DOCSLIB.ORG

Glypican 3 (GPC3) (NM 001164618) Human Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Glypican 3 (GPC3) (NM 001164618) Human Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC228459 Glypican 3 (GPC3) (NM_001164618) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Glypican 3 (GPC3) (NM_001164618) Human Tagged ORF Clone Tag: Myc-DDK Symbol: GPC3 Synonyms: DGSX; GTR2-2; MXR7; OCI-5; SDYS; SGB; SGBS; SGBS1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 Glypican 3 (GPC3) (NM_001164618) Human Tagged ORF Clone – RC228459 ORF Nucleotide >RC228459 representing NM_001164618 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGGGACCGTGCGCACCGCGTGCTTGGTGGTGGCGATGCTGCTCAGCTTGGACTTCCCGGGACAGG CGCAGCCCCCGCCGCCGCCGCCGGACGCCACCTGTCACCAAGTCCGCTCCTTCTTCCAGAGACTGCAGCC CGGACTCAAGTGGGTGCCAGAAACTCCCGTGCCAGGATCAGATTTGCAAGTATGTCTCCCTAAGGGCCCA ACATGCTGCTCAAGAAAGATGGAAGAAAAATACCAACTAACAGCACGATTGAACATGGAACAGCTGCTTC AGTCTGCAAAGGCCTTTGAAATTGTTGTTCGCCATGCCAAGAACTACACCAATGCCATGTTCAAGAACAA CTACCCAAGCCTGACTCCACAAGCTTTTGAGTTTGTGGGTGAATTTTTCACAGATGTGTCTCTCTACATC TTGGGTTCTGACATCAATGTAGATGACATGGTCAATGAATTGTTTGACAGCCTGTTTCCAGTCATCTATA CCCAGCTAATGAACCCAGGCCTGCCTGATTCAGCCTTGGACATCAATGAGTGCCTCCGAGGAGCAAGACG TGACCTGAAAGTATTTGGGAATTTCCCCAAGCTTATTATGACCCAGGTTTCCAAGTCACTGCAAGTCACT AGGATCTTCCTTCAGGCTCTGAATCTTGGAATTGAAGTGATCAACACAACTGATCACCTGAAGTTCAGTA AGGACTGTGGCCGAATGCTCACCAGAATGTGGTACTGCTCTTACTGCCAGGGACTGATGATGGTTAAACC CTGTGGCGGTTACTGCAATGTGGTCATGCAAGGCTGTATGGCAGGTGTGGTGGAGATTGACAAGTACTGG AGAGAATACATTCTGTCCCTTGAAGAACTTGTGAATGGCATGTACAGAATCTATGACATGGAGAACGTAC TGCTTGGTCTCTTTTCAACAATCCATGATTCTATCCAGTATGTCCAGAAGAATGCAGGAAAGCTGACCAC CACTATTGGCAAGTTATGTGCCCATTCTCAACAACGCCAATATAGATCTGCTTATTATCCTGAAGATCTC TTTATTGACAAGAAAGTATTAAAAGTTGCTCATGTAGAACATGAAGAAACCTTATCCAGCCGAAGAAGGG AACTAATTCAGAAGTTGAAGTCTTTCATCAGCTTCTATAGTGCTTTGCCTGGCTACATCTGCAGCCATAG CCCTGTGGCGGAAAACGACACCCTTTGCTGGAATGGACAAGAACTCGTGGAGAGATACAGCCAAAAGGCA GCAAGGAATGGAATGAAAAACCAGTTCAATCTCCATGAGCTGAAAATGAAGGGCCCTGAGCCAGTGGTCA GTCAAATTATTGACAAACTGAAGCACATTAACCAGCTCCTGAGAACCATGTCTATGCCCAAAGGTAGAGT TCTGGATAAAAACCTGGATGAGGAAGGGTTTGAAAGTGGAGACTGCGGTGATGATGAAGATGAGTGCATT GGAGGCTCTGGTGATGGAATGATAAAAGTGAAGAATCAGCTCCGCTTCCTTGCAGAACTGGCCTATGATC TGGATGTGGATGATGCGCCTGGAAACAGTCAGCAGGCAACTCCGAAGGACAACGAGATAAGCACCTTTCA CAACCTCGGGAACGTTCATTCCCCGCTGAAGCTTCTCACCAGCATGGCCATCTCGGTGGTGTGCTTCTTC TTCCTGGTGCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC228459 representing NM_001164618 Red=Cloning site Green=Tags(s) MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGP TCCSRKMEEKYQLTARLNMEQLLQSAKAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYI LGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVT RIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYW REYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDL FIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKA ARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECI GGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFF FLVH myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk8067_e06.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 4 Glypican 3 (GPC3) (NM_001164618) Human Tagged ORF Clone – RC228459 Cloning Scheme: Plasmid Map: ACCN: NM_001164618 ORF Size: 1692 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 4 Glypican 3 (GPC3) (NM_001164618) Human Tagged ORF Clone – RC228459 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001164618.2 RefSeq ORF: 1695 bp Locus ID: 2719 UniProt ID: Q53H15, B4DTD8 Protein Families: Druggable Genome MW: 63.73 kDa Gene Summary: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican- related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson- Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] Product images: Western blot validation of overexpression lysate (Cat# [LY431487]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC228459 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 4.
Load more

Recommended publications
  • Short Reports a Small Interstitial Deletion in the GPC3 Gene Causes Simpson-Golabi-Behmel Syndrome in a Dutch-Canadian Family
    J Med Genet 1999;36:57–58 57 Short reports J Med Genet: first published as 10.1136/jmg.36.1.57 on 1 January 1999. Downloaded from A small interstitial deletion in the GPC3 gene causes Simpson-Golabi-Behmel syndrome in a Dutch-Canadian family Jian Y Xuan, Rhiannon M Hughes-Benzie, Alex E MacKenzie Abstract prisingly, a family member with the apparent Deletions in the heparan sulphate proteo- stigmata of SGBS including Wilms tumour glycan encoding glypican 3 (GPC3) gene appeared not to inherit the SGBS chromosome have recently been documented in several in a previous linkage study.2 The definition of Simpson-Golabi-Behmel syndrome the GPC3 mutation has allowed the unequivo- (SGBS) families. However, no precisely cal documentation of a normal GPC3 status in defined SGBS mutation has been pub- this child. lished. We report here a 13 base pair DNA (extracted from peripheral blood and deletion which causes a frameshift and tumour tissues) was obtained from members of premature termination of the GPC3 gene the SGBS family and unrelated controls. PCR in the Dutch-Canadian SGBS family in amplification of exon 2 of the GPC3 gene was whom the trait was originally mapped. Our performed using the oligonucleotide primers analysis shows that a discrete GPC3 disa- EX2 A (5' gtttgccctgtttgccatg 3') and EX2 B (5' bling mutation is suYcient to cause SGBS. caaataatgatgccactaagc 3') producing a 329 bp Furthermore, our finding of a GPC3 nor- fragment in normal subjects.8 The reactions mal daughter of an SGBS carrier with contained 1 µg of DNA, 50 ng of each primer, skeletal abnormalities and Wilms tumour 0.2 mmol/l of each of the four dNTPs (dATP, raises the possibility of a trans eVect from dCTP, dGTP, and dTTP), and 1.2 U of Ta q the maternal carrier in SGBS kindreds.
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Original Article Immunization with Glypican-3 Nanovaccine Containing
    Am J Transl Res 2018;10(6):1736-1749 www.ajtr.org /ISSN:1943-8141/AJTR0072039 Original Article Immunization with glypican-3 nanovaccine containing TLR7 agonist prevents the development of carcinogen-induced precancerous hepatic lesions to cancer in a murine model Kun Chen1, Zhiyuan Wu1, Mengya Zang1, Ce Wang2, Yanmei Wang1, Dongmei Wang1, Yifan Ma2, Chunfeng Qu1,3 1Department of Immunology, National Cancer Center/National Clinical Research Center for Cancer/Cancer Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing 100021, China; 2Guangdong Key Laboratory of Nanomedicine, Key Lab of Health Informatics of Chinese Academy of Sciences, Shenzhen Institutes of Advanced Technology, Chinese Academy of Sciences, Shenzhen 518055, China; 3State Key Laboratory of Molecular Oncology, National Cancer Center/National Clinical Research Center for Cancer/Cancer Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing 100021, China Received January 3, 2018; Accepted June 1, 2018; Epub June 15, 2018; Published June 30, 2018 Abstract: Background: Glypican-3 (GPC3) is one of the key tissue markers that could discriminate malignant pre- cancerous lesions from benign hepatic lesions in cirrhotic patients. We aimed to develop a GPC3 cancer vaccine to induce specific T cells to intervene in hepatocellular carcinoma (HCC) development. Methods: Synthesizing manno- sylated liposomes (LPMan) as vaccine delivery system, incorporating one Toll-like receptor (TLR)-7/8 agonist CL097 as adjuvant, we prepared a GPC3 nanovaccine, LPMan-GPC3/CL097. We injected 25 mg/kg diethylnitrosamine intraperitoneally to induce autochthonous HCC in HBV-transgenic mice, which persistently express hepatitis B sur- face antigen in hepatocytes. Starting from week 8 after diethylnitrosamine injection when malignant hepatocytes generated, we immunized the mice subcutaneously every 2 weeks 4 times with LPMan-GPC3/CL097 containing 5 µg of GPC3 plus 5 µg of CL097.
    [Show full text]
  • Prognostic Value of Glypican Family Genes in Early-Stage Pancreatic Ductal Adenocarcinoma After Pancreaticoduodenectomy and Possible Mechanisms
    Prognostic value of Glypican family genes in early-stage pancreatic ductal adenocarcinoma after pancreaticoduodenectomy and possible mechanisms Jun-qi Liu Guangxi Medical University First Aliated Hospital Xi-wen Liao Guangxi Medical University First Aliated Hospital Xiang-kun Wang Guangxi Medical University First Aliated Hospital Cheng-kun Yang Guangxi Medical University First Aliated Hospital Xin Zhou Guangxi Medical University First Aliated Hospital Zheng-qian Liu Guangxi Medical University First Aliated Hospital Quan-fa Han Guangxi Medical University First Aliated Hospital Tian-hao Fu Guangxi Medical University First Aliated Hospital Guang-zhi Zhu Guangxi Medical University First Aliated Hospital Chuang-ye Han Guangxi Medical University First Aliated Hospital Hao Su Guangxi Medical University First Aliated Hospital Jian-lu Huang Guangxi Medical University First Aliated Hospital Guo-tian Ruan Guangxi Medical University First Aliated Hospital Ling Yan Guangxi Medical University First Aliated Hospital Xin-ping Ye Guangxi Medical University First Aliated Hospital Tao Peng ( [email protected] ) the rst aliated hospital of guangxi medical university Research article Keywords: GPC family genes, pancreatic ductal adenocarcinoma, prognostic indicator, mechanism Posted Date: December 9th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-48421/v3 Page 1/32 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Version of Record: A version of this preprint was published on December 10th, 2020. See the published version at https://doi.org/10.1186/s12876-020-01560-0. Page 2/32 Abstract Background: This study explored the prognostic signicance of Glypican (GPC) family genes in patients with pancreatic ductal adenocarcinoma (PDAC) after pancreaticoduodenectomy using data from The Cancer Genome Atlas (TCGA) and Gene Expression Omnibus (GEO).
    [Show full text]
  • A Workbench for Interactive Exploratory Data Analysis of Large Expression Datasets
    bioRxiv preprint doi: https://doi.org/10.1101/698969; this version posted July 14, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. MetaOmGraph: a workbench for interactive exploratory data analysis of large expression datasets Urminder Singh1,2, Manhoi Hur2, Karin Dorman1,2,3, and Eve Wurtele1,2* 1Bioinformatics and Computational Biology Program, Iowa State University, Ames, IA 50011, USA 2Department of Genetics Development and Cell Biology, Iowa State University, Ames, IA 50011, USA 3Department of Statistics, Iowa State University, Ames, IA 50011, USA The diverse and growing omics data in public domains provide can be attained with bigger datasets and the wide variety researchers with a tremendous opportunity to extract hidden of biological conditions can reveal the diverse transcription knowledge. However, the challenge of providing domain ex- spectrum of genes. Yet, despite the availability of such vast perts with easy access to these big data has resulted in the vast data resources, most bioinformatic studies use only a limited majority of archived data remaining unused. Here, we present amount of the available data. MetaOmGraph (MOG), a free, open-source, standalone soft- A common goal of analyzing omics data is to infer func- ware for exploratory data analysis of massive datasets by sci- entific researchers. Using MOG, a researcher can interactively tional roles of particular features by investigating differen- visualize and statistically analyze the data, in the context of its tial expression and coexpression patterns. A wide variety metadata. Researchers can interactively hone-in on groups of of R-platform tools can provide specific analyses (9–16).
    [Show full text]
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
    [Show full text]
  • Mouse Anti-Human Glypican-3 Monoclonal Antibody, Clone JID516 (CABT-L2888) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Mouse Anti-Human Glypican-3 monoclonal antibody, clone JID516 (CABT-L2888) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview This antibody is intended for qualified laboratories to qualitatively identify by light microscopy the presence of associated antigens in sections of formalin-fixed, paraffin-embedded tissue sections using IHC test methods. Specificity Human Glypican-3 Isotype IgG Source/Host Mouse Species Reactivity Human Clone JID516 Conjugate Unconjugated Applications IHC Reconstitution The prediluted antibody does not require any mixing, dilution, reconstitution, or titration; the antibody is ready-to-use and optimized for staining. The concentrated antibody requires dilution in the optimized buffer, to the recommended working dilution range. Positive Control Hepatocellular Carcinoma Format Liquid Size Predilut: 7ml; Concentrate: 100ul, 1ml. Positive control slides also available. Buffer Predilute: Antibody Diluent Buffer Concentrate: Tris Buffer, pH 7.3 - 7.7, with 1% BSA Preservative <0.1% Sodium Azide Storage Store at 2-8°C. Do not freeze. Ship Wet ice Warnings This antibody is intended for use in Immunohistochemical applications on formalinfixed paraffin- 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved embedded tissues (FFPE), frozen tissue sections and cell preparations. BACKGROUND Introduction Glypican-3 (GPC3) is a GPI-archored proteoglycan involved in cell division and growth regulation. Glypican-3 is a useful tumor marker, and its expression has been shown to be upregulated in hepatocellular carcinoma (HCC), hepatoblastoma, melanoma, testicular germ cell tumors, and Wilms' tumor.
    [Show full text]
  • Rs2267531, a Promoter SNP Within Glypican-3 Gene in the X
    www.nature.com/scientificreports OPEN rs2267531, a promoter SNP within glypican-3 gene in the X chromosome, is associated Received: 2 January 2019 Accepted: 23 April 2019 with hepatocellular carcinoma in Published: xx xx xxxx Egyptians Tarek Mohamed Kamal Motawi1, Nermin Abdel Hamid Sadik1, Dina Sabry 2, Nancy Nabil Shahin1 & Sally Atef Fahim 3 Hepatocellular carcinoma (HCC) is a major health concern in Egypt owing to the high prevalence of hepatitis C virus (HCV) infection. HCC incidence is characterized by obvious male predominance, yet the molecular mechanisms behind this gender bias are still unidentifed. Functional variations in X-linked genes have more impact on males than females. Glypican-3 (GPC3) gene, located in the Xq26 region, has lately emerged as being potentially implicated in hepatocellular carcinogenesis. The current study was designed to examine the association of −784 G/C single nucleotide polymorphism (SNP) in GPC3 promoter region (rs2267531) with HCC susceptibility in male and female Egyptian HCV patients. Our results revealed a signifcant association between GPC3 and HCC risk in both males and females, evidenced by higher C allele and CC/C genotype frequencies in HCC patients when compared to controls. However, no such association was found when comparing HCV patients to controls. Moreover, GPC3 gene and protein expression levels were signifcantly higher in CC/C than in GG/G genotype carriers in males and females. The CC/C genotype exhibited a signifcant shorter overall survival than GG/G genotype in HCC patients. In conclusion, GPC3 rs2267531 on the X chromosome is signifcantly associated with HCC, but not with HCV infection, in the Egyptian population.
    [Show full text]
  • Glypican-3: a Molecular Marker for the Detection and Treatment of Hepatocellular Carcinoma☆
    UC Davis UC Davis Previously Published Works Title Glypican-3: A molecular marker for the detection and treatment of hepatocellular carcinoma☆. Permalink https://escholarship.org/uc/item/6cp3q81q Journal Liver research, 4(4) ISSN 2096-2878 Authors Shih, Tsung-Chieh Wang, Lijun Wang, Hsiao-Chi et al. Publication Date 2020-12-01 DOI 10.1016/j.livres.2020.11.003 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Liver Research 4 (2020) 168e172 Contents lists available at ScienceDirect Liver Research journal homepage: http://www.keaipublishing.com/en/journals/liver-research Review Article Glypican-3: A molecular marker for the detection and treatment of hepatocellular carcinoma* * Tsung-Chieh Shih a, Lijun Wang b, Hsiao-Chi Wang c, Yu-Jui Yvonne Wan b, a Department of Biochemistry and Molecular Medicine, University of California Davis, Sacramento, CA, USA b Department of Pathology and Laboratory Medicine, University of California Davis, Sacramento, CA, USA c Department of Internal Medicine, University of California Davis, Davis, CA, USA article info abstract Article history: Hepatocellular carcinoma (HCC) is a malignant tumor with a fairly poor prognosis (5-year survival of less Received 26 August 2020 than 50%). Using sorafenib, the only food and drug administration (FDA)-approved drug, HCC cannot be Received in revised form effectively treated; it can only be controlled at most for a couple of months. There is a great need to 23 October 2020 develop efficacious treatment against this debilitating disease. Glypican-3 (GPC3), a member of the Accepted 6 November 2020 glypican family that attaches to the cell surface by a glycosylphosphatidylinositol anchor, is overex- pressed in HCC cases and is elevated in the serum of a large proportion of patients with HCC.
    [Show full text]
  • The Glypican Proteoglycans Show Intrinsic Interactions with Wnt-3A In
    Moraes et al. BMC Molecular and Cell Biology (2021) 22:26 BMC Molecular and https://doi.org/10.1186/s12860-021-00361-x Cell Biology RESEARCH ARTICLE Open Access The Glypican proteoglycans show intrinsic interactions with Wnt-3a in human prostate cancer cells that are not always associated with cascade activation Gabrielle Ferrante Alves de Moraes1, Eduardo Listik1, Giselle Zenker Justo1,2, Carolina Meloni Vicente1 and Leny Toma1* Abstract Background: Prostate cancer occurs through multiple steps until advanced metastasis. Signaling pathways studies can result in the identification of targets to interrupt cancer progression. Glypicans are cell surface proteoglycans linked to the membrane through glycosylphosphatidylinositol. Their interaction with specific ligands has been reported to trigger diverse signaling, including Wnt. In this study, prostate cancer cell lines PC-3, DU-145, and LNCaP were compared to normal prostate RWPE-1 cell line to investigate glypican family members and the activation of the Wnt signaling pathway. Results: Glypican-1 (GPC1) was highly expressed in all the examined cell lines, except for LNCaP, which expressed glypican-5 (GPC5). The subcellular localization of GPC1 was detected on the cell surface of RWPE-1, PC-3, and DU- 145 cell lines, while GPC5 suggested cytoplasm localization in LNCaP cells. Besides glypican, flow cytometry analysis in these prostate cell lines confirmed the expression of Wnt-3a and unphosphorylated β-catenin. The co- immunoprecipitation assay revealed increased levels of binding between Wnt-3a and glypicans in cancer cells, suggesting a relationship between these proteoglycans in this pathway. A marked increase in nuclear β-catenin was observed in tumor cells.
    [Show full text]
  • Evaluation of Glypican-3 Expression in Poorly Differentiated Carcinomas of Lung Origin
    18 Jul 2020 Vol 13 No.1 North American Journal of Medicine and Science Original Research Evaluation of Glypican-3 Expression in Poorly Differentiated Carcinomas of Lung Origin Jing Wang, MD;1 Oscar A. Roncal, MD;2 Michael M Ittmann, MD, PhD;3 Ying Ye, MD3* 1 Department of Pathology & Immunology, Baylor College of Medicine, Houston, TX 2 North Texas Pathology Laboratories, Rowlett, TX 3 Department of Pathology & Immunology, Baylor College of Medicine, Michael E. DeBakey VA Medical Center, Houston, TX Glypican-3 (GPC-3) is a glycoconjugate protein of heparan sulfate proteoglycan family and is important for embryogenesis but silenced in adult healthy tissue. GPC-3 protein is abnormally expressed in hepatocellular carcinoma (HCC) and has been used as a marker for pathological diagnosis of primary and metastatic HCC. However, GPC-3 expression has also been found in some tumors other than HCC. This study is to investigate the expression of GPC-3 expression immunohistochemically and the staining pattern in poorly differentiated carcinomas of lung primary in order to assess the value of GPC-3 as a marker for diagnosing metastatic HCC in lung. Lung tissue from 44 patients diagnosed with poorly differentiated carcinoma were evaluated, including 23 lung adenocarcinomas, 19 squamous cell carcinomas and 2 adenosquamous carcinomas. Immunohistochemical stains of GPC-3 was performed on tumor tissue samples. The expression pattern of GPC-3 was analyzed. Expression of GPC-3 was found in 45% of primary lung cancers, including 79% of squamous cell carcinomas, 18 % of adenocarcinomas, and 50% of adenosquamous carcinomas. The poorly differentiated carcinomas showed predominantly patchy positivity.
    [Show full text]
  • RA0125-C.5-IFU-RUO Glypican-3 (GPC3) (Marker of Hepatocellular Carcinoma)
    Instructions For Use RA0 12 5-C.5 -IFU -RUO Revision: 1 Rev. Date: Oct. 20, 2014 Page 1 of 2 P.O. Box 3286 - Logan, Utah 84323, U.S.A. - Tel. (800) 729-8350 – Tel. (435) 755-9848 - Fax (435) 755-0015 - www.scytek.com Glypican-3 (GPC3) (Marker of Hepatocellular Carcinoma); Clone GPC3/863 (Concentrate) Availability/Contents: Item # Volume RA0125-C.5 0.5 ml Description: Species: Mouse Immunogen: Recombinant human GPC3 protein Clone: GPC3/863 Isotype: IgG1, kappa Entrez Gene ID: 2719 (Human) Hu Chromosome Loc.: Xq26.2 Synonyms: DGSX; Glypican proteoglycan 3; GPC3; GTR2-2; Heparan sulphate proteoglycan; Intestinal protein OCI-5; MXR7; OCI-5; SDYS; Secreted glypican-3; SGBS1 Mol. Weight of Antigen: 67kDa Format: 200µg/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 1mM PBS with 0.05% BSA & 0.05% azide. Specificity: Anti-GPC3 has been identified as a useful tumor marker for the diagnosis of hepatocellular carcinoma (HCC), hepatoblastoma, melanoma, testicular germ cell tumors, and Wilm’s tumor. Background: Glypican-3 (GPC3) is an integral membrane protein that is mutated in the Simpson-Golabi- Behmel syndrome (SGBS). SGBS is characterized by pre- and post-natal overgrowth and is a recessive X-linked condition. GPC3 may also be found in a secreted form. In patients with HCC, GPC3 is overexpressed in neoplastic liver tissue and elevated in serum, but is undetectable in normal liver, benign liver, and the serum of healthy donors. GPC3 expression is also found to be higher in HCC liver tissue than in cirrhotic liver or liver with focal lesions such as dysplastic nodules and areas of hepatic adenoma (HA) with malignant transformation.
    [Show full text]