SNIP1 Antibody (N-Term) Blocking Peptide Synthetic Peptide Catalog # Bp12249a
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
TET2 Binding to Enhancers Facilitates Transcription Factor Recruitment in Hematopoietic Cells
Downloaded from genome.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press 1 2 TET2 binding to enhancers facilitates 3 transcription factor recruitment in hematopoietic cells 4 5 Kasper D. Rasmussen1,2,7,8*, Ivan Berest3,8, Sandra Keβler1,2,6, Koutarou Nishimura1,4, 6 Lucía Simón-Carrasco1,2, George S. Vassiliou5, Marianne T. Pedersen1,2, 7 Jesper Christensen1,2, Judith B. Zaugg3* and Kristian Helin1,2,4*. 8 9 1Biotech Research and Innovation Centre (BRIC), Faculty of Health and Medical Sciences, University of 10 Copenhagen, 2200 Copenhagen, Denmark. 2The Novo Nordisk Foundation Center for Stem Cell Biology 11 (Danstem), Faculty or Health and Medical Sciences, University of Copenhagen, 2200 Copenhagen, 12 Denmark. 3European Molecular Biology Institute, Structural and Computational Unit. 4Cell Biology Program, 13 Memorial Sloan Kettering Cancer Center, New York, NY, USA. 5Wellcome Trust Sanger Institute, Wellcome 14 Trust Genome Campus, Cambridge, United Kingdom and Department of Haematology, Cambridge 15 University Hospitals NHS Trust, Cambridge, United Kingdom. 6Present address: Friedrich Miescher Institute 16 for Biomedical Research (FMI), CH-4058 Basel, Switzerland. 7Present address: Centre for Gene Regulation 17 and Expression (GRE), School of Life Sciences, University of Dundee, Dundee, UK. 8These authors 18 contributed equally. 19 20 *Correspondence: [email protected], [email protected], [email protected] 21 22 Running title: TET2 and TF binding in enhancers 23 24 Keywords: Acute Myeloid Leukemia; Chromatin; DNA binding; DNA methylation; Epigenetics; 25 Hematopoiesis; TET2; Transcription Factor Downloaded from genome.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press Rasmussen et al. -
Dissertation
Regulation of gene silencing: From microRNA biogenesis to post-translational modifications of TNRC6 complexes DISSERTATION zur Erlangung des DOKTORGRADES DER NATURWISSENSCHAFTEN (Dr. rer. nat.) der Fakultät Biologie und Vorklinische Medizin der Universität Regensburg vorgelegt von Johannes Danner aus Eggenfelden im Jahr 2017 Das Promotionsgesuch wurde eingereicht am: 12.09.2017 Die Arbeit wurde angeleitet von: Prof. Dr. Gunter Meister Johannes Danner Summary ‘From microRNA biogenesis to post-translational modifications of TNRC6 complexes’ summarizes the two main projects, beginning with the influence of specific RNA binding proteins on miRNA biogenesis processes. The fate of the mature miRNA is determined by the incorporation into Argonaute proteins followed by a complex formation with TNRC6 proteins as core molecules of gene silencing complexes. miRNAs are transcribed as stem-loop structured primary transcripts (pri-miRNA) by Pol II. The further nuclear processing is carried out by the microprocessor complex containing the RNase III enzyme Drosha, which cleaves the pri-miRNA to precursor-miRNA (pre-miRNA). After Exportin-5 mediated transport of the pre-miRNA to the cytoplasm, the RNase III enzyme Dicer cleaves off the terminal loop resulting in a 21-24 nt long double-stranded RNA. One of the strands is incorporated in the RNA-induced silencing complex (RISC), where it directly interacts with a member of the Argonaute protein family. The miRNA guides the mature RISC complex to partially complementary target sites on mRNAs leading to gene silencing. During this process TNRC6 proteins interact with Argonaute and recruit additional factors to mediate translational repression and target mRNA destabilization through deadenylation and decapping leading to mRNA decay. -
A Novel Smad Nuclear Interacting Protein, SNIP1, Suppresses P300-Dependent TGF- Signal Transduction
Downloaded from genesdev.cshlp.org on October 5, 2021 - Published by Cold Spring Harbor Laboratory Press A novel Smad nuclear interacting protein, SNIP1, suppresses p300-dependent TGF- signal transduction Richard H. Kim,1 David Wang,1 Michael Tsang,2 Jennifer Martin,3,5 Carla Huff,1 Mark P. de Caestecker,1 W. Tony Parks,2 Xianwang Meng,3,5 Robert J. Lechleider,4 Tongwen Wang,3,5 and Anita B. Roberts2,6 1Laboratory of Cell Regulation and Carcinogenesis, National Cancer Institute, Bethesda, Maryland 20892 USA; 2Laboratory of Molecular Genetics, National Institute of Child Health and Human Development, Bethesda, Maryland 20892 USA; 3Department of Surgery, Massachusetts General Hospital, Department of Genetics, Harvard Medical School, Boston, Massachusetts 02114 USA Members of the transforming growth factor- superfamily play critical roles in controlling cell growth and differentiation. Effects of TGF- family ligands are mediated by Smad proteins. To understand the mechanism of Smad function, we sought to identify novel interactors of Smads by use of a yeast two-hybrid system. A 396-amino acid nuclear protein termed SNIP1 was cloned and shown to harbor a nuclear localization signal (NLS) and a Forkhead-associated (FHA) domain. The carboxyl terminus of SNIP1 interacts with Smad1 and Smad2 in yeast two-hybrid as well as in mammalian overexpression systems. However, the amino terminus of SNIP1 harbors binding sites for both Smad4 and the coactivator CBP/p300. Interaction between endogenous levels of SNIP1 and Smad4 or CBP/p300 is detected in NMuMg cells as well as in vitro. Overexpression of full-length SNIP1 or its amino terminus is sufficient to inhibit multiple gene responses to TGF- and CBP/p300, as well as the formation of a Smad4/p300 complex. -
Durbinharly.Pdf (9.770Mb)
GENOMICS OF SEASONAL HAIR SHEDDING AND ECOREGION-SPECIFIC GROWTH TO IDENTIFY ENVIRONMENTALLY-ADAPTED BEEF CATTLE _______________________________________ A Dissertation presented to the Faculty of the Graduate School at the University of Missouri-Columbia _______________________________________________________ In Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy _____________________________________________________ by HARLY JANE DURBIN Dr. Jared Decker, Dissertation Supervisor December 2020 APPROVAL PAGE The undersigned, appointed by the Dean of the Graduate School, have examined the dissertation entitled: GENOMICS OF SEASONAL HAIR SHEDDING AND ECO-REGION SPECIFIC GROWTH TO IDENTIFY ENVIRONMENTALLY-ADAPTED BEEF CATTLE Presented by Harly Jane Durbin, a candidate for the degree of Doctor of Philosophy, and hereby certify that in their opinion it is worthy of acceptance. _____________________________________ Dr. Jared E. Decker, Animal Sciences, UMC _____________________________________ Dr. Robert D. Schnabel, Animal Sciences, UMC _____________________________________ Dr. Jeremy F. Taylor, Animal Sciences, UMC _____________________________________ Dr. Elizabeth G. King, Biological Sciences, UMC _____________________________________ Dr. Stephen P. Miller, Angus Genetics, Inc. DEDICATION Momma – thank you for teaching me compassion and also how to approach life with a sense of humor. You do such an incredible amount for other people and I strive to be as selfless every day. Daddy – thank you for encouraging me to think independently and for teaching me how to stand up for myself. Thank you also for the years of FFA (also known sometimes as Father Feeds Animal) and getting up early to haul heifers to jackpot shows. Darby – thank you for holding me to a high standard. I often think there was some mix-up and that you were meant to be the older sister for how much you hold me up. -
Smad Regulation in TGF-(Beta) Signal Transduction
COMMENTARY 4359 Smad regulation in TGF-β signal transduction Aristidis Moustakas, Serhiy Souchelnytskyi and Carl-Henrik Heldin Ludwig Institute for Cancer Research, Box 595, SE-751 24 Uppsala, Sweden Corresponding author (e-mail: [email protected]) Journal of Cell Science 114, 4359-4369 (2001) © The Company of Biologists Ltd Summary Smad proteins transduce signals from transforming growth promote degradation of transcriptional repressors, thus factor-β (TGF-β) superfamily ligands that regulate cell facilitating target gene regulation by TGF-β. Smads proliferation, differentiation and death through activation themselves can also become ubiquitinated and are of receptor serine/threonine kinases. Phosphorylation of degraded by proteasomes. Finally, the inhibitory Smads (I- receptor-activated Smads (R-Smads) leads to formation of Smads) block phosphorylation of R-Smads by the receptors complexes with the common mediator Smad (Co-Smad), and promote ubiquitination and degradation of receptor which are imported to the nucleus. Nuclear Smad complexes, thus inhibiting signalling. oligomers bind to DNA and associate with transcription factors to regulate expression of target genes. Alternatively, Key words: Phosphorylation, Signal transduction, Smad, nuclear R-Smads associate with ubiquitin ligases and Transforming growth factor-β, Ubiquitination Introduction chromosome 15q21-22, and MADH5, MADH1 and MADH8 Members of the transforming growth factor-β (TGF-β) family to chromosomes 15q31, 4 and 13, respectively (Gene control growth, differentiation -
MOLECULAR GENETI a Thesis Submitted to the School Of
MOLECULAR GENETICS OF CATTLE MUSCULARITY By Irida Novianti A thesis submitted to the University of Adelaide in fulfilment of the requirement of the degree of Master of Agricultural Science The University of Adelaide School of Animal and Veterinary Science December 2010 DECLARATION I declare that this thesis is a record of original work and contains no material that has been accepted for the award of any other degree or diploma in any university or other tertiary institution to Irida Novianti. To the best of my knowledge and belief, this thesis contains no material previously published or written by any other person, except where due reference is made in the text. I give consent to this copy of my thesis, when deposited in the University Library, being made available for loan and photocopying, subject to the provisions of the Copyright Act 1968. I also give permission for the digital version of my thesis to be made available on the web, via the University’s digital research repository, the Library catalogue, the Australasian Digital Theses Program (ADTP) and also through web search engines, unless permission has been granted by the University to restrict access for a period of time. Irida Novianti December, 2010 ii TABLE OF CONTENTS Declaration ........................................................................................................... ii Index of Figures ................................................................................................... vi Index of Tables .................................................................................................... -
Supplementary Table 1 Double Treatment Vs Single Treatment
Supplementary table 1 Double treatment vs single treatment Probe ID Symbol Gene name P value Fold change TC0500007292.hg.1 NIM1K NIM1 serine/threonine protein kinase 1.05E-04 5.02 HTA2-neg-47424007_st NA NA 3.44E-03 4.11 HTA2-pos-3475282_st NA NA 3.30E-03 3.24 TC0X00007013.hg.1 MPC1L mitochondrial pyruvate carrier 1-like 5.22E-03 3.21 TC0200010447.hg.1 CASP8 caspase 8, apoptosis-related cysteine peptidase 3.54E-03 2.46 TC0400008390.hg.1 LRIT3 leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 1.86E-03 2.41 TC1700011905.hg.1 DNAH17 dynein, axonemal, heavy chain 17 1.81E-04 2.40 TC0600012064.hg.1 GCM1 glial cells missing homolog 1 (Drosophila) 2.81E-03 2.39 TC0100015789.hg.1 POGZ Transcript Identified by AceView, Entrez Gene ID(s) 23126 3.64E-04 2.38 TC1300010039.hg.1 NEK5 NIMA-related kinase 5 3.39E-03 2.36 TC0900008222.hg.1 STX17 syntaxin 17 1.08E-03 2.29 TC1700012355.hg.1 KRBA2 KRAB-A domain containing 2 5.98E-03 2.28 HTA2-neg-47424044_st NA NA 5.94E-03 2.24 HTA2-neg-47424360_st NA NA 2.12E-03 2.22 TC0800010802.hg.1 C8orf89 chromosome 8 open reading frame 89 6.51E-04 2.20 TC1500010745.hg.1 POLR2M polymerase (RNA) II (DNA directed) polypeptide M 5.19E-03 2.20 TC1500007409.hg.1 GCNT3 glucosaminyl (N-acetyl) transferase 3, mucin type 6.48E-03 2.17 TC2200007132.hg.1 RFPL3 ret finger protein-like 3 5.91E-05 2.17 HTA2-neg-47424024_st NA NA 2.45E-03 2.16 TC0200010474.hg.1 KIAA2012 KIAA2012 5.20E-03 2.16 TC1100007216.hg.1 PRRG4 proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane) 7.43E-03 2.15 TC0400012977.hg.1 SH3D19 -
Decrypting Noncoding RNA Interactions, Structures, and Functional Networks
Downloaded from genome.cshlp.org on October 7, 2021 - Published by Cold Spring Harbor Laboratory Press Perspective Decrypting noncoding RNA interactions, structures, and functional networks Muller Fabbri,1,6 Leonard Girnita,2,6 Gabriele Varani,3 and George A. Calin4,5 1University of Hawaii Cancer Center, Cancer Biology Program, Honolulu, Hawaii 96813, USA; 2Department of Oncology-Pathology, Cellular and Molecular Tumor Pathology, Karolinska Institute, and Karolinska University Hospital, Stockholm, 17164 Sweden; 3Department of Chemistry, University of Washington, Seattle, Washington 98195-1700, USA; 4Department of Experimental Therapeutics, Division of Cancer Medicine, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030, USA; 5Center for RNA Interference and Non-Coding RNAs, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030, USA The world of noncoding RNAs (ncRNAs) is composed of an enormous and growing number of transcripts, ranging in length from tens of bases to tens of kilobases, involved in all biological processes and altered in expression and/or function in many types of human disorders. The premise of this review is the concept that ncRNAs, like many large proteins, have a multidomain architecture that organizes them spatially and functionally. As ncRNAs are beginning to be imprecisely clas- sified into functional families, we review here how their structural properties might inform their functions with focus on structural architecture–function relationships. We will describe the properties of “interactor elements” (IEs) involved in di- rect physical interaction with nucleic acids, proteins, or lipids and of “structural elements” (SEs) directing their wiring within the “ncRNA interactor networks” through the emergence of secondary and/or tertiary structures. -
Defining the Genetic Basis of Three Hereditary Neurological Conditions in Families from the Indian Subcontinent
RETA LILA WESTON INSTITUTE OF NEUROLOGICAL STUDIES INSTITUTE OF NEUROLOGY UNIVERSITY COLLEGE LONDON DEFINING THE GENETIC BASIS OF THREE HEREDITARY NEUROLOGICAL CONDITIONS IN FAMILIES FROM THE INDIAN SUBCONTINENT Dr Vafa Alakbarzade PhD Thesis 2016 1 DEFINING THE GENETIC BASIS OF THREE HEREDITARY NEUROLOGICAL CONDITIONS IN FAMILIES FROM THE INDIAN SUBCONTINENT Submitted by Dr Vafa Alakbarzade, MBBS, MRCP (UK), MSc University College London Student Number: 1028294 to University College London as a thesis for the degree of Doctor of Philosophy, January 2016 This thesis is available for Library use on the understanding that it is copyright material and that no quotation from the thesis may be published without proper acknowledgement I confirm that the work presented in this thesis is my own and information derived from other sources has been indicated in the thesis (Signature) …………………………………………………… 2 ACKNOWLEDGEMENTS Foremost I would like to thank the families who took part in these studies. I am sincerely grateful to Professor Tom Warner and Professor Andrew Crosby, without whom I would never have had all the wonderful experiences this PhD brought me. They have always supported and encouraged me in whatever scientific endeavours I have followed. Dr. Barry Chioza and Dr. Sreekantan-Nair Ajith provided invaluable support and advice throughout my PhD; I am hugely appreciative of their guidance and encouragement. None of the work in this thesis would have been possible without guidance of Dr. Barry Chioza. I would specifically like to appreciate contribution of the team of Prof. David Silver and Dr. Kulkarni Abhijit who provided functional follow up of our genetic findings and Dr. -
Analyzing the Mirna-Gene Networks to Mine the Important Mirnas Under Skin of Human and Mouse
Hindawi Publishing Corporation BioMed Research International Volume 2016, Article ID 5469371, 9 pages http://dx.doi.org/10.1155/2016/5469371 Research Article Analyzing the miRNA-Gene Networks to Mine the Important miRNAs under Skin of Human and Mouse Jianghong Wu,1,2,3,4,5 Husile Gong,1,2 Yongsheng Bai,5,6 and Wenguang Zhang1 1 College of Animal Science, Inner Mongolia Agricultural University, Hohhot 010018, China 2Inner Mongolia Academy of Agricultural & Animal Husbandry Sciences, Hohhot 010031, China 3Inner Mongolia Prataculture Research Center, Chinese Academy of Science, Hohhot 010031, China 4State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, China 5Department of Biology, Indiana State University, Terre Haute, IN 47809, USA 6The Center for Genomic Advocacy, Indiana State University, Terre Haute, IN 47809, USA Correspondence should be addressed to Yongsheng Bai; [email protected] and Wenguang Zhang; [email protected] Received 11 April 2016; Revised 15 July 2016; Accepted 27 July 2016 Academic Editor: Nicola Cirillo Copyright © 2016 Jianghong Wu et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Genetic networks provide new mechanistic insights into the diversity of species morphology. In this study, we have integrated the MGI, GEO, and miRNA database to analyze the genetic regulatory networks under morphology difference of integument of humans and mice. We found that the gene expression network in the skin is highly divergent between human and mouse. -
Analysis of Mammalian Gene Function Through Broad-Based Phenotypic
ARTICLES Analysis of mammalian gene function through broad-based phenotypic screens across a consortium of mouse clinics The function of the majority of genes in the mouse and human genomes remains unknown. The mouse embryonic stem cell knockout resource provides a basis for the characterization of relationships between genes and phenotypes. The EUMODIC consortium developed and validated robust methodologies for the broad-based phenotyping of knockouts through a pipeline comprising 20 disease-oriented platforms. We developed new statistical methods for pipeline design and data analysis aimed at detecting reproducible phenotypes with high power. We acquired phenotype data from 449 mutant alleles, representing 320 unique genes, of which half had no previous functional annotation. We captured data from over 27,000 mice, finding that 83% of the mutant lines are phenodeviant, with 65% demonstrating pleiotropy. Surprisingly, we found significant differences in phenotype annotation according to zygosity. New phenotypes were uncovered for many genes with previously unknown function, providing a powerful basis for hypothesis generation and further investigation in diverse systems. Phenotypic annotations of knockout mutants have been generated for (EMPReSS) database10 catalogs the standard operating procedures about a third of the genes in the mouse genome1. However, the way in (SOPs) that were developed, including operational details and the which the phenotype is screened is often dependent on the expertise and parameters measured. More recently, a major single-center effort interests of the investigator, and in only a few cases has a broad-based to analyze several hundred knockout lines through a phenotyping assessment of phenotype been undertaken that encompassed the analy- pipeline has illuminated the pleiotropy that can be found and the sis of developmental, biochemical, physiological and organ systems2–4. -
SNIP1 Rabbit Polyclonal Antibody – TA333669 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA333669 SNIP1 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-SNIP1 Antibody: synthetic peptide directed towards the middle region of human SNIP1. Synthetic peptide located within the following region: RNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRG Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 46 kDa Gene Name: Smad nuclear interacting protein 1 Database Link: NP_078976 Entrez Gene 79753 Human Q8TAD8 Background: Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression. Synonyms: PMRED Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 82%; Rabbit: 81% This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SNIP1 Rabbit Polyclonal Antibody – TA333669 Product images: WB Suggested Anti-SNIP1 Antibody Titration: 0.2- 1 ug/ml; Positive Control: Jurkat cell lysateSNIP1 is supported by BioGPS gene expression data to be expressed in Jurkat This product is to be used for laboratory only.