Mouse anti-Human MXD1 monoclonal antibody, clone 3H20 (CABT-B10722) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Immunogen MXD1 (NP_002348.1, 60 a.a. ~ 149 a.a) partial recombinant with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG1

Source/Host Mouse

Species Reactivity Human

Clone 3H20

Conjugate Unconjugated

Applications IHC, ELISA

Sequence Similarities THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQR EQRHLKRQLE KLGIERIRMDSIGST

Format Liquid

Buffer In 1x PBS, pH 7.2

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

BACKGROUND

Introduction This encodes a member of the /MAX/MAD network of basic helix-loop-helix transcription factors. The MYC/MAX/MAD transcription factors mediate cellular proliferation, differentiation and apoptosis. The encoded protein antagonizes MYC-mediated transcriptional activation of target by competing for the binding partner MAX and recruiting repressor complexes containing histone deacetylases. Mutations in this gene may play a role in acute leukemia, and the encoded protein is a potential tumor suppressor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Keywords MXD1; MAX dimerization protein 1; MAD; MAD1; BHLHC58; dimerization protein 1; max dimerizer 1; MAX-binding protein; antagonizer of myc transcriptional activity;

GENE INFORMATION

Entrez Gene ID 4084

UniProt ID Q05195

Pathway Regulation of Telomerase, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem;

Function DNA binding; sequence-specific DNA binding activity; transcription cofactor activity; transcription corepressor activity;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved