwassafewell once given when pruritus chronic in improvement significant NK animal experimentation.Furthermore,Fucogel is adaptedforcosmeticingredientsscreeningbecausethereno 21 to 69 years old. Our prikling intensityversusplaceboon19womenvolunteersfrom Sonja Ständer CONTROLLED PHASE2CLINICAL TRIAL RANDOMIZED, MULTICENTER, PLACEBO- POST HOC ANALYSIS RESULTS FROM A WITH SERLOPITANT FORCHRONICPRURITUS: EARLY ONSET OF ANTIPRURITIC EFFECTS PP79 were sustainedtoweek6withthe1mgand5doses. The improvementsintheexperienceofprurituswithserlopitant mg doseandday3withthe5comparedplacebo. vement inchronicpruritusbeginningasearlyday2withthe 1 (NK neuropeptide substanceP anditsreceptor, neurokinin 1receptor te relief ofitch is an initial treatment goal for chronic pruritus. The are associatedwithundesirablesafety/tolerabilityissues.Immedia efficacy,limited have therapies pruritus chronic some Many and of underlying conditions, can significantly impact quality of life. Introduction: Chronicpruritus,aprevalentsymptomofvariety 3 1 Conclusions: Serlopitant provided statistically significant impro 5 mg(–42.5;p=0.013)atweek6comparedwithplacebo(–28.3). (–41.4; mg 1 serlopitant with greater significantly week 6;thepercentagechangefrombaseline VAS itchscorewas placebo. The antipruriticeffects ofserlopitantweresustainedto 1 mgbeginningonday2and53thanwith baseline VAS itch score was significantly greater with serlopitant baseline characteristicswerecomparable. The meanchangefrom 0.25 mg(n=64),1or5=65),placebo=64); Two hundred fifty-seven patients were randomized to serlopitant the serlopitantandplacebogroupstestedusingat-test.Results: zed, withthedifference inaverage changefrombaselinebetween 6 weeks.Changefrombaselineonstudydays1to14wasanaly loading dose of3tablets at baseline, patients took 1tablet daily for to receiveserlopitant0.25mg,15orplacebo. After a (VAS)Scale Analog 1:1:1:1 randomized were Patients ≥7. score Visualitch baseline and weeks ≥6 lasting pruritus -refractory or Methods: Keyeligibilitycriteriaweretreatment-unresponsive tant beginsinthefirstfewdaysofinitiatingtreatment.Material/ USA; pital Münster, Münster, Germany; Pacific Northwest Statistical Consulting, Inc., Woodinville, Washington, Woodinville, Inc., Consulting, Statistical Northwest Pacific Center forChronic Pruritus,DepartmentofDermatology, UniversityHos- 1 -R antagonistserlopitantwasshowntoprovidestatistically 1 -R), playaroleinthepathogenesisofchronicpruritus. The 4 Menlo TherapeuticsInc.,Park,California,USA 1 , GilYosipovitch in vitro model isethically interesting and 2 Miami Itch Center, DepartmentofDer 2 , JoeHirman 3 , PaulKwon ® has an interesting hasaninteresting p=0.022) and 4 - - - - - Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV Chen, Suephy1017,1031,1043, Chen, Sisi1020 Chen, Kuang-Ho1017,1031,1044, Chen, Chih-Cheng1044 Chauveau, Aurélie 1022 Chasset, François1022 Chasset, Adam 1050 Chalem, Ylana 1024,1031 Chadoutaud, Bernard1039 Carstens, MirelaIodi1009,1025, Carstens, Earl1009,1025,1035, Carré, Jean-Luc1058 Calo’, Girolamo1035 Calloch, RonanLe1022 C Buscaglia, Paul1029 Burke, Melanie1009,1033 Burke, Laurie1038 Buhé, Virginie 1029 Buchwald, Theresa 1032 Brun, Cecilia1019 Bruland, Philipp1025 Brombacher, Frank1020 Brock, Emily1013 Brestoff, JonathanR.1020 Brennan, Frank1012 Brenaut, Emilie1011, 1016 Braun, Frederik1038 Brasington, Richard1020 Bożek, Agnieszka 1018 Bouvier, Amelie 1037 Bødker, MarkBrendstrup1049 Bobko, Svetlana1057 Blome, Christine1038 Blicharz, Leszek1055 Biernacka, Anna 1040 Bieniek-Kobuszewska, Martyna Biegus, Jan1055 Białynicki-Birula, Rafał1042 Bernhard, Jeffrey D.1051 Berdeaux, Gilles1024,1031 Berardesca, Enzo1011 Benke, Dietmar1025 Beigi, Minaya1048 Bautista, Diana1013 Barton, Greg1013 Bartels, Danielle1020 Barnetsche, Thomas 1016 Babes, Alexandru 1036 B Azimi, Ehsan1029,1037 Austen, K.Frank1037 Augustin, Matthias1038 Auges, Marie1024,1031 Ase, Ariel 1010 Asahina, Akihiko 1041,1042,1043 Arendt-Nielsen, Lars1013,1038, Ardeleanu, Marius1018,1045 Aquiar, Rita1051 Apfelbacher, Christian1023 Antiga, Emiliano1022,1050 Andria, Michael1045 Andoh, Tsugunobu 1019,1035 Andersen, HjalteHolm1013,1038, Amagai, Yosuke 1020 Altrichter, Sabine1031 Alonso, Estrella1051 Akiyama, Tasuku 1009,1015,1025, Aizawa, Norie1041,1042,1043 Agelopoulos, Konstantin1028,1037 Afshari, Khashayar1045,1046 Adamski, Zygmunt1022,1050 Acuña, Mario A. 1025 Abbé, Adeline 1045 A 1044, 1056,1057 1056 1035, 1036 1036 1043 1040, 1049 1040, 1049 1030 Graham, Stewart1050 Gouin, Olivier1029,1058 Gleń, Jolanta1046 Giesler, Glenn1026 Gieler, Uwe1012,1017, 1024,1045 Gereau, Robert W. 1020 Gazerani, Parisa1049 Garrec, RaphaeleLe1012,1029 Gao, Xiaofei1020 Gall-Ianotto, ChristelleLe1012, Gal-Ianotto, ChristelleLe1011 Gajda, Patrycja1047 Gajda, Mariusz1038 Gadkari, Abhijit 1018,1045 G Furukawa, Fukumi1022,1050 Furue, Masutaka1012,1018 Funahashi, Hideki1036 Fukuda, Ryoko 1030 Fujii, Masanori1009,1035 François, Sandy1017,1031,1044, Forster, Clemens1032,1048 Foroutan, Arash 1037,1045,1046 Forner, Caroline-Donata1051 Follansbee, Taylor 1009,1035 Fluhr, Joachim1011 Fischer, MichaelJ.1047 Fischer, Matthias1052 Fischer, Caroline1035 Feng, Jing1020 Favrot, Claude1025 F Eydieux, Charlène1039 Evers, Andrea 1011, 1012,1017, Endo, Shogo1019 Elmariah, Sarina1029,1037 Ellrich, André 1031 Elberling, Jesper1013,1038,1040 Ehrchen, Jan1051 Eckert, Laurent1018,1045 Ebata, Toshiya 1030,1033,1041, E Düll, Margareta Miriam1047 Dugas, Martin1025,1037 Dücker, Lauravon1049 Duarte, Fátima1051 Dörfler, Arnd1032 Dong, Xinzhong1034 Donders, Rogier1020 Domocos, Dan1036 Doh, EunJin1041 Demkow, Tomasz 1052 Dehpour, Ahmad-Reza 1037,1045, Deguine, Jacques1013 Davoodi, A. 1009,1025 Davidson, Steve1020 Dangelmaier, Julia1028 Daneshpazhooh, Maryam1045 Dańczak-Pazdrowska, Aleksandra D Czuwara, Joanna1047 Czerwińska, Joanna1043 Cuervo, Jesus1024,1031 Council, M.Laurin1020 Costa, Ana Célia1051 Conrad, Heike1037 Clark, Marci1018 Christensen, JanneDjernis1049 Choi, Yong Won 1036 Chlebicka, Iwona1056 Chiu, IsaacM.1037 Chisolm, Sarah1044 Chiba, Shigetoshi1048 Chen, Zhou-Feng1020 Chen, Y.H. 1021 1019, 1022,1029,1058 1056 1020, 1024 1043 1046 1022, 1050 Koga, Tetsuya 1018 Klein, Amanda H1010 Kiupel, Stephanie1017,1045 Kini, Seema1044 Kimura, Utako1008 Kim, SeongJin1041 Kim, HyeOne1036,1041 Kim, HeiSung1041 Kim-Dufor, Deok-Hee1043 Kim, Do Won 1041 Kim, Byung-Soo1041 Kim, BrianS.1020 Kido-Nakahara, Makiko1018 Kidane, Tizita Yosef 1039 Khasabov, Sergey 1026 Kerkhof, Petervande1020 Kerby, MatthewB.1015 Katayama, Ichiro1013,1033,1039 Karaev, Elkham1039 Kanaoka, Yoshihide 1037 Kamata, Yayoi 1014 Kaaz, Karolina1023,1026,1055 K Jung, Bo Young 1036 Jo, Yong Se1036 Jastrząb, Beata1041 Janiszewska, Katarzyna1018 Jang, Yong Hyun1041 Jang, MinSoo1041 Jafferany, Mohammad1008 Jabłońska, Małgorzata1047 J Itoh, Takumi 1008 Islam, Aminul 1022,1050 Ishiuji, Yozo 1041,1042,1043 Ishida, Yasushi 1036 Inokuchi, Sanae1041,1042,1043 Inglot, Małgorzata1040 Inami, Yoshihiro 1035 Ikoma, Akihiko 1030,1033 Ikedam, Takaharu 1050 Idzior, Marta1041 Ianotto, Jean-Christophe1022 I Hu, Hongzhen1020 Hsieh, Chyi-Song1020 Houwer, JanDe1024 Honda, Kotaro1011 Holz, Kristian1014 Hołysz, Marcin1038 Hofer, Angelika 1028,1056 Hirman, Joe1058 Hill, Rose1013 Hijne, Kim1020 Higaki, Yuko 1043 Heisig, Monika1054 Haydek, Caitlin1017 Hayakawa, Yuko 1043 Hawro, Tomasz 1031 Häussler, Annett 1035 Hatano, Ryo 1008 Hashizume, Hideo1022,1050 Hasegawa, Minoru1022,1050 Haruta-Tsukamoto, Ayaka 1036 Hartke, Timothy1010 V Hanifin, Jon1015 Handwerker, HermannO.1048 Hamilton1, SamanthaL.1020 Hamasaki, Tetsuyoshi 1020 Haeberle, Michael1048 Haddadi, Nazgol-Sadat1037,1045, Häberle, Michael1054 H Guttman-Yasky, Emma1015 Guo, ChangxiongJ.1020 Gschwendtner, Andreas 1048 Gruber-Wackernagel, Alexandra Gronert, Karsten1013 Grochulska, Katarzyna1031 1046 1028, 1056 McGregory, M.1021 McEnery-Stonelake, Melissa1051 McDonald, Ian1010,1025 Maurer, Marcus1014,1031 Matusiak, Łukasz1023,1026,1054, Matsumoto, Akira 1013,1033 Matsuda, Kenshiro1019 Matsuda, Hiroshi1019,1020 Matsuda, Hironori1030,1049 Mashino, Toshihiko 1018 Masatoshi, Abe 1052 Mano, Yosuke 1035 Malek, Marta1046 Małek, Małgorzata1049 Maki, Takahito 1019 Mack, MadisonR.1020 M Lvov, Andrey 1057 Lüßmann, Kjell1024 Luo, Tuanlian 1029 Luo, Jialie1020 Luk, Kevin1044 Luger, Thomas A. 1014,1015,1057 Lotts, Tobias 1028,1037 Loser, Karin1014,1028,1057 Lőrinc Szabó,Imre1010,1025 Lloyd, Donna1009,1033 Liu, Qin1020 Li, Shikai1019 Lipshetz, Brett1026 Lippert, Eric1022 Li, Kap-sok1041 L’Herondelle, Killian1012 L’herondelle, Killian1029,1058 Lewis, Richard1012 Leslie, Tabi 1021 Lesiak, Aleksandra 1050 Leschiera, Raphael1058 Lerner, Ethan1029 Lelonek, Edyta1023,1054 Legat, FranzJ.1028,1056 Lefeuvre, Luc1029 Lee, Yang Won 1041 Lee, Grace1017,1031,1044,1056 Lee, DongHun1041 LeClercq, Didier1030,1033 Lebonvallet, Nicolas1019,1029, Lavery, M.J.1021 Lausten, MiaBirkholm1049 Laskowska, Marta1041 Larrick, James W. 1015 Lange, Magdalena1046 Łaczmański, Łukasz1054 Laarhoven, Antoinette van1012, L Kwon, Paul1014,1058 Kwiatkowski, Jacek1023,1054 Kwatra, Shawn1016 Kwatra, Madan1016 Kusumi, Tomomi 1048 Kusube, Fumiya1011 Kushner, Carolyn1022, 1050 Kuroki, Rie1018 Kurihara, Yuichi 1018 Kuraishi, Yasushi 1019,1035 Kupfer, Joerg 1012,1017,1021, Kupczyk, Piotr1038 Kupas, Verena 1014 Kumakawa, Kenjirou1048 Kucirek, NatalieKelava1013 Krischak, Madison1016 Krinitsina, Yulia 1054 Kremer, Andreas 1032,1047 Krecisz, Beata1056 Kozioł, Maria1052 Kottlors, Sophia1045 Kosaka, Ryohei 1030,1049 Kopparaju, RaviChandra1044 Komiya-Suyama, Eriko1008 1055 1058 1020, 1024,1040 1024, 1045 Acta DermVenereol 2017 Index 1059 Advances in dermatology and venereology ActaDV Acta Dermato-Venereologica ActaDV www.medicaljournals.se/acta Owczarczyk-Saczonek, Agnieszka Owczarczyk-Saczonek, Agnieszka Otsuka, Haruna1008 Ostadhadi, Sattar1037,1045,1046 Osada, Nani1038 Orri, Massimiliano1024,1031 Onipchenko, Viktoria 1054 Olszewska, Małgorzata1052 Olszewska, Berenika1046 Okuda, Yosuke 1039 Ohya, Susumu1035 Ohtsu, Hiroshi1035 Ohnuma, Kei1008 Ofenloch, Robert1009,1031 Oetjen, LandonK.1020 Odongo, Leo1042 Oddos, Thierry 1019 Ochi, Saori1033 O Nowicki, Roman1046 Nowak, Maciej1040 Nowacki, Maciej1047 Nowacka, Katarzyna1046,1047 Nørgaard, Anders Lindby1049 Nordon, Clementine1024,1031 Nomura, Yoshihiro 1020 Niżyński, Dawid1040 Niu, Haixia1020 Nishiyama, Chiharu1049 Nishimori, Toshikazu 1036 Neumann, Elena1025 Neubauer, Katarzyna1041 Nelson, Pauline1023 Nelson, Lauren1018 Nattkemper, Leigh1021 Nashan, Dorothée1049 Nanni, Cory1016 Namer, Barbara1047 Nakayama-Naono, Rumi1036 Nakahara, Takeshi 1018 Nakagawa, Hidemi1041,1042, Naito, Hisashi1011 Nagamine, M.1009,1025 N Murrell, Dedee1015 Murota, Hiroyuki1013,1033,1039 Murata, Kazuyoshi1049 Mowla, MohammadRafiqul1022, Morimoto, Chikao1008 Montgomery, Kerry1024 Momose, Akishi 1043,1048 Mohammed, Taqee Ansari 1026 Mochizuki, H.1021 Mizukami, Hiroki1048 Miyahara, Yu 1036 Mittal, Asit 1053 Mitra, Debdeep1016 Mitra, Barnali1016 Misery, Laurent1011, 1012,1016, Minematsu, Takeo 1052 Miller, MarkJ.1020 Mignen, Olivier1012,1029 Middleton, Lefkos1030 Middendorp, Henriëtvan1024 Metz, Martin1031 Metze, Dieter1057 Mettang, Thomas 1009,1012,1021, Menne, Kirstin1038 Mengeaud, Valerie 1024,1031 Mendes, Ana 1051 Meeuwis, Stefanie1024 Meena, Manju1053 1060 1043 1043 1050 1043, 1050,1058 1019, 1022,1024,1029,1031, 1031 9 th WorldCongressofItch Sanada, Hiromi1052 Samotij, Dominik1022,1050 Samochocki, Zbigniew1055 Sakka, Mehdi1058 Sakamoto, Tatsuya 1049 Sakamoto, Hirotaka1049 Sakai, Kent1015,1030 Sakaguchi, Azumi 1014 Saguet, Thibaut 1058 Saeki, Hidehisa1012 S Ruzza, Chiara1035 Rütten, Arno 1054 Rusteikaitè, Justina1049 Rülander, Falk1028 Rukwied, Roman1019 Rudolph, Uwe1025 Rudnicka, Lidia1052 Romanov, Dmitry1057 Roberts, James1017,1031,1056, Roberts, Callie1016 Rizzi, Anna 1035 Riviere, Julie1039 Ringler, Ralf1048 Ringkamp, Matthias1010 Ries, Vivien 1047 Riepe, Claudia1025 Riccio, Daniele1049 Reszke, Radomir1042 Reidel, Ulrich1031 Reich, Adam 1011, 1018,1022, Reeh, Peter W. 1047 Reddy, Vemuri 1029 Reaney, Matthew1018,1045 Rank, Miriam1048 Ramsey, R.V. 1021 Ralvenius, William T.1025 Rakowska, Adriana 1047,1052 Ragin, Dominika1046,1047 Radko, Agata 1040 Radin, Allen 1018 R Quehenberger, Franz1056 Quave, Cassandra1044 Q Przybylowicz, Katarzyna1031 Poulaliou, Adèle 1043 Ponikowska, Malgorzata1055 Poncet, Michel1030 Polańska, Adriana 1022,1050 Pogatzki-Zahn, Esther1028 Plewig, Natalie1009 Placek, Waldemar 1043 Pijeaux, Alix 1031,1044,1056 Pietra, Claudio1035 Philippe, Réginald1012 Philbé, Jean-Luc1058 Petrini, Laura1049 Perlman, Andrew J.1015 Pereira, ManuelPedro1027,1028 Pereira-Barbosa, Manuel1051 Pelc, Marta1052 Peerdeman, Kaya1020 Pedro, Elisa1051 Paul, Julia1050 Park, KyungDuck1041 Park, Gyeong-Hun1041 Park, Chun Wook 1036 Park, ChangOok1041 Parcheta, Piotr1056 Pahomova, Vera 1054 Pagani, Martina1025,1029 P 1057 1038, 1040,1041,1050,1054 Tominaga, Mitsutoshi1008,1011, Titenko, Anastasiia 1054 Thompson, Andrew 1024 Theunis, Jennifer1024,1031 Théréné, Chloé1016 Tey, HongLiang1012,1032,1053 Tereshenko, Anastasia 1057 Terao, Mika1013,1033 Tegeder, Irmgard 1035 Taniguchi, Nao1030 Tang, Jean Y. 1015 Tan, Colin Weixuan 1053 Tanaka, Akane 1019,1020 Talagas, Matthieu1012 Takemura, Kimitoshi1030,1033 Takase, Yoshimasa 1030 Takanami, Keiko1049 Takamori, Kenji1008,1011, 1014, Takahashi, Nobuaki1011, 1021, Tahara, Mayuko1039 T Szöllősi, Attila 1010,1025 Szepietowski, JacekC.1008,1011, Szczęch, Justyna1022,1023,1050 Sun, Yan Gang1029 Suga, Yasushi 1008,1011, 1014, Stull, C.1021 Stroo, Michiel1020 Storck, Michael1025 Stepien, Piotr1056 Stengel, Martina1047 Steinke, Sabine1025,1027,1038 Steinhoff, Martin1010,1015,1025 Ständer, Sonja1011, 1012,1014, Ständer, Hartmut1049,1053 Spínola, Amélia 1051 Spindler, Max1031 Spałkowska, Magdalena1040 Soto, Inaki1025 Son, JeeHee1036 Sølvsten, Henrik1013 Solanki, Reema1016 Sokołowska-Wojdyło, Małgorzata Smith, Shelby1017,1031,1044, Simpson, Eric1045 Simone, Donald1026 Silva, Alfredo Ribeiroda1010 Sikora, Mariusz1047 Shiraiwa, Yasauo 1048 Sharif, Behrang1010 Shakiba, Saeed1045,1046 Sergeeva, Irina1054 Semenov, Yevgeniy 1016 Selescu, Tudor 1036 Séguéla, Philippe1010 Schwendinger-Schreck, Jamie1013 Schut, Christina1017,1024,1045 Schnipper, EdwardF. 1015 Schmelz, Martin1008 Schaffer, András 1020 Sayag, Michèle1039 Satoh, Keita1049 Sato, Atsushi 1035 Sari, Dianis Wulan 1052 Sanders, Kristen1015,1030 1014, 1021,1030,1042,1049 1021, 1030,1042,1049 1030, 1042,1049 1054, 1055,1056 1027, 1038,1042,1050,1052, 1012, 1018,1022,1023,1026, 1030 1057, 1058 1037, 1038,1049,1051,1053, 1015, 1025,1027,1028,1034, 1046 1056 Zymlinski, Robert1055 Zschiebsch, Katja1035 Zimmermann, Jürgen 1057 Zick, Christoph1024 Zhang, Xiaoming1015 Zeilhofer, HannsUlrich1025 Zeidler, Claudia1025,1038,1051 Zegarski, Wojciech 1047 Zegarska, Barbara1046,1047 Zdanowska, Natalia1043 Żawrocki, Anton 1046 Zarebska-Michaluk, Dorota1056 Z Yvergnaux, Florent1058 Young, Michellie1009,1033 Yosipovitch, Gil1012,1013,1015, Yoshida, Mikako1052 Yasukochi, Yumi 1018 Yasui, Yuma 1035 Yang, Lihua1020 Yanai, Shuichi1019 Yanaba, Koichi1041,1042,1043 Yamazaki, Hiroto1008 Yamauchi-Takihara, Keiko1039 Yamakura, Fumiyuki1011 Yamada, Taketo 1008 Yabe, Michihiro1048 Y Xu, Amy Z.1020 X Wurm, Lina1047 Wu, Gang1010 Wróbel, Tomasz 1023,1054 Wooten, Matthew1010 Wolf, Peter1028 Wojas-Pelc, Anna 1040 Wildner, Hendrik1025 Whelan, Timothy M.1020 Werynowska, Małgorzata1040 Werth, Victoria 1022,1050 Weller, Karsten1031 Weisshaar, Elke1009,1011, 1012, Wei, Jessica1013 Watschinger, Katrin1035 Wassmann, Henk1038 Waśkiel, Anna 1052 Wang, PeterL.1020 Waltner, Klara1028,1056 Walsh, Carolyn1013 Wallengren, Joanna1011, 1027 Voisin, Tiphaine 1037 Virassamynaik, Sandrine1039 Vierow, Verena 1048 Vetter, Marcel1032 Veldhuijzen, Judy1024 Vecchio, SilviaLo1038 Vasudevan, Biju1016 Valdes-Rodriguez, R.1021 Vaglio, Joelle1030 V Uta, Daisuke1019 Usarek, Paulina1055 Umezawa, Yoshinori 1041,1042 Umehara, Yoshie 1014 U Tsuruta, Daisuke1050 Truong, Hai1026 Tripathi, Shivani V. 1020 Trier, Anna M.1020 Tran, Stefan1014 Tomooka, Yasuhiro 1011, 1049 1018, 1021,1030,1045,1058 1021, 1031,1048,1052