CHESTNUT FILLY Barn 21 Hip No. 1803

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Consigned by Brandywine Farm LLC (Jim & Pam Robinson), Agent Hip No. for Liberation Farm (Rob Whiteley) Barn 1803 CHESTNUT FILLY 21 Foaled April 17, 2007 Vice Regent Deputy Minister ................ Mint Copy Dehere .............................. Secretariat Sister Dot.......................... Sword Game CHESTNUT FILLY Exclusive Native Affirmed............................ Won't Tell You Spring Valley .................... (1992) Hoist the Flag Honor an Offer .................. Bridget o' Brick By DEHERE (1991). Champion 2-year-old colt, stakes winner of $723,712, Champagne S. [G1], etc. Among the leading sires, sire of 11 crops of rac- ing age, 1083 foals, 810 starters, 60 stakes winners, 537 winners of 1595 races and earning $58,334,503, including champion Mi Amigo Guelo ($164,450, Clasico Santiago Iglesias Pantin, etc.), and of Belle Du Jour (hwt. in Australia and Ireland, $1,899,064, Golden Slipper S. [G1], etc.), Take Charge Lady ($2,480,377, Ashland S. [G1] (KEE, $345,805), etc.). 1st dam Spring Valley, by Affirmed. 2 wins at 2, $48,425, 2nd Tiffany Lass S. (FG, $8,- 520). Dam of 7 other registered foals, 7 of racing age, including a 2-year- old of 2008, 6 to race, 5 winners, including-- Fusaichi Antaeus (c. by Cozzene). Winner at 2 and 3, ¥16,900,000, in Ja- pan. (Total: $162,719). Spicy Girl (f. by Tabasco Cat). 3 wins at 3 and 4, $111,100. Strong Boss (c. by Capote). 37 wins, ¥9,360,000, in Japan. (Total: $82,153). Spring Jabar (f. by Aljabr). 6 wins at 3 and 4, $54,076. 2nd dam HONOR AN OFFER, by Hoist the Flag. Unraced. Sister to O'Connell Street, half- sister to TEA SIPPER, WAYWARD ACE, RAISE THE BRIDGE. Dam of-- IMPERIAL GESTURE (f. by Langfuhr). 4 wins at 2 and 3, $1,149,140, in N.A./U.S., Beldame S. [G1] (BEL, $450,000), Gazelle H. [G1] (BEL, $150,000), 2nd Breeders’ Cup Juvenile Fillies [G1], Oak Leaf S. [G1], etc.; 2 wins in 2 starts, 991,918 dirhams, in United Arab Emirates, hwt. at 3 on United Arab Emirates Hand., 7 - 9 1/2 fur. (Total: $1,419,140). SARDULA (f. by Storm Cat). 6 wins in 10 starts to 3, $882,460, Kentucky Oaks [G1], Hollywood Starlet S. [G1], Del Mar Debutante S. [G2], etc. TEMPEST DANCER (f. by Storm Cat). 4 wins in 6 starts to 4, $115,250, Ellis Park Budweiser Breeders' Cup H. [L] (ELP, $63,450). Dam of-- WINDRUSH (c. by Seeking the Gold). 5 wins, $219,532, Stymie H. [G3]. Coming and Going (f. by Roberto). Winner at 2 in England; placed at 2 in Italy, 2nd Criterium Femminile-G3. Producer. Spring Valley (f. by Affirmed). Stakes-placed winner, above. Acyl (c. by Dahar). 5 wins to 4 in Italy, 2nd Premio Trofeo Cino del Duca. Czar's Princess. Winner at 3, $17,239. Dam of SUMMER PRINCE (g. by Summer Squall, $176,770, Tempe H. (TUP, $15,000), etc.). Granddam of DIVINE PARK (c. by Chester House, 6 wins in 8 starts to 4, 2008, $607,935, Metropolitan H. [G1] (BEL, $360,000), etc.), T J'S LUCKY MOON (g. by Tejabo, $671,505, Queen’s Plate-R (WO, $600,000 (CAN))), ALL HAIL STORMY (g. by Stormy Atlantic, 8 wins, $293,469). Engagements: Breeders' Cup. Foaled in Kentucky. (KTDF). KEE 9/08.
Recommended publications
  • We Cover the Risk So You Can Focus on the Reward

    We Cover the Risk So You Can Focus on the Reward

    CRT - Mixed Sale February 2019 1 WE COVER THE RISK SO YOU CAN FOCUS ON THE REWARD. You’ve worked hard for your assets. Protect them against misfortune. KUDA COVERS YOUR RACEHORSE: Mortality Cover, Lifesaving Surgery and Critical Care Cover, Medical Care Cover, and Public Liability Cover. KUDA COVERS EVERYTHING ELSE: We cover all your valued assets: Personal and Commercial Insurance, Sport Horse Insurance, and Game and Wildlife Insurance. If you trust us with covering your valued thoroughbred, you can trust us to cover all your assets. CALL US TODAY FOR COVER FROM THE LUXURY LIFESTYLE INSURANCE SPECIALISTS. WÉHANN SMITH +27 82 337 4555 JO CAMPHER +27 82 334 4940 ninety9cents 42088T ninety9cents Kuda Holdings - Authorised Financial Services Provider, FSP number: 38382. All policies are on a Co-Insurance basis between Infiniti Insurance and various syndicates of Lloyds. Kuda Holdings approved Lloyds coverholder PIN 112897CJS. 2 CRT - Mixed Sale February 2019 42088T Kuda Turf Directory Print Ad Luxury lifestyle insurance 210 x 148 FA2.indd 1 2018/12/19 2:48 PM CRT - Mixed Sale February 2019 3 VENDOR INDEX Lot Colour Sex Breeding On Account of Cheveley Stud. (As Agent) 43 Chestnut Mare Oxbow Lake by Fort Wood (USA) 45 Chestnut Mare Tippuana by Fort Wood (USA) 51 Chestnut Mare Silent Treatment by Jet Master 56 Chestnut Mare Rachel Leigh by Fort Wood (USA) 70 Bay Mare Miss K by Kahal (GB) 72 Chestnut Mare Giant's Slipper (AUS) by Giant's Causeway (USA) 76 Grey Mare Ado Annie by Trippi (USA) 84 Bay Mare Lavender Bells by Al Mufti (USA) On Account of Harold Crawford Racing.
  • LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu)

    LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu)

    LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu) Northern Dancer Nearctic Storm Bird Natalma South Ocean New Providence Storm Cat Shining Sun Secretariat Bold Ruler Terlingua Somethingroyal Crimson Saint Crimson Satan LUCIFER SAM[USA] Bolero Rose (b - 2005) Raise a Native Native Dancer Mr. Prospector Raise You Gold Digger Nashua Rafina Sequence Halo Hail to Reason Coup de Folie Cosmah Raise the Standard Hoist the Flag Natalma Lucifer Sam[USA] won 1 race at 2 (1400 m.), $ 47,179 and placed incl. 2nd in Tattersalls Millions Acomb Stakes, Gr.3, etc. Retired to stud in 2009. Sire from 3 crops of 43 named foals, 39 starters, 18 winners, 2 black- type performers, 35 wins, Rs. 1,53,39,544 viz. Lucy Diamond (2 wins, Rs. 16,64,635 and placed incl. 2nd in Smt Teegala Sulochana Reddy Memorial Byerly Turk Million, Gr.3, VIF Stud Godolphin Barb Million, Gr.3, 3rd in Deccan Bookmakers Fillies' Championship Stakes, Gr.3, etc), Lucia (1 win, Rs. 12,58,963 and placed incl. 3rd in Bangalore 1000 Guineas, Gr.2), ANCILLARY (4 wins, Rs. 15,31,000), SPINNING CHAKRAM (4 wins, Rs. 11,07,407), VIGOROUS (3 wins, Rs. 13,19,830), JAMAICAN (3 wins, Rs. 11,93,200), GRAND APPLAUSE (3 wins, Rs. 8,26,625), JACKIE OH (3 wins, Rs. 7,97,305), SMOKEY SID (2 wins, Rs. 7,61,905), PLATINUM PEARL, DOFANTASY, IMPRESSION, LUC DIVINE, DIVINE RULER, BATTLE EMPRESS, ALL IN, SAM HOUSTON and CHRISTMAS CAKE. His fourth crop is in training. This is his fifth crop.
  • To Consignors Hip Color & No

    To Consignors Hip Color & No

    Index to Consignors Hip Color & No. Sex Name,Year Foaled Sire Dam Barn 36 Property of Adena Springs Broodmares 735 dk. b./br. m. Salvadoria, 2005 Macho Uno Skipping Around 813 b. m. Witch Tradition, 1999 Holy Bull Hall's Lake Fire 833 dk. b./br. m. Beautiful Sky, 2003 Forestry Forty Carats 837 dk. b./br. m. Big City Danse, 2002 Joyeux Danseur Big City Bound 865 b. m. City Bird, 2004 Carson City Eishin Houlton 886 dk. b./br. m. Devine Will, 2002 Saint Ballado In the Will 889 dk. b./br. m. Distinguished Lady, 2004 Smart Strike Distinguish Forum 894 b. m. Dreamers Glory, 1999 Holy Bull Regal Victress 917 ch. m. Feisty Woman, 2003 El Prado (IRE) Joustabout 919 ch. m. First At the Wire, 2004 Awesome Again Zip to the Wire 925 b. m. Galica, 2001 Dixieland Brass Air Flair 927 ch. m. Getback Time, 2003 Gilded Time Shay 1029 gr/ro. m. Out of Pride, 1999 Out of Place I'm Proud 1062 ch. m. Ring True, 2003 Is It True Notjustanotherbird Barn 35 Property of Ann Marie Farm Broodmares 970 dk. b./br. m. Lake Merced, 2001 Salt Lake Little Miss Molly 1019 b. m. My Lollipop, 2005 Lemon Drop Kid Runaway Cherokee Barn 33 Consigned by Baccari Bloodstock LLC, Agent I Broodmare 831 dk. b./br. m. Bear and Grin It, 2002 Golden Missile Notable Sword Yearlings 775 ch. c. unnamed, 2009 Speightstown Surf Light 832 dk. b./br. c. unnamed, 2009 With Distinction Bear and Grin It 846 b. f. unnamed, 2009 Songandaprayer Broken Flower 892 ch.
  • EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams

    EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams

    EUROPEAN PEDIGREE for WHOLE GRAIN (GB) - Three Dams Danzig (USA) Northern Dancer Sire: (Bay 1977) Pas de Nom (USA) POLISH PRECEDENT (USA) (Bay 1986) Past Example (USA) Buckpasser WHOLE GRAIN (GB) (Chesnut 1976) Bold Example (USA) (Bay mare 2001) Mill Reef (USA) Never Bend Dam: (Bay 1968) Milan Mill MILL LINE (Bay 1985) Quay Line High Line (Bay 1976) Dark Finale WHOLE GRAIN (GB) (2001 mare by POLISH PRECEDENT (USA)); in GB/IRE, unplaced at 2 years, placed once, £434 at 3 years, unplaced at 4 years, unplaced at 5 years; in France, placed twice, £2,872 at 4 years; dam of 6 known foals; 1 known runner; 1 known winner. Tioman Two (GB) (2007 gelding by RED RANSOM (USA)), unraced in GB/IRE. LOUIS THE PIOUS (GB) (2008 gelding by HOLY ROMAN EMPEROR (IRE)); in GB/IRE, placed once, £265 at 2 years, won 4 races and placed 4 times, £29,057 at 3 years, placed 4 times, £29,946 at 4 years, won 1 race and placed once, £44,455 at 5 years, placed once, £9,625 at 6 years. (2009 mare by TEOFILO (IRE)). Oatmeal (GB) (2011 filly by DALAKHANI (IRE)), unraced in GB/IRE, exported to France. Swaheen (GB) (2012 colt by LAWMAN (FR)), unraced in GB/IRE. (2013 colt by SIR PERCY (GB)). No Return in 2010. 1st dam. MILL LINE (1985 mare by MILL REEF (USA)); in GB/IRE, won 1 race and placed 3 times, £3,473 at 3 years, WON Royal British Legion Stakes, Doncaster, 1988, SECOND Links Stakes, Redcar, 1988, exported to USA; dam of 13 known foals; 11 known runners; 9 known winners.
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • MARINO MARINI Gr/Ro, 2000

    MARINO MARINI Gr/Ro, 2000

    MARINO MARINI gr/ro, 2000 height 16.1 Dosage (8-5-9-0-0); DI: 3.89; CD: 0.95 RACE AND (STAKES) RECORD See gray pages—Nearctic Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, SW, $580,647 2 in Eng, Ire 6 2(1) 1(1) 1(1) $117,993 Storm Bird, 1978 636 f, 147 SW, 5.10 AEI Natalma, by Native Dancer 3 in NA, Ire 5 1 1(1) 2(2) $89,366 6s, SW, $169,181 South Ocean, 1967 New Providence, by Bull Page 4 5 0 2(2) 1(1) $87,025 682 f, 64 SW, 2.27 AEI Storm Cat, dkb/br, 1983 22s, SW, $70,147 Totals 16 3(1) 4(4) 4(4) $294,384 8s, SW, $570,610 12 f, 9 r, 9 w, 4 SW Shining Sun, by Chop Chop Won At 2 in Ireland 1,414 f, 181 SW, 2.95 AEI Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD Sara Lee Marble Hill S ($55,272, 5f in 1:04.80, by 21s, SW, $1,316,808 Terlingua, 1976 653 f, 57 SW, 2.95 AEI Somethingroyal, by Princequillo 2½, dftg. Luminata, Petite Histoire, Flamingo Bay). 17s, SW, $423,896 A maiden weight for age race at Cor ($17,836, 6f). 11 f, 9 r, 6 w, 2 SW Crimson Saint, 1969 Crimson Satan, by Spy Song 2nd Independent Waterford Wedgwood Phoenix S (Ire-I, 11s, SW, $91,770 6f, to Spartacus, dftg. Polar Force, Daganya, Ontario, 11 f, 8 r, 7 w, 4 SW Bolero Rose, by Bolero Cassis, Luminata, Petite Histoire, Hold That Tiger).
  • Index to Consignors Hip Color & No

    Index to Consignors Hip Color & No

    Index to Consignors Hip Color & No. Sex Name, Year Foaled Sire Dam Barn 12 Consigned by Anderson Farms, Agent Broodmare prospect 684 b. m. Elegant Effort, 2002 Alydeed Every Effort Barn 2 Property of Ashleigh Stud Yearling 329 dk. b./br. c. unnamed, 2006 Fusaichi Pegasus Dixie Talking Barn 8 Property of F. Gill Aulick (Cedar Point Farm) Yearling 97 gr/ro. c. unnamed, 2006 Whywhywhy Onesta Barn 8 Consigned by F. Gill Aulick (Cedar Point Farm), Agent Yearlings 174 dk. b./br. f. unnamed, 2006 Johannesburg Spankin 'n Fannin 257 b. c. unnamed, 2006 Chapel Royal Anna's Angel 349 gr/ro. c. unnamed, 2006 Hennessy Formal Process Barn 8 Consigned by F. Gill Aulick (Cedar Point Farm), Agent for J. Phillip Mote Yearling 163 dk. b./br. f. unnamed, 2006 Stormy Atlantic Silvery Pet Barn 7 Consigned by Belvedere Farm, Inc. (Marty Takacs), Agent IV Yearling 1 b. c. unnamed, 2006 Zavata Halo My Baby Barn 7 Consigned by Belvedere Farm, Inc. (Marty Takacs), Agent V Yearling 326 dk. b./br. c. unnamed, 2006 Orientate Desireux Barn 10 Property of Blake Agency Yearlings 130 ch. c. unnamed, 2006 Whywhywhy Residential 144 dk. b./br. f. unnamed, 2006 Officer Sarah's Approval Barn 12 Consigned by Blandford Stud (Padraig Campion), Agent Broodmare 576 b. m. Vacacionada (ARG), 1995 Southern Halo Valery Toss Yearling 672 ch. c. unnamed, 2006 Lion Heart Danube Barn 24 Consigned by Bluegrass Thor. Services, Inc. (J. Stuart), Agent I Broodmare 656 ch. m. Cherie Baby, 1994 Ogygian My Cherie Amour Yearling 657 dk. b./br.
  • Top Beyer Speed Figures • 1993-2018

    Top Beyer Speed Figures • 1993-2018

    TOP BEYER SPEED FIGURES • 1993-2018 2-year-olds, 1993 2-year-olds, 1996 Beyer Beyer No. Horse Track Dist Date No. Horse Track Dist Date 106 VALIANT NATURE HOL 8.5 12/19/1993 108 THISNEARLYWASMINE SA 6 10/23/1996 105 BROCCO HOL 8.5 12/19/1993 107 KELLY KIP SAR 6 07/26/1996 105 POLAR EXPEDITION AP 6 08/14/1993 106 IN EXCESSIVE BULL SA 6 10/23/1996 103 HOLY BULL BEL 7 09/18/1993 104 HOLZMEISTER HAW 8.5 11/17/1996 102 DEHERE BEL 7 09/18/1993 104 KELLY KIP BEL 5 06/21/1996 101 HOLY BULL MTH 5.5 08/14/1993 103 IN C C’S HONOR LRL 6 12/21/1996 100 FLYING SENSATION HOL 8.5 12/19/1993 102 DIXIE FLAG (F) AQU 6 11/24/1996 100 SARDULA (F) DMR 7 09/04/1993 101 CAPTAIN BODGIT LRL 9 11/02/1996 99 BLUMIN AFFAIR HOL 8.5 12/19/1993 101 GOLD CASE FG 6 12/30/1996 99 INDIVIDUAL STYLE HOL 7 11/26/1993 101 IN EXCESSIVE BULL HOL 7 11/10/1996 99 YOU AND I AQU 7 10/20/1993 101 IN EXCESSIVE BULL SA 6 10/05/1996 Champion 2-year-old male Dehere had one of the highest Beyer Speed 101 MUD ROUTE HOL 6.5 12/15/1996 Figures of the season, but Valiant Nature earned the highest when beating 101 ORDWAY BEL 8.5 10/05/1996 Breeders’ Cup Juvenile winner Brocco in the Hollywood Futurity.
  • HEADLINE NEWS Eclipse Champion REAL QUIET

    HEADLINE NEWS Eclipse Champion REAL QUIET

    STORM FLAG FLYING Porter’s Pedigree HEADLINE Perspectives p. 2 NEWS For information about TDN, DELIVERED EACH NIGHT call 732-747-8060. BY FAX AND INTERNET www.thoroughbreddailynews.com WEDNESDAY, SEPT. 18, 2002 COMIC STRIP COLT TOPS KEENELAND DAY 8 ALL’S FAIR A colt from the first crop of MGSW Comic Strip (Red Fair Mix (Ire) (Linamix {Fr}) secured his first group Ransom) fetched a session-topping bid of $250,000 as victory with a cozy win at the expense of renowned the Keeneland September Yearling Sale marched into its international traveler Jim and Tonic (Fr) (Double Bed second week yesterday in Lexington, Kentucky. Hip {Fr}) in the G3 La Coupe de Maisons-Laffitte Tuesday number 2762, consigned by Lane’s End, agent, was afternoon. Unraced as a juvenile, Fair Mix only made purchased by Jimmy Gladwell III. The bay is out of two starts as a sophomore, but one of those was a MGSW Chapel of Dreams (Northern Dancer), a half successful one at Saint-Cloud last December. This sister to Storm Cat, and he is a half brother to SP Seek- season has been his busiest to date, with two handicap ing the Dream (Seeking the Gold). Hip number 2637, a successes at Longchamp the platform for promotion to daughter of Kentucky Derby winner Real Quiet (Quiet stakes company, where he has won the Listed Prix de American) out of Silver Chance (Silver Buck), a full Reux at Deauville Aug. 6 and finished third in the G2 sister to Derby winner Silver Charm, was the top-priced Grand Prix de Deauville Aug.
  • View California Thoroughbred Stallion Directory

    View California Thoroughbred Stallion Directory

    Entered Stud in 2015 STORMBERG ch, 2008 Dosage (7-3-8-0-0); DI: 3.50; CD: 0.94 See gray pages—Nearctic RACE RECORD Northern Dancer, 1961 Nearctic, by Nearco Age Starts 1st 2nd 3rd Earned 18s, BTW, $580,647 Storm Bird, 1978 636 f, 147 BTW, 4.11 AEI Natalma, by Native Dancer 2 1 0 0 0 $2,250 6s, BTW, $169,181 3 5 0 1 0 $11,209 682 f, 63 BTW, 2.26 AEI South Ocean, 1967 New Providence, by Bull Page 22s, BTW, $70,147 4 3 2 1 0 $80,000 Storm Cat, dkb/br, 1983 8s, BTW, $570,610 12 f, 9 r, 9 w, 4 BTW Shining Sun, by Chop Chop 5 1 0 0 0 $506 1,414 f, 177 BTW, 2.94 AEI 6 4 0 0 2 $14,900 Secretariat, 1970 Bold Ruler, by Nasrullah 7.08 AWD 21s, BTW, $1,316,808 Totals 14 2 2 2 $108,865 Terlingua, 1976 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 17s, BTW, $423,896 Won At 4 11 f, 9 r, 6 w, 2 BTW Crimson Saint, 1969 Crimson Satan, by Spy Song A race at SA ($75,750, abt 6.5f, turf in 1:12.12, dftg. 11s, BTW, $91,770 Kumiva, Maui Mark, Aliza’s Dream, Warren’s Dr. 11 f, 8 r, 7 w, 4 BTW Bolero Rose, by Bolero Yang, Clinton). Blushing Groom, 1974 Red God, by Nasrullah A maiden special weight race at SA ($73,500, abt 10s, BTW, $407,153 6.5f, turf in 1:13.05, dftg.
  • (With VAT) the Property of Hever Stud Farm Ltd

    (With VAT) the Property of Hever Stud Farm Ltd

    HORSE OUT OF TRAINING, consigned by Hever Stud Farm The Property of Hever Stud Farm Ltd. Lot 1 (With VAT) Royal Applause Acclamation Harbour Watch (IRE) Princess Athena Woodman Gorband JANE CAMILLE Sheroog (GB) Alhaarth Unfuwain April 9th, 2016 Emulate (GB) Irish Valley (2004) Kenmare Bay Filly Aquarelle Aquamarine E.B.F. Nominated. JANE CAMILLE (GB): ran a few times at 3 years, 2019. Sold as she stands (see Conditions of Sale). FLAT 5 starts LAST THREE STARTS Latest BHA Rating 40 (Flat) (prior to compilation) 09/11/19 11/14 Class 6 (WFA AWT) Southwell 1m 13y 26/10/19 9/13 Class 6 (WFA AWT) Chelmsford City 7f 07/10/19 6/10 Class 5 (WFA Maiden) Windsor 6f 12y 1st dam EMULATE (GB): winner at 2 years and £6855; dam of 2 winners from 4 runners and 9 foals: Sandra (GB) (2010 f. by Three Valleys (USA)): 2 wins at 3 and 6 years in Bulgaria and in Germany and £9842 and placed 14 times. Manton Grange (GB) (2013 g. by Siyouni (FR)): 2 wins at 4 years, 2017 and £22,345 and placed 9 times. Dale Doback (GB) (2015 g. by Medicean (GB)): ran twice in N.H. Flat Races. Jane Camille (GB) (2016 f. by Harbour Watch (IRE)): see above. She also has a yearling filly by Harbour Watch (IRE) and a colt foal by Lethal Force (IRE). 2nd dam AQUARELLE (GB): winner at 2 years in France and £15,898; dam of 4 winners inc.: Coastline (GB): 3 wins in France and £18,132; dam of 3 winners inc.: Pain Perdu (FR): 9 wins in France and in Germany and £300,776, 2nd Prix La Force, Longchamp, Gr.3, Prix Francois Mathet, Saint-Cloud, L.
  • California Thoroughbred Stallion Directory

    California Thoroughbred Stallion Directory

    MANY RIVERS ch, 2005 Dosage (7-4-8-1-0); DI: 3.00; CD: 0.85 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Northern Dancer, 1961 Nearctic, by Nearco 18s, BTW, $580,647 Age Starts 1st 2nd 3rd Earned Storm Bird, 1978 636 f, 147 BTW, 4.11 AEI Natalma, by Native Dancer 2 8 1 2 1(1) $45,180 6s, BTW, $169,181 3 8 1 0 1 $26,526 682 f, 63 BTW, 2.26 AEI South Ocean, 1967 New Providence, by Bull Page 22s, BTW, $70,147 4 0 0 0 0 — Storm Cat, dkb/br, 1983 8s, BTW, $570,610 12 f, 9 r, 9 w, 4 BTW Shining Sun, by Chop Chop 5 2 0 0 0 $800 1,414 f, 177 BTW, 2.94 AEI Secretariat, 1970 Bold Ruler, by Nasrullah Totals 18 2 2 2(1) $72,506 7.08 AWD 21s, BTW, $1,316,808 Won At 2 Terlingua, 1976 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 17s, BTW, $423,896 A maiden special weight race at BM ($40,200, 5.5f in 11 f, 9 r, 6 w, 2 BTW Crimson Saint, 1969 Crimson Satan, by Spy Song 1:04.47, dftg. Kentucky Twostep, Autism 11s, BTW, $91,770 Awareness, Vadheim, Forearlthepearl, Strong 11 f, 8 r, 7 w, 4 BTW Bolero Rose, by Bolero Suggestion, Sweetville, Searchforthetruth, etc.). Exclusive Native, 1965 Raise a Native, by Native Dancer 3rd Gold Rush S (8f, AW, to El Gato Malo, Bert’s Law, 13s, BTW, $169,013 dftg.