FRIDAY
161st YEAR • NO. 258 FEBRUARY 26, 2016 CLEVELAND, TN 22 PAGES • 50¢ City school board launches search for new director; July 1 is the goal By LARRY C. BOWERS Tennessee School Boards Association in its work,” she said in her opening discussions. Banner Staff Writer search. “We work to find the best candidate for the TSBA Executive Secretary Dr. Tammy job, and we will help you get a great person to The Cleveland Board of Education is mov- Grissom came to Cleveland on Thursday to lead this school district,” she added. ing swiftly to find a new director of schools. assist the school board in getting the search She also praised the Cleveland board, hav- The city school board is benefited by the under way. She brought along a copy of the ing worked with them before. fact it has retained selection criteria from five board’s selection criteria, and helped the “You have a great, great school system,” years ago when Dr. Martin Ringstaff was board to establish a timeline for the search. she said. hired for the position. Much of this criteria School board members, headed by Chair She emphasized several Tennessee school was compiled at community meetings. Dawn Robinson, made some slight changes, systems are seeking new superintendents. Ringstaff was fired recently for conduct additions and tweaks to the criteria prior to TSBA consultants are working with three of deemed unbecoming of a school system Banner photo, LARRY C. BOWERS approval. They did the same to the timeline. those districts, in addition to Cleveland. TENNESSEE SCHOOL BOARDS Association Executive Director employee. Grissom assured the board her organiza- Three metro systems, Davidson County, The Board of Education has once again tion will quickly move forward. “When you Dr. Tammy Grissom, left, shares a laugh with Cleveland Board of decided to utilize the services of the hire us, we work for you and do your leg- See DIRECTOR, Page 10 Education Chair Dawn Robinson prior to a meeting Thursday. Inside Today Hassan Banner photo, SARALYN NORKUS NEARLY A MONTH Earlier after surgery, 7-year-old Carli Oliver and her toy Najjar bear paid a visit to the Cleveland Daily Banner office, right photo. Oliver’s power playful demeanor has resigns remained unchanged despite going through her 13th cranial surgery. In outage the photo below, brother museum Hunter Oliver, from left, father Daniel Oliver and mother Beth Oliver pose cause with Carli at her pre- position surgery party at Black Fox Elementary. Director accepts is ID’d post in Colorado Transformer should Region roundball By LARRY C. BOWERS Five county prep hoops teams Banner Staff Writer have lasted longer are heading into Region 3-AAA play tonight and tomorrow. The Cleveland’s Museum Center at By RICK NORTON TCPS girls captured another con- Five Points is losing its top official. Associate Editor ference championship. Lee’s Hassan Najjar, the executive A midnight electrical outage roundballers came up “Short” in director of the museum, has that left 1,247 Cleveland Utilities their contest in Georgia. The UT informed the board of trustees he customers in an even darker athletic director stands by the will be resigning effective March dark, and most without heat, in school’s embattled football coach. 4. the wee morning hours of Feb. 11, See Sports, Pages 13-15. Najjar joined the museum three years ago, during challenging has been blamed on a power times. At the transformer’s Justice Scalia time, the muse- premature fail- um was strug- ure. will be missed gling to meet its The blackout Supreme Court Justice Antonin mission and Praying for Carli a little over two Scalia will be long remembered and cement its weeks ago forever missed because of a pio- identity as a occurred at destination for 12:11 a.m. and neering spirit and for offering views power was that weren’t always popular. At history, arts ‘Last resort’ surgery No. 13 brings and culture restored by least, this is the perspective of one within the e m e r g e n c y writer who had the chance to meet Najjar region. good news for Black Fox student crews to Payne Borden him. See the guest “Viewpoint” on Najjar has Gap area resi- Page 16 of today’s edition. been widely credited for his trans- By SARALYN NORKUS dents by 1:57 a.m., according to a formational leadership of the Banner Staff Writer report by Bart Borden, vice presi- dent of CU’s Electric Division. Forecast Museum Center, the realignment One month ago, 7-year-old of its mission and being an advo- Mechanical malfunctions are a Carli Oliver was preparing to part of life, but Borden told cate for the museum in the com- undergo what was referred to as munity and nationwide. Cleveland Board of Public Utilities a “last resort” surgery — her members during a formal session Notable accomplishments 13th cranial surgery to date. under Najjar’s direction include Thursday the unexpected shut- After five excruciating hours in down came on a 22-year-old the creation of three new exhibit a waiting room at T.C. spaces, a consistent and upgrad- transformer whose life expectancy Thompson Children’s Hospital, should be at least 50 years. ed schedule of exhibits, a new the Oliver family received the slate of mission-focused program- “It caught us very much by sur- best news possible: surgery No. prise,” Borden acknowledged. He Today looks to be mostly sunny, ming, housing the permanent col- 13, which was performed by with a high near 48 degrees. lection, receiving Smithsonian later added, “We were not expect- Walter E. Boehm Birth Defect ing it.” Tonight’s forecast calls for partly accreditation, an overhaul of Center Neurosurgeon Dr. Peter heating and air conditioning, and That’s because routine mainte- cloudy skies, with a low around 30. Boehm Jr. and Craniofacial and nance testing performed in the recent facelift of the Museum Pediatric Plastic Surgeon Dr. Saturday should be mostly sunny store and lobby. August 2015 showed the trans- and somewhat warmer, with a high Devan Griner, had proven to be former to be operating properly, “Hassan’s leadership and vision lucky indeed. near 56. Saturday night calls for reshaped the Museum Center into and well within required guide- clear skies and a low around 35. “It went so much better than I lines. a true community asset,” said ever imagined,” said Carli’s mom, Mike Griffin, board president. On the night of the outage, CU Beth. “It took about five hours crews performed exploratory test- Index “He’s the type of guy that rolls and everything went as planned, up his sleeves and gets the job ing and as the Payne Gap substa- Church...... 8-9 done, and that’s the example he tion was being powered up, it Classified...... 20-21 See CARLI Page 12 Comics...... 17 See MUSEUM, Page 10 See OUTAGE, Page 10 Editorials...... 16 Horoscope...... 17 Obituaries...... 2 Traffic attack suspects Stocks...... 4 County schools mourn Sports...... 13-15 ‘dangerous criminals’ TV Schedule...... 18-19 Weather...... 11 By ALLEN MINCEY lent crime as this is no different death of John Mehling Banner Staff Writer than using a firearm or any other Around Town weapon. We consider the sus- By CHRISTY ARMSTRONG A person or persons throwing pects to be dangerous criminals Banner Staff Writer objects at oncoming traffic could Madison Scoggins enjoying her who will be treated as such,” said face serious charges, according Gibson. For the third time this school year, a Bradley County school day off with her mom ... Angie to law enforcement officials. They is faced with mourning the loss of a teacher. Burnette being told she doesn’t sing Watson said the two law warned such actions could cause enforcement agencies are looking John Mehling, a reading intervention specialist and ACT prep well enough to be in 4-year-old serious accidents resulting in for the identity of a suspect teacher at Walker Valley High School, died Feb. 18 at the age of granddaughter Mackenly’s band ... injuries or even fatalities. described as a white male who 54. He will be honored with a funeral this weekend. Gary Williamson sporting around in a Both Bradley County Sheriff was observed throwing objects Walker Valley Principal Nat Akiona said Mehling will be new SUV ... Jenny Garner-Davis Eric Watson and Cleveland Police from the back of a dark-colored missed, and his contributions to the school were great. having her sights set on the big pic- Chief Mark Gibson are asking for pickup truck at approaching “He was a good example of a lifelong learner and an excellent example for students,” Akiona said. ture ... Teakoah Doss and Brooke the public’s help in identifying vehicles. He did say that they do As someone who helped students improve their math, sci- Taylor doing some modeling at the the person or persons responsi- not appear to be related to inci- ble for these acts, which report- ence and English skills for the ACT exam, he also said Mehling Old Woolen Mill ... Lois Myers talking dents of vandalism from earlier helped raise the school’s average ACT composite score. That about how much she enjoyed her edly occurred on the evening of this month, for which five juve- Feb. 19 through the morning of average currently sits at 25 — higher than both the state and recent trip to Hollywood Beach, Fla. niles and one adult were arrest- national averages. Feb. 20, and were not confined to ed. any one section of the county or “Someone knows who these city. John Mehling See MEHLING, Page 10 “We treat this as a serious, vio- See TRAFFIC, Page 3 6489076 75112 2—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com
OBITUARIES (USPS 117-700) Periodical Postage Paid at Cleveland, TN 37320-3600 Post Office POSTMASTER: Send Address Changes to: Banner, P.O. Box 3600, Cleveland, TN 37320-3600 Chris Davis Alford Andrew Ferry gregation through numerous Published at 1505 25th Street, NW (P.O. Box 3600) building programs, establishing Alford Andrew Ferry, 67, of in Cleveland, TN 37320-3600, daily except Saturday Chris Davis, 50, of Calhoun, community ministries, exponen- and Christmas day by Cleveland Newspapers, Inc. died Thursday evening, Feb. 25, Delano, died Wednesday, Feb. tial growth, the construction of a Phone (423) 472-5041. 2016, in an Athens hospital. 24, 2016. 4,000-seat sanctuary, and the Survivors and funeral arrange- He was preceded in death by construction of 410 apartments Stephen L. Crass Jim Bryant ments will be announced by the his parents, Oscar and Vertie for the elderly and median- Editor & Publisher General Manager Wildwood Avenue Chapel of Jim Gossett Ferry; and brothers: income families. Rush Funeral and Cremation Raymond, Maynard and Clifford He, as a prominent denomi- Member of The Associated Press Services. Ferry. national leader, served 16 years The Associated Press is exclusively entitled to the use for publication of all news dispatches He is survived by his wife, on the Church of God credited to it or not otherwise credited in this newspaper, and also the local news of spontaneous or igin Mary Wilcox Ferry; sons: Charles International Executive herein. All rights of all other material herein are as reserved. ©2014 Cleveland Newspapers, Inc. Ferry and Michael Ferry; daugh- Committee and 34 years on the SUBSCRIPTION RATES ters: Elizabeth Rogers amd International Executive Council. Renay Long; six grandchildren; Publishser Reserves the Right to Change Rates Without Notice Over the years, he devotedly Print Only 3 months 6 Months 1 Year Monthly Daily seven great-grandchildren; sis- served as a member of the Carrier Collect Rate * $6.75 ter, Eveline Hess; and several boards of the National nieces and nephews. By Carrier Home / Business Delivery $20.00 $38.00 $ 75.00 Association of Evangelicals By Mail inside Zip 307 $ 25.00 $45.00 $ 85.00 The family will receive friends (NAE), National Religious By Mail outside Zip 307 in TN, GA $38.00 $55.00$105.00 from noon to 2 p.m. Saturday, By Mail Outside TN $38.00 $ 67.00 $ 130.00 Broadcasters (NRB), and the Feb. 27, 2016, at Higgins Funeral Pentecostal and Charismatic Print + E-Edition Home in Benton. By Carrier Home / Business Delivery $21.25 $40.25 $ 79.25 Churches of North America By Mail inside Zip 307 $ 26.25 $47.25 $ 90.50 The funeral will follow at 2 p.m. (PCCNA). His civic involvement By Mail outside Zip 307 in TN, GA $40.00$58.00 $ 112.00 in the chapel of the funeral home in United Way, Rotary and the By Mail Outside TN $40.50 $ 71.00 $ 137.00 with the Rev. Robbie Hatcher offi- Chamber of Commerce was Nellie Faye Malone E-Edition Only $26.85 $53.70 $ 107.40 $8.95 $1.95 ciating. exemplary. He authored more Nellie Faye Herron Malone of Interment will be at Friendship than 30 books, was published in Crandall, Ga., passed away Office Hours: Monday-Friday: 8 a.m. - 5 p.m. • 423-472-5041 Baptist Church Cemetery with inspirational magazines, and Tuesday, Feb., 23, 2016, in a military honors and the Rev. John was a contributing writer for Chattanooga hospital following a Cain officiating. numerous publications. While brief illness. and Molly Woolson, Will Cooper, Chattanooga; grandchildren: serving in Washington, he min- She was born April 13, 1937, in Isaiah and Isabella Bayliss, Janessa Nipper of Cleveland, istered within the National Beaverdale, Ga., to the late Grady Gavin and Caroline Swafford, Staff Sgt. Justin and Jennifer Security Council, Department of London and Viola M “Jimmie” and Eli and Simon Sebastian; Officer Williams of Clarksville and Transportation, Justice Herron. and several nieces and Zachary Officer of Cleveland; Department, Coast Guard, She was also preceded in death nephews. great-grandchild, Skyler Nipper; Pentagon and State by her brothers: Vance, Buck and The funeral will be held at 6 special little boys: Noah Mathis Department. In January of 2016, Clyde Herron; and her sister, p.m. Saturday, Feb. 27, 2016, in and Jagger; her dog, Toby; and He was Chaplin of the Day and Rosie Roberts. the chapel of Fike-Randolph & caregiver, Connie Litton. prayed over the Tennessee She was a loving and caring Son Funeral Home with the Rev. The funeral will be held at 11 House of Representatives, and wife, mother, grandmother, great- Tim Bracken officiating. a.m. on Saturday, Feb. 27, 2016, Wilma Grace Disharoon on Monday, February 22, 2016, grandmother, sister and aunt. She Interment will be held at 10:30 in the chapel of Ralph Buckner was a very active member of a.m. on Tuesday, March 1, 2016, Funeral Home. Wilma Grace Disharoon, 78, the Tennessee House of Representatives paused for a Fairview Church. in Chattanooga National Interment will follow in Sunset passed away Wednesday, Feb. She is survived by her husband Cemetery with Eddie Harris, Memorial Gardens. 24, 2016, at her home in moment of silence to honor the Life and Ministry of Dr. T.L. of 63 years, Charles Edward Micah Harris, Charlie Gilliland, The family will receive friends Cleveland. Malone; her sons and daughters- Michael Bunch, Gale Housley from 5 to 8 p.m. today, Feb. 26, She was born Nov. 14, 1937, to Lowery. During a lifetime of dedicated in-law, Wayne and Robin Malone and Halen Housley serving as 2016, at the funeral home. the late Theodore and Elizabeth of Biloxi, Miss., David and Kim pallbearers. We invite you to send a mes- Kersey. Christian service, his example of anointed ministry leadership Malone of Crandall, Ga.; her A white dove release ceremo- sage of condolence and view the She loved music, particularly brothers: Billy Herron and ny will conclude the service. Nipper family guestbook at Alan Jackson and Elvis. She also has inspired thousands of young ministers and influenced Waymon Herron of Cleveland; Her family will receive friends www.ralphbuckner.com. enjoyed playing the lotto and trav- grandchildren and their families: from 4 to 6 p.m. on Saturday at eling to her beach home in countless laypersons. The lega- cy of T.L. Lowery’s ministry will Joshua and Sarah of Crandall, the funeral home prior to the Florida. Kristen and Eric Minda of St. service. Along with her parents, she is reveal his passion for evangel- ism, commitment to the Holy Louis, Zachary Malone of We invite you to send a mes- preceded in death by her son, Crandall, Cody and Dara Malone sage of condolence and view the Roger Disharoon; three brothers: Spirit, dedicated to divine heal- ing and his apostolic ministry. of Sheppard AFB Texas, Jason Morton family guest book at Roy, Kenneth and Billy Kersey; Malone of Biloxi; great-grandchil- fikefh.com. and sister, Ruth Ann Suggs. His commitment to mentoring future leaders led him to start dren: Kaitlyn, Derrick, Addison Annette Postelle Pack She is survived by her husband and Braylee; and her loving broth- the T.L. Lowery Global Annette Postelle Pack, 80, of of 56 years, James W. ers- and sisters-in-law, nephews Foundation, whose goal is to Calhoun and formerly of Disharoon; son, Stacy (Tammy) Thomas Lanier Lowery and nieces. encourage effective ministry in Chatsworth, Ga., passed away Disharoon; daughter, LeAnn Dr. T.L. Lowery, an Apostolic A Remembrance of Life service the model of this faithful ser- Wednesday, Feb. 24, 2016, at (Donald) Swafford; sisters: Patsy Statesman, 87, died peacefully will be held 2 p.m. Saturday, Feb. vant. Through periodic training her residence. (Ronald) Williams and Betty in his home on Sunday, Feb. 21, 27, 2016, at Berean Baptist events, he mentored and coun- She was born on Feb. 15, (Donald) Smith; grandchildren: 2016. Church on Spring Place Road in seled leaders — both present 1936, in Polk County to the late Cassie Disharoon, Haleigh His son, Steve, and his Cleveland with Pastor Roger and future — for effective min- Marvin and Maudie Lowe (Justin) Knight, Lauren daughter-in-law, Jan, were at Wagoner, the Rev. Wayne Malone istry. His apostolic ministry will Postelle. Disharoon, Andrea Swafford and his side as he transitioned into and the Rev. David Evans officiat- be felt for years to come within She had lived the past 30 Racheal Keith; and great- grand- his heavenly home. When he ing. the Church of God and the years in Chatsworth, before children: Aubrey and Gavin Reed, greeted his savior Jesus, you The interment will follow in the Pentecostal/Charismatic world. recently moving back to Calhoun. Madilyn Knight, Aiden Swafford, could almost hear, “Well Done Mount Pleasant Cemetery in T.L., as he was affectionately She was of the Baptist faith Brianna, Hunter and Bailey Keith. Thou Good and Faithful Whitfield County with Joshua known, was preceded in death and enjoyed flowers, singing, The family will have a private Servant”. Malone, Kristen Minda, Zachary by Mildred, his beloved wife of and spending time with family memorial service at a later date. He was born Jan. 12, 1929, in Malone, Dara Malone, Jason 66 years; his parents, Otis and and friends. You are invited to share a per- Eastman, Ga. Thomas Lanier Malone, Gary Herron and Hettie Lowery; Mary Williams, In addition to her parents, she sonal memory of Wilma or your Lowery was one of six children Maynard Herron serving as cas- his eldest sister; and his broth- was preceded in death by her condolence with her family at her with a family heritage steeped in ketbearers; Her nephews will ers: Aubrey, Egbert (Ed) and sisters: Wanda Green, Evelyn online memorial located at the Pentecostal tradition. He serve as honorary casketbearers. Maxwell. Poteet, Catherine Breeden, www.companionfunerals.com. came to a saving knowledge of The family will receive friends He is survived by his son and Barbara Stoops, and Naomi Companion Funeral and Jesus Christ on New Year’s Day this evening from 5 until 9 p.m. at daughter-in-law, Stephen and Shell. Cremation Service and the Cody 1943. By 1954, he had pastored the North Ocoee Chapel of Jim Janice Lowery; grandchildren: She is survived by her hus- family are honored to assist the four congregations; married his Rush Funeral and Cremation Aimee (Steve) Smith, Stephanie band, Cliff Pack of Calhoun; Disharoon family with these sweetheart, Mildred Woodard, Services. (Ian) Gibson, Jon (Lisa) Lowery, daughter, Bridgette Hammons arrangements. and welcomed their son, We encourage you to share Michael (Katrin) Lowery; 10 and husband, Joe, of Riceville; Stephen Lanier, into their lives. your memories and or condo- great-grandchildren: Mya, Jack, son, Winston Merrell and wife, While in Galax, Va., restless lences with the family by going to Justin Smith, Jenna, Jacob, Carol, of Calhoun; sisters: Peggy in his spirit, he felt compelled to www.jimrushfuneralhomes.com. Peyton Gibson, Kelsey Cyree and husband, David, of fulfill the mantle of full-time The Malone family would like to Snowden, Noah and Abigail Riceville, Quendyln Shell of evangelism. To make ends express their gratitude to family Billie Rymer Nipper Lowery, and Allister Lowery; his Greasy Creek, Sandy Maron and meet, he sold Kirby vacuum and friends, Murray County EMS Billie Rymer Nipper, a resident sister, Aileen Elliott; brothers-in- husband, George, of Michigan; cleaners on the side. He was so and paramedics, Life Force and of Cleveland, passed away law: Kenneth (Marcia) and brother, Jack “Buddy” Postelle of successful, Mr. Kirby himself the Erlanger Medical team for their Wednesday, Feb. 24, 2016, at her Harvey Woodard, sister-in-law, Greasy Creek; grandchildren: offered him $100,000 a year (in awesome support, kind words, home surrounded by her loving Ruth Hall; and many family David Hammons and wife, Mary, the early 1950’s) and most of thoughts and prayers during this family. members of the Lowery and of Riceville, Zabrina Hammons of the eastern coast as a territory. difficult time. She was also known for her Woodard families. Polk County, Samantha Woods Torn by this, he fasted and Dr. Lowery was served faith- beautiful artwork and annual craft prayed alone for 21 days. show, Nillie Bipper. and husband, Marcus, of fully and tirelessly by his niece, Riceville, Crystal Hammond and During the last days of the fast, Barbara Mitchell, for the last 10 She was a member of First God said to him, “I didn’t call Baptist Church in Cleveland. husband, Patrick, of Englewood, years of his life. Tabitha Yearwood and husband, you to be a salesman, I called TO GOD BE THE GLORY! She was a charter member of you to preach the gospel.” He the Cleveland Creative Arts Guild Daniel, of Tellico Plains, Dwight A Remembrance of Life serv- Merrell and wife, Amy, of Etowah, resigned his position and lived ice will be held on Monday, Feb. and a chairperson to major art by faith in God ever since. shows like the Spring Arts Festival Shawna Reigelsperger of 29, 2016, at 6 p.m. from the Etowah, Gabriel Coker of Dalton, From 1954, through 1969, National Church of God in at the Village Mall, for 20 years, were years of divine appoint- and Nillie Bipper, for 46 years. Her Brady Coker of Chatsworth, Washington, D.C. He may be Miranda Coker of Calhoun; ments across the nation and viewed from 5 until 6 just before accolades include, The around the globe for evangelist Tennessee Walking Horse Hall of great-grandchildren: Joshua the service on Monday in Green of Englewood, Mia Lowery. Traveling with a tent Washington, D.C., at the Fame, Honorary Member of the that could accommodate 10,000 Georgia Walking Horse Hammond of Englewood, Katie church. The family will receive Yearwood of Tellico Plains, Alex worshipers, he followed God’s friends from 4 until 7 p.m. on Association, Honorary Member of guidance with crusades in over the Tennessee Walking Horse Yearwood of Tellico Plains, Sunday, Feb. 28, 2016, at the Kayley Thomas of Charleston, 115 nations and every state in National Church of God in Auxiliary and The Tennessee the U.S.A. The name T.L. Walking Horse Trainer Friendship Braxton Thomas of Calhoun, Washington D.C. Steven Merrell of Calhoun, Lowery was synonymous with There will also be A Club. She served as vice presi- spiritual power, fire-from-heav- dent of the Tennessee Walking Cameron Merrell of Kentucky, Carolyn Nell Duncan Remembrance of Life service Carlie Reigelsperger of Carolyn Nell Duncan, 54, a res- en sermons and miraculous held here in Cleveland on Horse Booster Club for one year, healings. Summers included and she was inducted into the Englewood, Zachary Chrisman of ident of Cleveland, went to be with Thursday, March 3, 2016, at 11 Polk County , Elias Hammons of her Lord and Savior on week after week of ministry at a.m. from the North Cleveland Bradley County Agricultural Hall Church of God camp meetings. of Fame. She also served on the Riceville, Summer Woods Wednesday, Feb. 24, 2016. Church of God. He may be Cleveland , Adley Woods of She was born in Centerville, Testimonies were from thou- viewed from 10 until 11 a.m. just Board for The Tennessee Walking sands whose lives have been Horse National Museum. Cleveland; great-great-grand- Ala., a daughter of the late before the service on Thursday child, Blakley Green of Haywood and Ila Duncan, on forever changed — physically here in Cleveland at the church. She has had her art collection and spiritually — and continue displayed in all 50 states and in Englewood; and several nieces, January 9, 1962. The family will receive friends in nephews, and other extended She leaves behind to cherish to characterize the anointed Cleveland on Wednesday, several countries internationally. ministry of T.L. Lowery. She was a featured artist at the family members. her memory one daughter, Laura March 2, 2016, from 4 until 8 The funeral will be held at 2 Duncan; several siblings and their In 1969, he became the sen- p.m. at the T. L. Lowery Ministry 1982 World’s Fair in Knoxville and ior Pastor of the historic North Nell Morton had the privilege to do a portrait of p.m. Saturday, Feb. 27, 2016, spouses; and numerous other Center. from the chapel of Serenity Cleveland Church of God (1969- Nell Morton, 95, of Cleveland, her work for President Ronald extended family members, her Officiating clergy will be Funeral Home in Etowah with 1974), one of the oldest continu- passed away Wednesday, Feb. Reagan, ZsaZsa Gabor, Shania church family, and a host of spe- Pastor Mitch Maloney, Dr. Brother Vernon Webb officiating. ing Pentecostal churches in the 24, 2016, at her home. Twain and many more. Her art cial friends. Dennis McGuire, Dr. Mark Interment will follow in the world. He accepted this call of She was an avid bridge player, work has been reproduced on A memorial service is planned Williams, Dr. Stephen Lowery Archville Baptist Church God and built a new, modern a member of the Garden Club weavings, albums, music boxes, for Saturday, Feb. 27, 2016, at 11 and the Rev. George Cemetery. 1,200 seat auditorium. This lat- and the Mae Dooley Circle. She pottery and prints. She has done a.m. at the Hopewell Church of Henderson. The family will receive friends est building was completed was also a member of the First murals for churches and a paint- God, 5765 Eureka Road NW, with Entombment service will be from 5 to 8 p.m. today, Feb. 26, under Pastor Mitch Maloney in United Methodist Church. Her ing for E.L. Ross Elementary Brother George Warren officiating. held privately for the family. 2016, and from 1 p.m. until the 2005. During his pastorate, he family was very important to her. School. She was also commis- The family will receive friends at The family request that in lieu funeral hour on Saturday at the also built the North Cleveland She was preceded in death by sioned by Gov. and Mrs. Bill the church from 10 until the 11 of flowers memorials be made funeral home. Towers, a senior citizens apart- her parents, Thomas and Flossie Haslam to do a Christmas orna- a.m. service time. to the T.L. Lowery Global Online condolences may be ment complex. Herrington Morgan; husband, ment representing Bradley You are encouraged to share a Foundation, P. O. Box 2550 sent to www.serenityfunerals.com. memory of Carolyn and/or your He was elected to the Church Cleveland, TN 37320. James E. Morton; daughter, County for the Governor’s personal condolences with her of God International Executive The Jim Rush Funeral and Shann Robinson; and several Mansion. Most recently her art- family by visiting her memorial Committee in 1974, and Cremation Services North brothers and sisters. work was featured on a small web page and guestbook at remained in that position until Ocoee Chapel has charge of the Survivors include her daughter, painting done for a dollhouse at www.companionfunerals.com. 1981. This was the year God arrangements. You may share Penny Bunch of Cleveland; son- St. Jude’s Children’s Hospital. Companion Funeral Home and quickened his spirit and placed your condolences and your in-law, Hugh Robinson of She was preceded in death by the Cody family are honored to a burden on his heart for the memories with Dr. Lowery’s Cleveland; six grandchildren: her husband, J.L. Nipper; parents, assist the Duncan family with her nation’s capital — a church in family at www.jimrushfuneral- Beth (Sam) Cooper and Amy Ina Mae Arthur and John Ernest arrangements. Washington, D.C. During his homes.com. (Kevin) Woolson, all of Mason, Rymer; and brothers and sisters, pastorate in Washington (1981- Ohio, Melanie (Tom) Bayliss of Lt. Col. Carl Rymer, Ralph Rymer, 1996), his leadership placed the Athens, Michael (Shirley) Bunch Frances Kibler, Mamie MORE OBITS, National Church of God on a of Cleveland, Michelle (Matthew) Stephenson and Sue Bivens. trajectory that would catapult its Swafford of Delano, and Mindy She is survived by her children; influence in and around the (André) Sebastian of Perry, Ga.; Joel Nipper and wife, Patrice, of PAGE 3 nation’s capital, guiding the con- nine great-grandchildren: Charlie Cleveland, and Jeanna Nipper of www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 3 BITUARIES Member of Top Ten Most Wanted O is captured by the Sheriff’s Office Beecher Gene Payne From Staff Reports failure to appear on theft over Top Ten these past 12 months.” Beecher Gene Payne, 84, of A member of Bradley County’s $1,000, possession of drug para- The percentage of those on the Cleveland, became cancer free Top Ten Most Wanted has been phernalia and resisting arrest. list taken into custody since when he walked into the loving captured through the combined He was listed among the Top February of last year is some 85 arms of Jesus on Tuesday, Feb. efforts of the Bradley County 10 that is featured in the Banner percent. 23, 2016. Sheriff’s Office and the Cleveland each week. Bradley County’s Top Ten He was a highly-decorated Daily Banner. “Once again, our teaming up Most Wanted is published in the honorably-discharged veteran Jason William Lunsford was with the Cleveland Daily Banner Cleveland Daily Banner every of the United States Army after has resulted in a Top Ten Most Tuesday. You can also access the faithfully serving his country taken into custody by a deputy during both the Korean and with the Bradley County Sheriff’s Wanted member going to jail,” list at www.bradleysheriff.com. Vietnam wars. He loved the out- Office. Lunsford was wanted on a Watson said. “I sincerely appreci- It’s also available on the Mobile doors, camping, fishing and Jason Lunsford number of charges, including ate the Banner’s publishing the Patrol phone application. hunting. He will be greatly missed by those who truly knew him. Live! Saturdays at There to meet him at Heavens Cleveland Middle School open 10:00 a.m. gates was his son, Gene Payne; Mom and Dad, Rosa and Gay Payne; sisters: Geneva Massey, Opal Payne and Barbara Payne; after bomb threat on Thursday and brothers: Paul Payne, Jerry (JC) Payne and Dean Payne. From Staff Reports Department. school was declared safe, According to Sgt. Evie West, according to Cleveland City He leaves to cherish his mem- Classes were being held as woopfm.com ory, his children: Donna Payne, Lola Underwood CPD public information officer, Schools officials. Lola Cordelia Withrow scheduled today at Cleveland Mitchell Payne, Linda Payne, Middle School after no explosive the agency was notified around Detective Daniel Gibbs of the OLD TOWN Glenda Payne, Ronald Underwood, 78, a resident of 5 p.m. of the threat. CPD reportedly spoke with the device was found following a Wilkerson and Greg Payne; Cleveland, went home to be with CPD officers responded to the juvenile, a CMS student, who CLEVELAND brothers: Ted Payne, Marion the Lord, Tuesday evening, Feb. Thursday afternoon bomb threat 23, 2016. scene, as did responders from reportedly made the false threat. Hosted by Ron and Debbie Moore (Leota) Payne and Dale Payne; at the school. the Tennessee Highway Patrol Charges are pending as investi- and several grandchildren, She was a member of Hopewell The Cleveland City Schools Baptist Church. and Cleveland/Bradley gation into the incident contin- February 27: nieces, nephews, great-nieces system’s Public Relations and great-nephews. She was preceded in death by Emergency Management ues. Charleston Businesses A graveside service will be her husband, James Robert Department said that the school Agency. School was scheduled to take Tune in to 99.9 FM or Underwood; son, Stephen was evacuated for after-school held on Sunday, Feb. 28, 2016, A thorough investigation of place today as normal, and www.WOOPFM.com at 2 p.m. in the Coker Creek Underwood; parents, Charlie and activities, and school officials the school by police found no investigation into the false Church Cemetery in Tellico Pauline Withrow; and brother, notified the Cleveland Police evidence of a bomb and the threat is continuing. Plains with full military honors. Zane Withrow. “In Christ, there are no good- Survivors include her daughter, byes and in Christ there is no Cindy (Darren) Pew; grandsons: end so I’ll hold onto Jesus with Corey and Justin Urban, all of LOTTERY NUMBERS COMING Cleveland; sisters: Bonnie Hunt of Legislature all that I have till I see you SOON! again”. Chattanooga and Juanita (Jim) In lieu of flowers, the family Conway of Cleveland; brother, (AP) — These state lotteries were requests that memorial dona- Larry (Carolyn) Withrow of nullifies local drawn Thursday: tions be made to your local Cleveland; sister-in-law, Linda American Legion in Beecher’s Faye (Bobby) Scott of Ooltewah; Tennessee memory. and several nieces and nephews. hiring plan Cash 3 Evening: 4-5-6, Lucky You are encouraged to share A graveside service will be held Sum: 15 at 1:30 p.m. Saturday, Feb 27, a memory of Beecher and/or Cash 3 Midday: 3-3-1, Lucky your personal condolences with 2016, at Hopewell Baptist Church Cemetery with the Rev. Ed Sum: 7 FAMILY ATMOSPHERE his family by visiting his memori- in Nashville Cash 3 Morning: 1-7-0 al web-page and guestbook at Eldridge officiating. • Italian • Greek www.companionfunerals.com. The family will receive friends NASHVILLE (AP) — The Cash 4 Evening: 8-6-8-4, Lucky from 11 a.m. to 1 p.m. Saturday at Sum: 26 • American Cuisine Companion Funeral Home Republican-controlled state • Full Salad Bar and the Cody family are hon- Ralph Buckner Funeral Home House has given final approval Cash 4 Midday: 4-3-7-0, Lucky ored to assist the family with his prior to the service. Sum: 14 We invite you to send a mes- to a bill nullifying a local hiring arrangements. requirement approved by Cash 4 Morning: 5-6-1-0 423-790-5850 sage of condolence and view the Cash4Life: 02-16-19-33-39, Underwood family guestbook at Nashville voters last year. www.ralphbuckner.com. Supporters say the local hir- Cash Ball: 3 Stuart Rd. Behind Sonic ing requirement discriminates Mega Millions estimated jackpot: against workers living in sur- $125 million rounding counties. Powerball estimated jackpot: The bill sponsored by $266 million Republican Rep. Pat Marsh of Shelbyville was approved on a GeORGIA FREE IT’SASPECIAL 72-20 vote on Thursday after All or Nothing Day: 02-04-05- Hearing Test / Otoscopic Screening Dorothy White the Senate passed the bill earli- 06-09-12-13-15-19-22-23-24 DAY FOR ... Dorothy White, 78, of er this week. All or Nothing Evening: 01-02- National Board Certified Specialist Cleveland, died Thursday morn- The ballot measure that 04-05-07-08-14-15-18-20-22-23 with 30 Years Practicing Experience ing, Feb. 25, 2016, in a local earned 58 percent of the vote in All or Nothing Morning: 03-05- Rita Haynie, Pam Mowery, health care facility. August requires contractors on 06-07-09-12-13-15-17-20-21-24 There will be no public servic- All or Nothing Night: 01-04-06- Denise Hawkins, Karen Hilton, es at this time. public construction projects BEST PRICES & QUALITY ON Kelly Pickel, Jim Metzger and worth more than $100,000 to 08-09-10-11-13-14-15-19-22 Companion Funeral & Cash 3 Evening: 0-6-2 Amanda Nix, who are celebrating Cremation Service along with the assign at least 40 percent of REXTON HEARING AIDS birthdays today ... Jones Cody family were honored to work hours to employees who Cash 3 Midday: 6-8-8 $1200 OFF A SET - IN THE EAR Mahaffey, who is celebrating his assist the White family with her live within the city, and that 10 Cash 4 Evening: 5-8-3-3 70th birthday today ... Kain arrangements. percent go to low-income resi- Cash 4 Midday: 0-2-0-1 OR POPULAR BEHIND THE EAR Brogdon, who turns 20 ... Skye dents. Fantasy 5: 09-10-13-14-18 Gray, Kathy Barnes, Ron Brown, Nashville Mayor Megan Barry Estimated jackpot: $325,000 Jim Thedford and Don Jacobsen, said she was disappointed at Georgia FIVE Evening: 8-3-1-0-2 Make Appointment Today! who will celebrate birthdays the Legislature for “overturning Georgia FIVE Midday: 1-7-1-8-4 CLEVELAND HEARING AID CENTER Saturday. the will of the voters.” Jumbo Bucks Lotto: 01-03-09- 12-38-42 2538 KEITH ST. NW SUITE 8 Estimated jackpot: $2.7 million (COLONY SQUARE PLAZA) Mega Millions estimated jackpot: $125 million 423-478-3085 Powerball estimated jackpot: clevelandhearingaidc.ipage.com Traffic $266 million From Page 1 people are, and I am asking them us solve cases proves to be of to come forward so our city and great benefit. Anyone with this county investigators can make “We treat this as a information is urged to contact arrests,” the sheriff said. “We are serious, violent crime as Detective Andy Ratcliff at the Ta k e A d v a n t a g e fortunate there were no serious this is no different than Cleveland Police Department.” injuries from debris entering the using a firearm or any Watson said anyone with passenger compartments of other weapon. We information is also welcome to these vehicles.” consider the suspects to pass it on to the Bradley County o f O u r Gibson said that this is defi- be dangerous criminals Sheriff’s Office’s Criminal nitely a possibility and that the who will be treated as Investigations Division at 423- person involved apparently does such.” 728-7336. not either care about others’ — Police Chief n The sheriff added that his 2016 safety or is trying to harm Mark Gibson office is also conducting a sepa- another. “It’s unfortunate that a group rate investigation into broken of individuals would find it that some injuries have already windows to several vehicles in N e w Ye a r ’ s entertaining to destroy the prop- been reported. the East Cleveland area, and erty of others,” Gibson said. “We are actively pursuing though they are not believed to “But this is not just an act of these suspects and will follow be related to other vandalism vandalism. Throwing objects every lead in connection with occurring in the city and coun- Special from one moving vehicle into these cases as will the Bradley ty, the incidents are equally another could cause serious Co. Sheriff’s Office investiga- serious. He asked that anyone injury or be fatal.” tors,” Gibson said. “We are look- with any information about the Watson agreed, saying that ing for any information on the incidents call the BCSO not only have there been mount- individuals involved. Our com- Criminal Investigations BREAST ing damages to vehicles, but munity coming together to help Division. AUGMENTATION $3600.00! Call Today For An Appointment
o f C l e v e l a n d (423) 472-1996 Michael L. Hoops, MD Board Certified by The American 597 Church Street NE • Cleveland, Tennessee Board of Plastic Surgery www.hoopsplasticsurgery.com
Anyone can wear a white coat. Not everyone is board certified in plastic surgery. Do your homework! 4—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com Study examines little-known internment camp in Alaska JOINT BASE ELMENDORF- post formerly known as Fort ments at the site, but they were of a welcoming community. RICHARDSON, Alaska (AP) — Richardson. unable to find anything definite- Hikido and her 75-year-old Alice Tanaka Hikido clearly Archaeologists recently ly connected with the camp, sister, Mary Tanaka Abo, are the remembers the bewilderment zeroed in on the site based on Blanchard said. Researchers only surviving members of her and sense of violation she felt documents including a map and believe — but can’t say with cer- family who experienced the 74 years ago when FBI agents the only two known photo- tainty — that the 17 foreign internment. rifled through her family’s graphs, according to Morgan nationals who were sent to the Today, Hikido sees the same Juneau home, then arrested her Blanchard, a local archaeologist post were actually held at the distrust of some foreigners that father before he was sent to who worked on the study. camp, constructed between her family experienced so many Japanese internment camps, “Although it was known that February and June 1945. decades ago. It’s troubling to including a little-known camp in this camp existed — it shows up It was only after her father her to hear politicians whipping pre-statehood Alaska. on all the lists of camps that joined them in Minidoka that up that fear by demonizing cer- The 83-year-old Campbell, existed during the war — no Alice Hikido and her family tain minorities. California, woman recently information was available,” heard his story for the first time, If there’s a lesson to learn, attended a ceremony where par- Blanchard told a small crowd from his apprehension in she said, it’s how crucial it is for ticipants unveiled a study of the during a Feb. 19 Day of Juneau to various internment individuals to arm themselves short-lived internment camp at Remembrance ceremony at the camps including at least one in with knowledge. what is now Joint Base base. “So we filled in a lot of the New Mexico. “It’s incumbent upon citizens Elmendorf-Richardson in blanks.” The family’s time in captivity to be well-informed,” Hikido Anchorage. Researchers discovered forced the closure of her father’s said. “If you’re well-informed, Archaeologists working on the debris such as .30 carbine Juneau cafe. They reopened it then fear doesn’t overcome your research used old records to rounds and barbed wire frag- upon their return, with the help better judgment.” pinpoint the camp location in an area now partially covered by a parking lot. The Army study is expected to be finalized later this year. “As I look back, I had no idea as a child that the U.S. and Japan were having difficulties,” Hikido said. “It was a tremen- dous surprise to me.” Hikido herself was interned at Idaho’s Minidoka camp with her Alice Tanaka Hikido via AP mother, younger sister and two In THIs 1945 PHoTo ProvIded by Alice Tanaka Hikido, mem- brothers a few months after her bers of the Tanaka family stand together at the Minidoka Japanese father’s arrest during one of the internment camp in Jerome, Idaho, where they were held in forced nation’s darkest chapters — the incarceration during World War II. Alice Tanaka Hikido, left, and her forced incarceration of tens of sister, Mary Tanaka Abo, who was the child in the foreground, partic- thousands people of Japanese ipated in a Feb. 19 ceremony at Joint Base Elmendorf-Richardson, ancestry, including Americans, Alaska, that was held to remember the forced incarceration of more during World War II. than 200 Alaskans, as well unveil the results of a study about a little- Her father eventually joined known Japanese internment camp that was erected there during his family in Idaho in 1944. World War II. Also pictured are Nobu Tanaka, back left, John Tanaka, They spent more than a year there together before the war in uniform second from right, standing next to Shonosuke Tanaka. ended and they returned to Juneau. Her father, Shonosuke Tanaka, was among 15 Japanese Man killed when wave nationals and two German nationals who were rounded up in the territory of Alaska almost sweeps 4 into ocean immediately after the Japanese REDONDO BEACH, Calif. (AP) In San Diego, a large section of attacked Pearl Harbor. — A large wave swept four people a cliff collapsed onto Ocean Beach That number would grow to off a Los Angeles County jetty as below Wednesday afternoon. The 104 foreign nationals, mostly high surf pounded much of the parking lot by Sunset Cliffs had Japanese, who were arrested in California coast, leaving one man been fenced off as chunks of sand- Alaska as alien enemies. An dead and his three companions stone had been sloughing off the estimated 145 others, including seriously injured, authorities said. cliff face last week, part of a natu- some Alaska Natives who took Redondo Beach firefighters ral erosion process intensified by Japanese names in marriage, responded late Wednesday after the winter storms. also would be sent to intern- witnesses reported people in the The National Weather Service ment camps outside the territo- water calling for help at King said the high surf subsided by ry under Executive Order 9066, AP Photo Harbor. Thursday night, but warned that a which launched the exile of MArY TAnAKA ABo, left, stands with her sister, Alice Tanaka Hikido, far right, and Susan Churchill, Rescuers pulled two men and similar pattern will return to the about 120,000 Japanese- center, president of the Japanese American Citizens League on Feb. 19, 2016 at Joint Base Elmendorf- two women from the waves at the California coast Friday. Americans. Richardson, Alaska. The women participated in a ceremony on base held to remember the forced incar- base of the rock jetty, said the Beachgoers were warned of dan- Before leaving Alaska, Tanaka ceration of tens of thousands of people of Japanese ancestry in U.S. interment camps during World War city’s Fire Department Operations gerous waves, rip currents and and 16 other men were briefly II, as well as unveil the results of a study about a little-known Japanese internment camp that was erect- Chief Mark Winter. One man was possibly minor flooding. housed at the Anchorage Army ed there. dead at the scene. The three oth- Waves just to the north and ers were hospitalized in serious south of San Francisco could hit condition. 11 feet, while sets topping 18 feet It wasn’t clear why the group are expected along the Central State BOE to formalize teacher discipline policy was on the rocks late at night, but Coast. Waves from 5 feet to 12 feet people routinely fish there, are predicted from Los Angeles to NASHVILLE (AP) — In an Staff attorney Philip Cramer Without a set policy, board others instances in which the according to Winter. He said the San Diego. effort to prevent inconsistent said he will help develop new members said, they have been board had allowed teachers in surf this week was especially high The cause is a large swell gener- punishments, Tennessee Board recommendations that future hamstrung by the standards set similar scenarios to be either and people were warned to stay ated by a storm off Northern of Education members are seek- board members can use when by previous boards. reinstated or apply for reinstate- away. California. ing to formalize a teacher disci- deciding how to punish teachers In the case of James Aaron ment. “You get one wave every three or Authorities say swimmers plinary policy. found guilty of wrongdoing. The Swafford, the Tennessee board “This is developing a new four minutes,” Winter told the should watch the waves before The board affirmed support board’s executive staff hopes to decided not to reinstate his precedent with a matrix that Daily Breeze newspaper entering the water or ask life- last week for punishment guide- present a draft for first reading license after North Carolina offi- says ‘This is what it means to be (http://bit.ly/21jXCpS). “They feel guards for advice. lines after a recent investigation in April. cials revoked it because of love a professional educator in they can get out and that’s just Meanwhile, Southern by the USA Today Network and Board member Wendy Tucker letters to a 16-year-old student. Tennessee,’” Tucker said. not the case.” California’s winter heat wave con- The Tennessean showed flaws in said she hopes the formal docu- Swafford’s attorney, however, —- A wave knocked a Harbor Patrol tinues due to a high pressure the teacher background check ment will help create clear guide- was able to get the decision Information from: The officer into the water during the ridge. Downtown Los Angeles hit system, the newspaper reported lines and tougher punishments overturned when he demon- Tennessean, http://www.ten- rescue. He was not hurt. 83 degrees on Thursday. (http://tnne.ws/24rIUw1). than have been set in the past. strated that there have been 20 nessean.com
THE MARKET IN REVIEW DAILY NASDAQ DAILY DOW JONES MONEY RATES CURRENCIES Last Pvs Wk Day Ago Pvs Day Nasdaq composite 4,600 Dow Jones industrials 16,720 Prime Rate 3.50 3.50 Australia 1.3805 1.3886 Discount Rate 1.00 1.00 Britain 1.3977 1.3913 Close: 4,582.21 4,400 Close: 16,697.29 16,100 Federal Funds Rate .25-.50 .25-.50 Canada 1.3524 1.3728 Change: 39.60 (0.9%) Change: 212.30 (1.3%) Treasuries Euro .9059 .9077 1.17 1.20 Japan 112.81 111.65 4,200 10 DAYS 15,480 10 DAYS 5-year 5,400 18,000 10-year 1.72 1.74 Mexico 18.1134 18.1844 30-year 2.57 2.61 Switzerlnd .9890 .9879 17,500 Gold (troy oz.,NY Merc spot) $1238.20 $1226.10 British pound expressed in U.S. dollars. All others 5,100 Silver (troy oz., NY Merc spot) $15.165 $15.427 show dollar in foreign currency. 17,000 4,800 16,500 MUTUAL FUNDS Total Assets Total Return/Rank Pct Min Init 4,500 16,000 Name Obj ($Mlns) NAV 4-wk 12-mo 5-year Load Invt American Funds AmBalA m MA 48,214 23.34 +2.8 -2.9/A +8.5/A 5.75 250 15,500 American Funds CapIncBuA m IH 66,929 55.28 +3.7 -7.1/A +5.9/A 5.75 250 4,200 AFS ONDJ AFS ONDJ American Funds CpWldGrIA m WS 49,538 40.79 +2.1 -12.1/C +5.1/B 5.75 250 American Funds FnInvA m LB 42,264 48.07 +3.5 -5.8/A +8.9/C 5.75 250 American Funds GrthAmA m LG 68,237 37.98 +1.7 -7.4/B +9.2/C 5.75 250 American Funds IncAmerA m MA 68,651 19.85 +3.7 -6.2/B +7.2/A 5.75 250 STOCK MARKET INDEXES STOCKS OF LOCAL INTEREST American Funds InvCoAmA m LB 52,513 32.39 +4.7 -7.3/B +9.2/C 5.75 250 52-Week Net YTD 12-mo YTD YTD American Funds NewPerspA m WS 34,767 33.14 +0.7 -7.9/A +6.5/A 5.75 250 High Low Name Last Chg %Chg %Chg %Chg Name Div Yld PE Last Chg %Chg Name Div Yld PE Last Chg %Chg American Funds WAMutInvA m LV 47,650 37.16 +5.0 -6.0/A +10.3/A 5.75 250 18,351.36 15,370.33 Dow Industrials 16,697.29 +212.30 +1.29 -4.18 -8.33 Dodge & Cox Income CI 43,367 13.28 +0.3 -1.7/E +3.4/C NL 2,500 9,214.77 6,403.31 Dow Transportation 7,369.58 +78.70 +1.08 -1.85 -18.86 AT&T Inc 1.92 5.1 16 37.37 +.27 +8.6 iShEMkts .84 2.8 ... 30.36 +.10 -5.7 Dodge & Cox IntlStk FB 51,575 31.85 -0.6 -26.2/E -0.6/D NL 2,500 BB&T Cp 1.08 3.3 12 32.49 +.49 -14.1 Kroger s .42 1.1 20 39.46 +.76 -5.7 631.00 539.96 Dow Utilities 637.80 +7.60 +1.21 +10.38 +7.40 Dodge & Cox Stock LV 50,943 151.13 +3.9 -12.3/D +8.7/B NL 2,500 BkofAm .20 1.6 9 12.32 +.19 -26.8 Lowes 1.12 1.6 21 68.70 +.08 -9.7 11,254.87 8,937.99 NYSE Composite 9,625.28 +119.21 +1.25 -5.11 -13.15 Fidelity Contra LG 73,007 92.21 +2.3 -4.6/A +10.3/B NL 2,500 B iPVixST ...... 24.16 -.86 +20.2 MktVGold .12 .6 ... 19.39 +.28 +41.3 Fidelity ContraK LG 29,923 92.15 +2.3 -4.5/A +10.4/B NL 0 5,231.94 4,209.76 Nasdaq Composite 4,582.21 +39.60 +.87 -8.49 -8.13 ChesEng ...... 2.56 -.13 -43.1 NorflkSo 2.36 3.2 14 73.67 -.27 -12.9 947.85 809.57 S&P 100 869.61 +9.46 +1.10 -4.59 -6.37 CocaCola 1.40 3.2 25 44.16 +.25 +2.8 Olin .80 5.3 13 15.03 -.03 -12.9 Fidelity Spartan 500IdxAdvtg LB 48,827 68.82 +4.3 -5.7/A +10.4/A NL 10,000 2,134.72 1,810.10 S&P 500 1,951.70 +21.90 +1.13 -4.51 -7.53 CocaCE 1.20 2.4 21 50.10 +.63 +1.7 PaneraBrd ...... 35 205.02 -.62 +5.3 FrankTemp-Franklin IncomeA m CA 41,656 2.01 +3.1 -13.4/E +3.4/C 4.25 1,000 1,551.28 1,215.14 S&P MidCap 1,334.29 +14.53 +1.10 -4.60 -11.78 CmtyHlt ...... 8 15.21 +.07 -42.7 Pfizer 1.20 3.9 18 30.59 +.57 -5.2 FrankTemp-Templeton GlBondAdv IB 27,462 10.93 -1.6 -8.5/E +1.6/B NL 0 22,537.15 18,462.43 Wilshire 5000 19,998.52 +219.13 +1.11 -5.52 -10.23 CSVLgNG rs ...... 88 -.09 -63.9 RegionsFn .24 3.2 11 7.51 +.09 -21.8 Harbor IntlInstl FB 35,375 56.02 +2.4 -15.0/C +0.6/C NL 50,000 1,296.00 943.09 Russell 2000 1,031.58 +9.50 +.93 -9.18 -16.75 CSVLgCrd rs ...... 1.67 +.11 -57.7 S&P500ETF4.13 2.1 ... 195.54 +2.34 -4.1 T Rowe Price GrowStk LG 35,670 48.39 +0.2 -6.6/B +11.2/A NL 2,500 DirDGldBr ...... 4.26 -.20 -74.2 Scotts 1.88 2.7 24 69.03 +1.05 +7.0 Vanguard 500Adml LB 146,311 180.64 +4.3 -5.7/A +10.4/A NL 10,000 DukeEngy 3.30 4.3 18 76.44 +1.49 +7.1 SouthnCo 2.17 4.4 18 49.36 +.38 +5.5 Vanguard HltCrAdml SH 36,605 84.23 -1.7 -4.8/A +18.4/B NL 50,000 ARKET UMMARY AND ASDAQ Eaton 2.28 4.0 14 57.28 +.48 +10.1 SPDR Fncl .46 2.2 ... 21.17 +.29 -11.2 Vanguard IntlStkIdxAdm FB 35,932 22.45 +1.8 -16.3/D -0.7/D NL 10,000 M S - NYSE N EgyTrEq s 1.14 16.8 7 6.80 -.37 -50.5 SunEdison ...... 1.72 +.46 -66.2 Vanguard MuIntAdml MI 42,832 14.40 +0.4 +3.9/A +4.9/B NL 50,000 AINERS ($2 OR MORE) OSERS ($2 OR MORE) CTIVES ($1 OR MORE) FstHorizon .24 2.0 14 12.17 +.22 -16.2 SunTrst .96 2.8 9 33.80 +.38 -21.1 Vanguard PrmcpAdml LG 35,771 96.40 +2.3 -7.6/C +11.5/A NL 50,000 G L A FrptMcM ...... 7.12 -.08 +5.2 Target 2.24 2.8 ... 78.67 +1.73 +8.3 Vanguard STGradeAd CS 33,856 10.61 +0.5 +1.2/A +2.2/A NL 50,000 Name Last Chg %Chg Name Last Chg %Chg Name Vol (00s) Last Chg FrontierCm .42 7.9 ... 5.31 +.01 +13.7 UtdCmBks .28 1.6 15 17.13 +.46 -12.1 Vanguard TgtRe2025 TG 28,846 15.13 +2.6 -6.9/C +5.8/A NL 1,000 PowerSec 18.54 +8.67 +87.8 Bankrate 7.28 -5.40 -42.6 BkofAm 1013443 12.32 +.19 GenElec .92 3.1 ... 29.23 +.50 -6.2 US OilFd ...... 8.80 +.21 -20.0 Vanguard TotBdAdml CI 62,206 10.84 +1.3 +1.4/A +3.6/B NL 10,000 KEYW Hld 6.34 +1.70 +36.6 RestorHdw 38.49 -13.43 -25.9 SunEdison 693494 1.72 +.46 HP Inc .50 4.8 9 10.34 -.48 -12.7 WalMart 2.00 2.9 15 68.04 +.92 +11.0 Vanguard TotIntl FB 73,995 13.42 +1.8 -16.3/D -0.8/D NL 3,000 HomeDp 2.76 2.2 23 126.86 +1.25 -4.1 Whrlpl 3.60 2.4 13 151.87 +.59 +3.4 TOP Ship rs 2.80 +.75 +36.5 PHH Corp 8.83 -3.06 -25.7 Pfizer 511236 30.59 +.57 Vanguard TotStIAdm LB 120,312 48.26 +4.1 -7.7/C +9.9/B NL 10,000 iShJapan .13 1.2 ... 11.07 +.13 -8.7 WhitingPet ...... 3.53 -.19 -62.6 Navios pfG 3.38 +.73 +27.5 PatriotN n 4.54 -1.57 -25.7 EgyTrEq s 476508 6.80 -.37 Vanguard TotStIdx LB 92,592 48.24 +4.1 -7.7/C +9.7/B NL 3,000 Vanguard WellsIAdm CA 28,923 59.82 +2.9 +0.4/A +7.4/A NL 50,000 EnerNOC 6.39 +1.37 +27.3 SummitMP 12.37 -3.61 -22.6 FrontierCm 396467 5.31 +.01 Stock Footnotes: g = Dividends and earnings in Canadian dollars. h = Does not meet continued-listing standards. Vanguard WelltnAdm MA 65,584 62.12 +3.2 -4.2/A +7.8/A NL 50,000 LendgTree 85.50 +15.56 +22.2 Eco-StimE 2.42 -.53 -18.0 ChesEng 392552 2.56 -.13 lf = Late filing with SEC. n = New in past 52 weeks. pf = Preferred. rs = Stock has undergone a reverse stock split of at least 50 percent within the past year. rt = Right to buy security at a specified price. s = Stock has split by at least 20 per- Vanguard WndsIIAdm LV 28,605 56.23 +4.4 -10.5/C +8.7/B NL 50,000 DiamdRsts 23.21 +4.10 +21.5 Unit 4.41 -.97 -18.0 GenElec 353909 29.23 +.50 cent within the last year. un = Units. vj = In bankruptcy or receivership. wd = When distributed. wi = When issued. wt = CA -Conservative Allocation, CI -Intermediate-Term Bond, CS -Short-Term Bond, FB -Foreign Large Blend, IB -World Bond, WLyonHm 10.81 +1.87 +20.9 ArgosTher 3.56 -.77 -17.8 HP Inc 351625 10.34 -.48 Warrants. Mutual Fund Footnotes: b = Fee covering market costs is paid from fund assets. d = Deferred sales charge, IH -World Allocation, LB -Large Blend, LG -Large Growth, LV -Large Value, MA -Moderate Allocation, MB -Mid-Cap Blend, Metaldyne 14.24 +2.32 +19.5 SkySolar 2.69 -.54 -16.7 FrptMcM 349706 7.12 -.08 or redemption fee. f = front load (sales charges). m = Multiple fees are charged. NA = not available. p = previous day’s MI -Muni National Intermediate, SH -Health, TE -Target Date 2016-2020, TG -Target Date 2021-2025,WS -World Stock, Total net asset value. s = fund split shares during the week. x = fund paid a distribution during the week. Return: Chng in NAV with dividends reinvested. Rank: How fund performed vs. others with same objective: A is in top 20%, EnPro 50.99 +7.72 +17.8 Relypsa 14.24 -2.54 -15.1 WhitingPet 340364 3.53 -.19 Source: The Associated Press. Sales figures are unofficial. E in bottom 20%. Min Init Invt: Minimum $ needed to invest in fund. Source: Morningstar. www.edwardjones.com Member SIPC 230 1596 Clingan 2080 Chambliss 3858 Candies 112 Stuart 1053 Peerless 3575 Keith Edward ones N. Ocoee St. Ridge Dr. Ave. NW, Creek Ln. Rd. NE, Crossing St. NW J 476-9143 476-0162 Suite 1 Suite C Farmland Corner 339-2885 Suite 201 MAKING SENSE OF INVESTING 472-6814 476-3320 476-4325 476-0190 www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 5 Apple: FBI seeks ‘dangerous power’ in fight over phone WASHINGTON (AP) — In its the company warned in a memo vidual device” and get a judge’s and self-destruct security proto- weeks in a new “hyper-secure rial on millions of iPhones, the first salvo in a court fight that submitted to Magistrate Sheri approval. cols so that it can repeatedly and isolation” room. attorneys state. pits digital privacy rights against Pym in California that aggres- The court fight is set on new quickly test passcodes in what’s The order would “effectively Apple compared forcing it to national security, Apple Inc. sively challenges policy justifica- ground that could create mean- known as a brute force attack require Apple to create full-time create software that doesn’t exist asked a federal magistrate to tions put forward by the Obama ingful precedent and establish without risking loss of the positions in a new ‘hacking’ to weaken the iPhone’s locks to reverse her order forcing the administration. new legal boundaries on how phone’s data after 10 tries. department to service govern- forcing a journalist to publish company to help the FBI hack “The government says: ‘Just technology is dealt with in the In court papers, Apple deri- ment requests and to develop false information to arrest a fugi- into a locked iPhone. this once’ and ‘Just this phone.’ national security context when sively called the specialized soft- new versions of the back door tive or forcing another software The Thursday filing — a day But the government knows those encrypted devices increasingly ware the FBI requested software every time iOS changes” company to implant a virus in a before its formal objection was statements are not true,” lawyers proliferate and so many of the “GovtOS,” a play off the formal plus those engineers would likely customer’s computer so the gov- due and as FBI Director James for Apple wrote. overarching laws governing their name for its iOS operating soft- have to testify as government ernment could eavesdrop. It Comey defended the FBI stance The locked iPhone 5C in ques- use are antiquated. ware for iPhones and tablets. witnesses in trials. argued that such a precedent on Capitol Hill — accused the tion was a work phone linked to Over the last year, law enforce- Apple, which must convince Plus, “if the new operating sys- could lead to many other poten- federal government of seeking Syed Farook, who with his wife ment officials have spoken out Pym that the order is an “unrea- tem has to be destroyed and tially more invasive requests. “dangerous power” through the Tashfeen Malik, killed 14 people about their inability to access sonable burden,” argues that her recreated each time a new order Attorneys for Apple also courts and of trampling on the in a Dec. 2 terror attack in San encrypted data. In the California order expands judicial power and is issued, the burden will multi- argued that forcing Apple to use Cupertino-based company’s con- Bernardino, California, which case, the phone was found after is a political issue that Congress ple,” the filing states. its cryptographic signature to stitutional rights. was at least partly inspired by investigators searched a car with should decide. Apple’s attorneys Apple’s attorneys said “there validate the code so that Farook’s The arguments by Apple attor- the Islamic State group. Two per- a warrant after the attack and also say the legal order is a new are hundreds of demands to cre- iPhone would recognize and neys, outlined a day before the sonal cell phones were found so then couldn’t access the locked expansion of the 1789 All Writs ate and utilize the software wait- accept the new operating system company’s annual shareholders badly destroyed that investiga- iPhone, despite working with Act, which has been used to ing in the wings,” noting would be “compelled speech and meeting scheduled for Friday, tors couldn’t retrieve data from Apple and Farook’s employer. require third parties to help law Manhattan District Attorney viewpoint discrimination” and built upon those voiced by the them. Comey reiterated to lawmakers enforcement in investigations. A Cyrus Vance, who’s said his violate the First Amendment. company’s chief executive and Justice Department lawyers Thursday that the government federal magistrate in New York office has 175 iPhones it can’t Prior court precedent has treated supporters in the last week and were reviewing Apple’s brief and owed it to victims’ families to remains poised to rule on open. Apple is opposing requests computer code as speech and set the stage for a prolonged fight will respond, said spokeswoman conduct a thorough investiga- whether the catchall law has the to help extract information from Apple’s attorneys say that the with legal arguments that may Melanie Newman. She said Apple tion. Some family members and power to force Apple to bypass 14 Apple devices in California, government is forcing Apple to take the issue as far as the had reversed “its long-standing” survivors of the attack have said security protocols on its behalf in Illinois, Massachusetts and New speak on its behalf through code, Supreme Court. cooperation with government they’ll be filing a brief in support a drug case. York. adopting a security and privacy The Justice Department is requests, and that when Justice of the government’s position. Apple states in its filing that Should Apple not destroy the viewpoint the company does not proposing an unprecedented and Department officials want to Pym directed Apple to help the creating the new software would new operating system, it would support. “boundless interpretation” of the search a phone or another elec- FBI hack its phone by creating require “significant resources have to protect it from “crimi- The government’s response is law that, if left unchecked, could tronic device, “we narrowly target specialized software that will let and effort,” forcing it to dedicate nals, terrorists, and hackers” due by March 10. A hearing is bring disastrous repercussions, our request to apply to the indi- investigators bypass time-delay six to 10 engineers for up to four gunning for code to access mate- scheduled for March 22. Cruz lifts hold on Senate bill to resolve Flint water crisis WASHINGTON (AP) — water was treated properly and said. “We’ve got a widespread Republican presidential candi- lead from aging pipes leached national problem and there date Ted Cruz on Thursday lifted into the water supply. should be resources to help a hold he placed on bipartisan Elevated levels of lead have every state in the union.” legislation to address the water been found in some children’s Peters and other supporters crisis in Flint, Michigan, where blood. Lead contamination has said the deal would use federal lead-contaminated pipes have been linked to learning disabili- credit subsidies to provide resulted in an ongoing public ties and other problems. incentives for up to $700 million health emergency. The crisis in Flint has become in loan guarantees and other Senators had reached a tenta- an issue in the presidential cam- financing for water infrastruc- tive deal a day earlier for a $220 paign. Campaigning in Flint on ture projects nationwide. million package to fix and Thursday, Democratic presiden- The bill would be paid for by replace the city’s lead-contami- tial candidate Bernie Sanders redirecting up to $250 million nated pipes, make other infra- said he hopes people will look at from an Energy Department loan structure improvements and the city’s water crisis and say, program approved in the 2009 bolster lead-prevention pro- “Never again.” economic stimulus law. grams nationwide. Hillary Clinton said there are In comments issued after Cruz and at least one other a “lot of Flints” and that she Cruz’s hold became known, GOP senator objected to a quick wants to help them. Flint is a Michael Brune, executive direc- vote on the deal, delaying Senate majority black city, and Clinton tor of the Sierra Club, the THE MUSICAL “Mary Poppins” is being presented by students at Walker Valley High School. consideration of the bill until at questioned whether a similar nation’s largest environmental Here, cast members make their way through one of the show’s memorable songs. The next perform- least next week. A spokesman crisis would have occurred in a organization, said: “Ted Cruz ances take place tonight, Saturday night and Thursday through Saturday, March 3-5. for the Texas senator, Phil “white, affluent suburb of only cares about one thing — Novack, said Thursday night Detroit.” and that’s Ted Cruz. It’s clear that Cruz had reviewed the bill The legislative impasse over that he’ll do anything to promote WVHS to present ‘Mary Poppins’ and will not prevent it from mov- Flint has blocked a bipartisan his own political aspirations ing forward in the Senate. energy bill that had been moving without any regard for what’s Special to the Banner Akiona, who is serving as one of them, but their parents, espe- There was no word on whether forward in the Senate. Under the right for Flint and communities the musical’s directors. “I am cially the stern Mr. Banks, other holds on the legislation tentative agreement, the Senate like Flint across the country.” The Walker Valley High always amazed by what comes insist on someone who is strict had been removed. Earlier would vote on the energy bill School Fine Arts Department is about when we [the directors] and can bring more order to the Thursday, Kristina Baum, a before taking up the Flint legis- currently presenting the musi- have the opportunity to work home. spokeswoman for Sen. James lation as a separate bill. cal “Mary Poppins,” with shows with young people of this cal- When a mysterious young Inhofe, R-Okla., said there were Sen. Gary Peters, D-Mich., tonight, Saturday night and iber." woman named Mary Poppins “a few holds” on the bill. Inhofe said the plan provides $100 mil- three nights in early March. The show takes place in the shows up at their door, the fam- chairs the Senate Environment lion for subsidized loans and People do read The Broadway musical, Danny Coggin Performing Arts ily finds she is exactly what and Public Works Committee grants to any state that declares small ads. which is based on the stories of and was a main architect of the an emergency due to a public Center inside Walker Valley at 7 they need — but in “the most You are reading P.L. Travers and the Walt p.m. tonight and Saturday peculiar way.” She takes the Flint deal. health threat from lead or other Disney film, tells a magical night, as well as Thursday, children on many magical and Baum declined to identify sen- contaminants in its public one now. story centered around the titu- Friday and Saturday, March 3- memorable adventures, but ators who were objecting to the drinking water supply. Call The Banner lar character. bill, but said Inhofe and other “Certainly Flint is an extreme 5. they are not the only ones who 472-5041 Students have been working “Mary Poppins” tells the tale she has a profound effect upon. senators were “genuinely trying example right now, but there are on the production since the of the Banks family, which lives Even adults can learn a les- to work through their concerns.” problems all over the country” beginning of January, working in a big house on Cherry Lane son or two from the nanny who Sen. Lisa Murkowski, R- with lead in aging pipes, Peters on everything from song and in London. advises that “Anything can Alaska, chairwoman of the dance skills to behind-the- Children Jane and Michael happen, if you let it.” Senate Energy Committee, said scenes stage management Banks are “out of control,” and Tickets are available for sale she was optimistic lawmakers skills. the family has found itself in in the main office of Walker could resolve the dispute and “INVEST IN YOUR "It is my great pleasure to need of a new nanny. The chil- Valley. For more information, take up both the Flint bill and a work with this group of talented dren have their own ideas of call the school at 423-336- larger energy package it is tied to students,” said Principal Nat who they would like to care for 1383. next week. COMMUNITY!” Novack declined to specify the nature of Cruz’s concern, but many Republican senators have Historic commission approves homeowners plan said it’s too early to provide funds for Flint without specific By JOYANNA LOVE Callaway asked if they were plan- door to replace the current one, plans from state and local offi- Banner Senior Staff Writer ning to use hardie board that which has three windows in it. cials. Some Republicans also looked like stucco. Ty Cardin City Senior Planner Corey question whether Flint is analo- A house on Centenary Avenue said they were not planning on Divel advised that the couple gous to natural disasters such will be getting a fresh look after that course. might have to go to the board of floods or hurricanes, since the the Historic Preservation Commissioner Joan Benjamin zoning appeals for a variance crisis was the result of a political Commission approved the home- said the homeowners should because of the proximity of the decision. owners’ plans. leave the roof brackets as they fence to the property line. Flint’s drinking water became Ty and Bobbi Cardin wanted to are. A carport is also being added. tainted when the city switched cover the aging stucco on their “That is a big feature of a The Historic District guidelines from the Detroit water system home with hardie plank or shake Craftsman house,” Benjamin allow carports and garages but and began drawing from the siding. said. Ty Cardin said they were have restrictions on garages that Flint River in 2014 to save Commission chair Maryl Elliott considering adding a contrasting can be seen from the street. All money. The impoverished city said hardie board siding would trim if it was allowed. The his- that will be visible of the carport was under state control at the Cleveland Daily Banner be more appropriate because toric commission was more in from the street is the roof. The time. Serving Our Community Since 1854 shake siding was not widely in favor of a trim that was a similar rest will be hidden from view by Regulators failed to ensure the use at the time the house was color to the siding being used. the privacy fence. The roof of the built. Repair work to the foundation carport will match the roof of the “I think shake siding would not and work on the front porch were house. really look right,” Elliott said. also approved. Also during the meeting, the Ty Cardin said he was fine As part of the project, the Historic Commission discussed with using hardie board. He com- Cardins will also be adding a 6- issues with the Codes mented that the stucco was in foot tall privacy fence to close in Enforcement department. disrepair and something needed their backyard and replacing Commissioners talked about to be done to improve the look of their front door. houses where cars were parked the house. Bobbi Cardin explained they in the front yard, which is pro- Commissioner Phyliss would be installing a solid wood hibited in the Historic District. U.S. economy sees modest growth WASHINGTON (AP) — The U.S. The revision was made Still, economists are confident economy’s slowdown in the final because the downturn in busi- that GDP is poised to accelerate three months of 2015 wasn’t ness stockpiling was less severe this quarter. Steady job gains quite as bad as initially thought. than the government’s first esti- and faster wage growth are The gross domestic product, mate. That helped offset slightly boosting consumer spending, the broadest measure of econom- weaker consumer spending. which accounts for more than ic health, grew at an annual rate The latest figure, however, two-thirds of the economy. of 1 percent in the fourth quarter, does little to change the fact that “First-quarter GDP growth is the Commerce Department growth in the final months of on track to rebound to a very reported Friday. That’s an 2015 was modest. Since then, healthy 2.5 percent (rate) which improvement from the first esti- global weakness and financial should dampen any concerns mate of 0.7 percent, though just market turbulence have triggered about an imminent recession,” half the 2 percent growth posted worries about the potential fall- said Paul Ashworth, chief U.S. in the third quarter. out on the U.S. economy. economist at Capital Economics. 6—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com Bellingham Townhomes open house set for Sunday By ALLEN MINCEY just beyond the breakfast nook Banner Staff Writer leads to the outside of the town- home, which features a small Accessibility to just about patio area that would be a won- everything, in a beautiful home derful place to watch the dawn or and growing neighborhood, the the sun go down in the evening. Bellingham Townhomes off Place a couple of small outdoor Urbane Road offer that special chairs and possibly a small table feel a new home doesn’t always there and it would be a perfect have. way to enjoy your coffee or even You can view one of those breakfast or dinner. homes on Sunday, from 2 to 4 The master bedroom is located p.m. during an open house there. off the hallway, and is carpeted, The home to be featured is at Lot so if you get out of bed barefoot, 15B, which is on Belle Chase you’ll feel that coziness as you Way, the first street off Urbane make your way to the rest of the Road if traveling north. home, including the attached It will be easy to see which master bath. home is being featured because The master bedroom also fea- of the flags outside pointing it tures a large walk-in closet. out, but you may not even notice Upstairs, there are two good them at first because you are sized carpeted bedrooms, and a looking at the beautiful exterior full bathroom that connects to of the townhome. the two bedrooms. Both bed- You enter the residence rooms offer ample closet space. through a pretty area which fea- Like all of the bedrooms in the tures stacked stone on the front, home, and the living room and and once inside, your first view is dining room area, there are styl- of the beautiful wooden flooring ish ceiling fans that not only in the living room area. This enhance the beauty of the rooms, flooring is not only featured in but are practical in circulating that room, but in the attached air and helping cool off the rooms kitchen, dining room and break- when it gets to summer. fast nook area. The townhome has central The kitchen includes granite heat and air, all electric, and is countertops, which are also connected to the public sewer placed in the bathrooms in the system. home. Whirlpool appliances — The outside of the entrance is range, microwave oven and dish- Banner photo, ALLEN MINCEY landscaped beautifully. THE FRONT OF THE home has a small landscaped area perfect washer — are in the kitchen, as The townhome is located in an is beautiful custom cabinetry. area accessible to many parts of for small shrubs or flowers. An island for preparing meals Cleveland. It is just up the road or even sitting at, if you have from the Cleveland Family barstools, is in the kitchen. It YMCA, the county farmer’s mar- Banner photo, ALLEN MINCEY offers plenty of drawers for sil- ket and the baseball complex. THE BELLINGHAM TOWNHOMES are beautiful on the inside YOUR ONE STOP SOURCE FOR ALL YOUR verware, etc. Urbane Road connects with and beautiful on the outside, and very welcoming to visitors. PLUMBING & LIGHTING NEEDS A window at the sink area of Stuart Road, which is a quick the kitchen allows sunlight into route to Bradley Square Mall, Street, and it is easy to get to the very reasonable at $149,900, and the room, as well as a place to North Lee Highway, and lake and mountains by going is listed through the Richardson FERGUSON view what will eventually be won- Interstate 75. Thus, it is within east toward Polk County. Team at Keller Williams. For more derful landscape in the horizon. FERGUSON quick driving distance to shops, The residence is zoned for information, contact the Bath Kitchen Gallery ENTERPRISES, INC. That same view is seen in the liv- grocery stores and dining estab- North Lee Elementary School, Richardson Team at 303-200, or ing room area. lishments. Easy access to down- Ocoee Middle School and Walker go by the open house this Sunday. 3375 Old Tasso Road, N.E. The hallway has a half-bath town Cleveland is possible on Valley High School. Just follow the signs off Urbane Just Off 20th St. • 472-5441 just past the kitchen area, and North Lee Highway and Keith The price for the townhome is Road onto Belle Chase Way. Cleveland’s Largest Flooring Center! FINANCING AVAILABLE THE FLOORING CENTER “The Home Hours: 923 I m p r o v e m e n t M o n . - F r i . 8 : 0 0 - 5 : 0 0 StarVue Dr. S p e c i a l i s t s ” S a t . 9 : 0 0 - 2 : 0 0 4 7 6 - 9 4 3 4
CONGRATULATIONS D&S Custom Homes Builder WE ARE PROUD TO HAVE BEEN A SUPPLIER THE RIGHT MIX FOR YOUR JOB RESIDENTIAL AND COMMERCIAL
Banner photo, ALLEN MINCEY Banner photo, ALLEN MINCEY CLEVELAND READY MIXED CONCRETE CO., INC. LOW MAINTENANCE siding and stacked stone highlight the BREAKFAST WILL BE special in this nook in the home. It is per- 1601 6TH STREET 472-6522 entrance to the home. fect to sit for a meal, or just to enjoy a cup of coffee with others. ATTENTION: Contractors and Builders To have your new home featured as Home-of-The-Week K WWEE TTHE E OOF Call the HOM Advertising Department Today 472-5041 or Email [email protected]
Banner photo, ALLEN MINCEY WHIRLPOOL appliances — a range, microwave oven and dishwasher — are featured in the kitchen Cleveland Daily Banner of the home. www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 7
Banner photo, ALLEN MINCEY GRANITE COUNTERTOPS Thanks For DANE are located in the kitchen and bathrooms in the Bellingham Choosing MILLS Townhome residence. Me 595-7489 • Site Preparation • Footers Banner photo, ALLEN MINCEY • Septic Systems THE TOWNHOME has three bedrooms: a master bedroom downstairs and two upstairs bedrooms. • Landscaping & More FREE ESTIMATES LICENSED & INSURED Congratulations D&S Custom Homes Upon your completion Dustin Hawkins - Contractor Thanks for using us! Congratulations D&S Custom Homes RICK OWENS PLUMBING Dustin Hawkins - Contractor P H O N E : 3 3 6 - 5 0 0 0 Thanks for letting us be a part of the project Jerry Wright T&M ELECTRIC Drywalling “Congratulations” 423-240-8761 D&S Custom Homes - Builder Thank You For Choosing Us 423-593-6408423-593-7377 Locally Owned and Operated Banner photo, ALLEN MINCEY THE KITCHEN FEATURES an island that is great for preparing meals or for sitting down at and enjoying some spare time.
4130 Jersey Pike (423) 648-7863 Chattanooga, Tennessee “Let Us Help” For All Your Masonry Needs
PROUD Congratulations BUILDER DUSTIN HAWKINS D&S CUSTOM HOMES D u s t i n H a w k i n s OWNER/BUILDER L i c e n s e d C o n t r a c t o r • New Construction • Home Additions • Sunrooms • Decks • Remodels
( 4 2 3 ) 2 5 5 - 1 6 0 5 Banner photo, ALLEN MINCEY THE LIVING ROOM has beautiful wooden floors and a large win- www.dscustomhomes.com dow that shows off the exterior landscaping.
CLEVELAND PLYWOOD CO. “SERVING CLEVELAND SINCE 1968” Congratulations CONGRATULATIONS D&S Custom Homes LLC D&S Custom Homes Dustin Hawkins - Builder D u s t i n H a w k i n s Lot 15 Bellingham Owner/B uilder Thanks for choosing us! We were pleased to supply materials used on these beautiful new home. FREE DELIVERY All Major Brands BUILDING SUPPLIES • SHEETROCK • ROOFING • LUMBER “For All Your Flooring Needs!” • DOORS • SIDING • POWER TOOLS • MOULDING • WINDOWS • HARDWARE Installation Available • CEILING TILE • INSULATION • PAINTS HOURS: 7 A.M. - 5:30 P.M. M-F Banner photo, ALLEN MINCEY TFOLL FREE 800-356-1253 THE STAIRWELL at the home 472-3357 begins with wooden steps, then Dalton, GA. 2700 20TH N.E. • CLEVELAND becomes carpeted as it goes www.hankscarpet.com upward to the second floor. 8—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com FRIDAY
Phone 472-5041 or fax 614--6529 Religion e-mail: [email protected] ChurCh [email protected]
N. Cleveland Baptist to honor Nancy Paul On Jan. 10, Nancy Paul shared cal blessing from this gifted Say this: ‘God can’ her heartfelt decision to retire as woman. It is our joy and privilege pianist at North Cleveland to grant her a small portion of the I don’t need to understand, the testimony as a great Lifelines Baptist Church. honor she deserves. just let me hold your hand. prayer warrior. I’ve heard him Two weeks later, she complet- “I hope people throughout our Only those who wholly fol- pray. Every time when before ed more than 57 years of service community who share our love low the Lord in faith are able he said, “Amen,” he made this to the Lord at the piano of this for Nancy will join us during one to claim His promises. Bettie statement: “Lord, I count it Bradley County congregation. of our services Sunday morning.” A person who trusts God Marlowe done.” He seemed to have This Sunday, North Cleveland On Sunday afternoon from 2 never doubts that “God can!” experienced the same trust in Baptist will express thanks to to 4 p.m., a drop-in reception There is no strength in unbe- God that Caleb and Joshua Paul and her family for her near- will be held for Paul and her fam- lief. We can count on God for did as they counted on God’s ly six decades of ministry. ily in the church Annex. his goodness and faithfulness. I’m reminded of the little girl goodness and faithfulness. The 8:30 and 11 morning wor- The church especially wants to What a mighty truth! What a who was whining and decided How much do we trust God? ship services will include her invite her former students and wonderful realization. she wanted a worm. Trying to When we pray, do we give God favorite hymns, a video tribute, fellow members of the Cleveland (Eph 3:20 KJV) “Now unto pacify the little darling, her options? Do we have the prob- special music from the church Music Club to join in atten- him that is able to do exceed- father brought her a worm. lems already “figured out” and choir and ensembles, and testi- dance. ing abundantly above all that “Fry it,” she said. So he did. just want God to carry out our monies from current and former Also, the church is collecting we ask or think, according to “Cut it in half,” she said. “You instructions? Are we always staff. nancy Paul personal thank-you notes and the power that worketh in us.” eat half and I’ll eat half.” asking for the details before we “Simply put, Nancy Paul is a emails to her. “Thanks be to God, who sur- Going all the way, her dad really surrender all to him?” treasure and a legacy,” said Jay ‘The Queen Mother’ of our The church’s physical address passes all expectations, I ate half the worm. She started How wonderful it would be if McCluskey, North Cleveland church. What a rich heritage that is 2815 North Ocoee St. count it done.” That is believ- howling all the louder. “Now we could — like the words of a Baptist Church pastor. “She multiple generations of our Emails may be sent to ing God. Psalm 92 expresses what?” he asked. song, declare “I don’t need to lightheartedly refers to herself as church family received the musi- [email protected]. this faith with thanksgiving — “You ate my half,” she pout- understand, I just need to hold “It is a good thing to give ed. His hand.” thanks unto the Lord, and to The Israelites were hungry. The preacher Andrew sing praises unto thy name, O God sent manna. “No, we want Murray said, “Say this: ‘God ELIGION BRIEFS most High: To shew forth thy some meat.” God sent quail. can.’ That will clear up many a R lovingkindness in the morn- Never satisfied, they were problem. That will bring you ing, and thy faithfulness every always testing God and then through many a difficulty in IS gets millions in ransom Assyrians, members of an Rubio also said he wonders if the night.” pouted like spoiled children. your life. We must desire and ancient Christian sect, last Cruz policy was “Go out and do Like Israel, we sometimes When they asked, “Can believe. for abducted Christians February after overrunning sev- anything you want and if you get murmur and have our pity God?” in unbelief, God was “We must ask and expect BEIRUT (AP) — The Islamic eral communities. caught we’ll just apologize, but parties. Although God had grieved. His children did not that God will do unlooked-for State group has collected mil- Shakeup over Bible tweet we’ll keep doing it.” proven himself to his children things! We must set our faith lions of dollars in ransom for a trust Him. They were not LAS VEGAS (AP) — Republican Georgia governor says changes in many times, they still ques- depending on His goodness in a God of whom men do not group of Assyrian Christians it presidential candidate Ted Cruz works on religious exemptions bill tioned and complained. Still and faithfulness. But there know what He hath prepared kidnapped in Syria a year ago. has asked his campaign God always supplied their for them who wait for Him.” ATLANTA (AP) — Georgia’s gov- were two who believed God – That’s according to Christian spokesman to resign for tweeting needs — water, food, shelter The wonder-doing God ... Caleb and Joshua – and God officials and an opposition group. a story that falsely alleged Marco ernor says changes are coming to and victory – whatever was must be the God of our confi- honored their faith. The last of the 230 hostages are Rubio insulted the Bible. a bill allowing faith-based organ- needed. dence. I once knew a man who had just being freed. The release Cruz told reporters in Las izations to refuse service to gay ended a yearlong saga for the Vegas that he asked for Rick couples without repercussion. Christians — many of them Tyler’s resignation. The Texas Supporters say it’s intended to women and children — during senator says Tyler is “a good prevent religious adoption agen- which families had no news from man” and deleted the tweet once cies, schools and other organiza- east Side church of christ starts radio programs their loved ones. he found it was false. But Cruz tions from losing licenses, state Younan Talia, of the Assyrian says the resignation was neces- grants, or other government ben- The East Side church of Christ announces its “A Minute for the Master.” This segment is com- Democratic Organization, told sary because campaign stan- efits for their religious beliefs new radio programs to begin this Sunday. prised of one-minute biblical messages that will The Associated Press that about dards were clear to all staffers. about same-sex marriage. The “Declaring Glad Tidings” returns to the air on air at 8 a.m. and 3 p.m. on MyMix 104.1 and at 9 40 remaining captives were He said the tweet was wrong even state’s business community con- Talk 101.3, The Buzz, starting Sunday at 10 a.m. a.m. and 3 p.m. on Talk 101.3, The Buzz. Archey released early Monday and if the story had been true. Cruz tinued to marshal opposition to East Side preacher Jeff Archey will host the 15- will also host these segments. arrived in the northeastern town says he won’t question the faith the proposal, wary of the type of minute program of Bible study that will air weekly The East Side church of Christ is located at 252 of Tal Tamr. He said the release of another candidate. economic backlash Indiana expe- on 101.3. Wildwood Ave., just behind the Jim Rush Funeral came after mediation led by a top The shakeup came after Rubio rienced following 2015 passage of A new daily segment is debuting Monday titled Home. Assyrian priest in northern Syria. questioned if there would be a broader “religious freedom” The extremists captured the accountability for the incident. law. BIG SprInG UnIted BETHEL BAPTIST CHURCH BBethelethel BBaPtiStaPtiSt 2514 Old Chattanooga Pike ttaBernacleaBernacle MethodISt In One 3165 Buchanan Road 1196 Hardwick St. S.E. Accord to sing Sunday, 11 a.m. nno PPlace to hhideide Breakfast _ Sausage and — RegulaR SeRviceS — will sing Sunday Pancakes, Biscuits and Gravy Sunday School...... 10 a.m. Saturday, Feb. 27, 6:30 to 11 a.m. Sunday Worship...... 11 a.m Sunday School ... 10 a.m. in the church fellowship hall Evening Worship ...... 6 p.m. Worship Service ... 10:45 a.m. Cost — $6 Wednesday Bible study ...... 6 p.m. Children 5 and under free Everyone Welcome
THIS PAGE SPONSORED IN THE INTEREST OF ALL BRADLEY COUNTY CHURCHES
(423) 473-2620
EQUAL HOUSING 126 Keith St. OPPORTUNITY 4699 Across from Village Green N. LEE Burgers, Fries, BBQ, Hot Dogs, Deli HWY. Sandwiches & More THE HARDIN COMPANY GENELLE HARDIN 472-3396 1009 KEITH STREET NW 476-3205 CELL 596-9352
Large Enough To 160 Durkee Meet All Your CLEVELAND 472-3357 Home Appliance Road NE Needs...Yet Cleveland TN 37323 2700 20TH ST., N.E. (Behind Sonic on PLYWOOD CO. Small Enough To “SERVING CLEVELAND SINCE 1968” CLEVELAND Hwy. 64) P.O. BOX 1227 CLEVELAND, TN 37311 Appreciate Your Family Owned and Business! Operated “When Quality and Service are Important.” CENTRAL AT WORTH 476-7528
COMPLETE WELLNESS 2596 Keith CHIROPRACTIC CENTER St., N. W . 479-8553 MATTRESS WAREHOUSE 95 Mikel St. 476-0023 614-3232 595-5967 “A New Way of Treating Your Problem” 158 Old Mouse Creek Rd. (Next to Tako Yaki)
CALL US FOR ALL YOUR PEST CONTROL NEEDS CALL PESTAWAY
Member FDIC 473-7980 479-9711
Phone 479-9615 423-479-2742 David Goins-Mgr. GILBERT Fax 423-479-5272 FENCE COMPANY 1105 South Lee Highway www.tiretownauto.com “GOD IS MY GUIDE” [email protected] 95 Second Street, N.E., Cleveland 1282 EUCLID AVE. 479-4186 www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 9
At Gethsemane The Bible and Current Events Oscar Pimentel has heart of a missionary The darkest Clyne W. By BETTIE MARLOWE day of history Buxton Banner Staff Writer Chicago-born Oscar Pimentel, CALLED TO SERVICE the son of Serafin and Josefina It was the darkest day of all them would betray Him, and Pimentel, has experienced the history. The 3 million Jews in the then He washed their feet. ordinary and the unexpected in Holy Land and many thousands They sang a hymn and, as the his life. His parents and grand- Oscar Pimentel serves as the general overseer more scattered throughout the notes faded in the large room, the parents were from Mexico. of The Church of God. The global organization world intently prayed for the disciples had begun to bridge the When he about 4 years old, his has its general headquarters in Cleveland. coming of the Messiah. gap between the Old and New family left Chicago, moving to sev- Thousands were sure that Christ Testaments. eral states, ending up living in was the answer. Jesus led His disciples to Nampa, Idaho. emotion, but were happy in that died in 2015, the church presby- be OK, even if out of my comfort Now He was nailed to the cross Gethsemane on the slopes of the His dad got saved in 1984 when area, as they were tricing to follow tery selected Pimentel as interim zone.” He said that thought has — dead. Hope was dashed to Mount of Olives. Gethsemane Oscar was about 6 years old and the Lord. general overseer of The Church of sustained and undergirded him those who believed Jesus was means “olive grove,” a favorite became a minister in the Church Of course, he confided, he felt it God. He explained his feelings of — “to follow the Lord and the divine. God had died. Little won- place of Christ to pray. This night of God of Prophecy, beginning was a challenge, but “I don’t regret shock and disbelief — and in Holy Ghost to fulfill that.” der we call it the saddest day of was different; he was going to be pastoral duties around 1986. it — I’m completely sure.” some way, “with uncertainty,” he Pimentel said he constantly all history. betrayed into the hands of sin- In Nampa, Oscar attended West In the 2012 General Assembly said. “It didn’t seem real — wasn’t prays “to keep my mind and heart What a paradox! We also call ners and He flinched from the Junior High School and High of The Church of God, Pimentel happening.” He said thoughts when the enemy assails, and to that hopeless day Good Friday. spectacle. School. In fact, he met his future was ordained a bishop, and in rushed through his head after help me to understand the will of The people then could not see the The Bible says: “He began to be wife, Amanda, in junior high 2014 was placed under general that initial meeting when he was God.” whole picture. It was Friday, but deeply distressed and troubled. school in the spring of 1993 when appointment in the position of the chosen. But, he continued, “God He gives this advice to those Sunday was coming! Christ died ‘My soul is overwhelmed with she was 13. He was 15 — they Bible Training Institute represen- gave me the grace to go through who feel the call to enter the min- on Friday to “save His people sorrow to the point of death. . . .” were junior high sweethearts. The tative. the weeks and months.” The next istry: “Seek all the spiritual bless- from their sins.” Going a little farther he fell to the two dated for some four years and In the almost eight years since assembly confirmed him as gen- ings of God; press in the fight; and Though our Lord died on ground and prayed that if possi- after Amanda finished school, got making the move, Pimentel has eral overseer by unanimous as the song goes, ‘Brighten the Friday, the Passover began the ble the hour might pass from married on Sept. 6, 1997. She was traveled to some 26 different agreement. Corner Where you Are.’ And when night before, on Thursday. Peter him” (Mark 14:34, 35). 17 and he was 19. countries and served as inter- He said if it pleased God, it God needs a worker, He’ll know and John had prepared the Note the intensity of His Although he was raised in a preter and teacher in Bible pleased him, and “this is going to where to find you.” Upper Room. Scholars say that prayer. No folded hands while pastor’s home, Oscar wasn’t a Training Institute. Not only in the Passover meal began at 7 kneeling by an olive tree. “He Christian when he and Amanda specifically church ministry, he p.m., which came to be known as [was] deeply distressed and trou- married. He got saved when incar- has been the interpreter at confer- the Last Supper. Present was bled [and] overwhelmed with sor- cerated in July 2001. “I gave my ences, legal and civil meetings, Christ and His little band of 12 row. . . . He fell to the ground and life to the Lord and a month later, and business and religious mat- followers. prayed” Christ is in agony for us. Amanda was saved at a ladies ters. He said he had to learn the The 12 apostles were a cross At Gethsemane we gain insight retreat.” They still lived in Nampa terminology for the various section of common men — fisher- into our own troubles and trials and attended church there. He aspects of translation and inter- men, carpenters, a tax collector. and how to face emotional dis- told his dad that he had to attend pretation. That’s the way Christ wanted it. tress. Some people suffer from AA classes during the week, but During the last two years, he Doesn’t the Book say, “The com- depression as well as panic as soon as he received his certifi- has gone to countries as represen- mon people heard him gladly” attacks along with emotional cate of completion, “I’ll be able to tative of the church. “I have bap- (Mark 12:37)? Most of us who are upheaval. Then we look into attend services during the week.” tized in cold, frigid water in Peru, redeemed today are common peo- God’s word and find that Jesus Pimentel didn’t know God was gone into the interior and back ple willing to follow Christ. It may suffered the same things. The setting the stage for a later min- woods of Central American coun- have been as late as 11 p.m. Bible, in various places, teaches istry. The church was studying a tries, such as Panama and when the left the Upper Room. us how to handle such adversi- Body of Christ Course taught by Honduras, and traveled from While there, many things hap- ties. Jerry Wilda. He and Amanda went Buenos Aires over the Andes Contributed photo pened. Christ instituted the Last (Column 1 of a series on Christ in and sat on the back pew. Since Mountains into Chili. Whatever OsCar and amanda Pimentel have four children: Julian, 17; Supper, predicted that one of Suffered for Us) the congregation was both the mode of travel — be it land, Yadira, 14; Eliana, 13; and Evangelina, 11. Spanish and English, the class sea or air — Pimentel makes sure was being taught with the help of he always carries out his duties, an interpreter. But that night the he said, “to the glory of God.” He East Cleveland SDA to hold Spanish interpreter was absent has had communion and prac- and Pastor Pimentel was strug- ticed washing the saints feet of Day of Prayer event March 5 gling to fill the vacancy. different groups, taken in mem- “As we were sitting there,” bers to the church and preached “Dare to Ask for More” is the theme for the International Women’s Pimentel said, “Amanda elbowed to the lost. Day of Prayer on March 5. me and said, ‘Go up there and Pimentel said he has learned to The Day of Prayer event wil begin at 11 a.m. at East Cleveland help Dad.’” eat with the people, walk with the Seventh-day Adventist Church. The guest speaker will be Nicole “Too many people here,” was people and live with the people Stokes of the Hillcrest SDA Church in Nashville. his reply. wherever God calls him. One par- At 3 p.m., a worship will be held led by Dr. Maquila Mills of New The third time, Pimentel said, ticular food he experienced (not so Life SDA Church in Chattanooga. “she elbowed me in the ribs,” so favorably) was guinea pig in Peru. The Day of Prayer is being hosted by the East Cleveland SDA reluctantly, he took the long way “It’s on the menu in restaurants Women’s Ministry. around to the microphone — “tak- there,” he said, “but I wouldn’t eat Individuals attending the lunch and or workshop are asked to ing my time,” he said. “Here we it again.” RSVP by calling or texting 423-892-0177 or emailing go.” It was the beginning of his But, he said, when you’re invit- [email protected]. Food and workshop material will be prepared being heavily involved as a lan- ed to a home and they put food on based on RSVP responses. guage interpreter. the table, you don’t ask — “enjoy “When he became a member of it with them, because they do the church, he almost immediate- their best to make you feel com- Morgan, Braddy to be speakers ly began to teach at the local fortable and they give you their church. He was appointed to best.” at HHE devotion at Garden Plaza teach the junior class and then Pimentel said you don’t com- accepted the responsibility of plain if you walk with an overseer His Hands Extended is a nondenominational devotional held youth leader. through the mud — “this is the Tuesday and Thursday mornings, from 7 to 7:30. He became totally immerged in heart of missionary work.” He said The devotions are held at Garden Plaza, located at 3500 Keith St. ministry and became the Sunday to expect nothing except to be of The speakers for this week are Steve Morgan on Tuesday, and school adult teacher in 2003, then service. “These are exciting times Carolyn Braddy on Thursday. assumed the position of leader of and moments to cherish — when The public is invited to start the day with a devotion. the small group ministry. Every you can impress the hearts of peo- Sunday, he was the interpreter. ple that you minister to.” That expanded to include region Currently, he is working with a conventions, conferences, retreats Spanish congregation in CHURCH ACTIVITIES and so forth. Chattanooga of about 60 people He was given a lay minister’s from Central America. For three or license around 2004 or ’05, and four years, he and his family visit No Place To Hide will be The Rev. Harry Johnson and then received his evangelist as often as they can, and at the singing in the Sunday morning the Green’s Chapel congregation license. request of Pastor Lucas, Pimentel service at Bethel Baptist invite you to worship with them at His first mission field was has the opportunity to preach to Tabernacle. The church is locat- 11 a.m. Sunday, for the annual Boise, Idaho — his first real expe- the people. ed at 3165 Buchanan Road. Brotherhood Sisterhood Black rience as a missionary in new field When General Overseer Smith ——— History celebration and soul food work. In One Accord will sing at dinner. The church is located at They were there three years Bethel Baptist Church, Old 288 Wool St. in Charleston. after building a congregation of Chattanooga Pike, Sunday at 11 ——— about 20 people including 11 CHURCH DIRECTORY a.m. The Evening Light Gospel covenanted members. By then the ——— Tabernacle, 200 20th St. S.E. will Pimentels had been blessed with Serving Cleveland for over 175 years Farmland Community Church Jessie Conner will sing at have a chili dinner Sunday after four children. In 2007, he began God’s House Of Prayer Sunday the morning service. A singing Spanish translation of course Meeting at the Cleveland Family YMCA at 7 p.m. The church is located Sunday evening will feature books and was asked officially to 220 Urbane Road NE at 1215 Spring Place Road, Christian Gospel Heirs and the work on the church business Sanctuary - Traditional Worship - 8:30 a.m. and 10:45 a.m. ——— Wiseman Family at 6 p.m. guide. Sunday School - 9:30 a.m. Sunday Morning Worship Service 10 AM Fellowship Hall - Informal Worship - 8:45 a.m. and 10:45 a.m. But God tapped the heart of Nursery available for all worship services Office Phone: 473-9891 The Church of God General 11 polygamous leaders arrested in Overseer Stephen Smith to bring Randy Martin, Senior Pastor Skip White, Associate Pastor “Come See The Difference” 155 Central Ave., NW 423-476-5586 the Pimentels to Cleveland. In http://www.bsumc.org REV. CHIP HAMMONDS food stamp fraud, money laundering 2008, Smith asked him to come to General Headquarters and work FIRST UNITED METHODIST CHURCH United Christian Church SALT LAKE CITY (AP) —Several leader Warren Jeffs. full time as a Spanish translator 3425 Ocoee St. N 476-4504 top leaders from Warren Jeffs’ Warren Jeffs is serving a life for the written material, as well as Pastors Charles & Margie Poteat www.ClevelandUMC.com 2200 Peerless Rd polygamous sect have been arrest- sentence in Texas for sexually be available to travel with other Pastor: Rev. Tim Bracken ed on federal accusations of food assaulting his 12- and 15-year- headquarters staff to Spanish- Sunday Worship . . .. 8:30 a.m. and 10:45 a.m. Cleveland, TN stamp fraud and money launder- old child brides at a secretive speaking countries and serve as Sunday School ...... 9:30 a.m. 423.479.4277 ing — marking one of the biggest church compound in that state. interpreter. Wednesday Night Together ...... 5:30 p.m. A Full-Gospel Fellowship blows to the group in years. A federal prosecutor says the To the young minister, it was a (Supper Reservations Required) - (Nursery Provided) Everyone Welcome Prosecutors say the sect based case has nothing to do with reli- decision orchestrated by God. OPEN HEARTS, OPEN MINDS, OPEN DOORS... on the Utah-Arizona border gion, but fraud. Pimentel and his wife, Amanda, The People of The United Methodist Church Service Times: Sunday 11 AM & 6 PM, Wed. 7 PM diverted funds from Utah’s nutri- University of Utah law profes- packed up all their belongings and tion assistance program for inap- sor Amos Guiora (gee-OH’-ruh), their four children — “just babies” St. Thérese ´ of Lisieux propriate use by its leaders. who has studied the church, says said Pimentel — and moved more Wesley Memorial United A total of 11 people were the government is sending a mes- than 2,000 miles across the Methodist Church Catholic Church charged in the scheme, including sage that it “will not tolerate United States in September 2008 MASS SCHEDULE Lyle Jeffs and Seth Jeffs, top- crimes committed in the name of to live in the city of Cleveland — 3405 Peerless Road NW Saturday 6 p.m. (Vigil) ranking leaders of the religion.” He says FLDS leaders for them, a different culture and Cleveland, TN 37312 • 472-9578 Sunday: 8 a.m. (Spanish), 9:30 a.m., 12 p.m. www.wesleymemorialchurch.com 1st & 3rd Sunday, 3 p.m. (Latin) Fundamentalist Church of Jesus carried out anti-government climate. Monday, Tuesday, Thursday, Friday, Saturday: 8:30 a.m. Christ of Latter Day Saints and practice known as “bleed the Email: [email protected] It was with mixed emotions the Rev. Ramon Torres Wednesday: 5:30 p.m. brothers of imprisoned sect beast.” SACRAMENT OF PENANCE Saturday 4:45-5:45 p.m. Pimentels moved to Cleveland, Sunday Worship – 8:30, 11:00, 6:00 900 CLINGAN RIDGE DR. NW • 476-8123 but (you) place yourself in God’s Where Everybody is Somebody, & Jesus Christ is Lord Child sex abuse victims to hear cardinal’s testimony hand, he said. “Feels like obeying sttheresecatholicchurch.org the Lord — fulfilling the calling as BALLARAT, Australia (AP) — return to Australia to testify at satisfying the Lord. At the same First Lutheran Church Victims of clergy abuse have won the Royal Commission into time, it was sad to leave both their ATTEND A permission to be present next Institutional Responses to Child families behind and moving more “Building on His Promise” week when Pope Francis’s Sexual Abuse had requested they than 2,000 miles, “not knowing if “Scripture-Based” CHURCH OF finance minister testifies from be allowed to hear in person Pell’s we would have the opportunity to 8:15 & 10:45 Service Rome to an Australian inquiry testimony by video conference. visit them.” 9:30 Sunday School into child sex offenses within the A crowd funding website set up But Pimentel said, “We knew it YOUR CHOICE Reverend Robert Seaton, Pastor Roman Catholic Church. last week to raise $39,000 to was settled in our hearts that ‘this Child abuse victims angry that send 15 abuse victims and their is the will of God.’” He said they -C)NTIRE 3TREET .% s #LEVELAND 4. Cardinal George Pell will not supporters to Rome. weren’t wrestling with the natural #HURCH /FlCE s 0ARSONAGE THIS WEEKEND 10—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com Museum From Page 1 set for his staff and for this board. It’s easy to see the physi- cal changes, like the new exhibit “He’s the type of guy areas, reconfigured lobby and that rolls up his sleeves store, and marketing materials,” and gets the job done, Griffin added. and that’s the example The board president went on he set for his staff and to say, “It’s his work behind the for this board. It’s easy scenes that’s leading us to sta- to see the physical bility, lowering our operating changes, like the new expenses and increasing our rev- exhibit areas, enue. It has truly been an honor reconfigured lobby and to mentor and work with store, and marketing Hassan. I hate to see him leave, materials.” but I’m excited about his future — Mike Griffin and look forward to following his career.” Banner photo, LARRY C. BOWERS Najjar is leaving to accept top-notch exhibits,” the outgoing THE CLEVELAND BOARD of Education was preparing to meet Thursday with Tennessee School Boards Association Executive Director another position. He will become director continued. “The Museum Dr. Tammy Grissom on criteria and a timeline for its search for a new director of schools. At the afternoon meeting were, from left, Grissom, the executive director of the Center will always need support School Board Chair Dawn Robinson, interim Director of Schools Cathy Goodman, director assistant and supervisor of communication Foothills Art Center in Golden, from the community, and we will Andrea Byerly, and board members Dr. Murl Dirksen, Peggy Pesterfield, Charlie Cogdill, George Meacham, Tom Cloud and Steve Morgan. Colo., in April. continue to show our supporters Anyone interested in applying how their investment is used to for the job at the Museum Center tell the story of the Ocoee at Five Points can visit Region.” www.museumcenter.org for more Najjar emphasized one doesn’t Director details. need deep pockets to be a sup- From Page 1 Najjar says that for every porter. change the public saw at the Membership starts at $35 a Knoxville and Chattanooga, are all searching cation; and can build support, confidence Museum Center at Five Points, year. for new directors. and pride in the school system. there were many more behind the “We do a great deal for our The first thing to be changed on the “We work to find the best — A person who seeks information and scenes that helped propel the members, and there is always recruitment brochure dealt with experience candidate for the job, and we will ideas relative to the problem, and makes success of the facility. There were something going on at the muse- and degrees. help you get a great person to lead decisions that show fairness, mature judg- accreditation reports, collections, um,” Najjar said. He also recom- The board decided to require at least five this school district. You have a ment, appropriate analysis, and sensitivity studies, inventories, and audi- mended potential visitors check years of successful experience in school great, great school system.” for those affected by the decisions. ence assessments. out www.museumcenter.org to administration, rather than the three years — Dr. Tammy Grissom — A person who has experience in working Najjar point outs that his was see the Museum Center’s full required previously. with a community, staff and students in not a one-man-show. “Our slate of programming and remarkable staff and board of exhibits. After some discussion, the board decided The school board on May 16 will begin its developing long-range goals for the school to retain a statement which says a doctorate system, and a determination to accomplish trustees deserve so much credit,” Cleveland’s Museum Center is second phase of consideration, focusing on says Najjar. “We’ve set out on located at 200 Inman St., and degree would be preferred, but not required. one candidate at a time. TSBA will once again those goals, and has the ability to unite The board added a sentence to this new diverse groups for a common purpose. some pretty large projects in houses exhibits and artifacts check on the availability of the finalists. these past three years, and our relating to the history of the brochure, which requires the successful From May 16 through May 20, school — A visionary and decisive leader who will applicant to be willing to reside in Cleveland. work with the board to build an effective team continued to work hard to Ocoee Region, which includes board members are planning to visit the Bradley and Polk Counties, the Five years ago, according to schools offi- leadership team and a strong board/superin- realize each of them. This group hometowns of their top prospects. Chattanooga region, and sur- cials, a promising candidate lived just under tendent relationship. Who can and will confi- of individuals fueled our success Once this process has been completed, the rounding areas. 100 miles away, but was not looking to move dently articulate alternatives and recommen- and I’m thankful for each of board will negotiate and enter into a contract The museum features one per- to Cleveland. He told the board he would dations to the board. them.” with its selection between May 23 and May Financially, Najjar said the manent exhibit, The River of probably drive back and forth (if selected). 27, announce the appointment. The plan is — A person who will build support within Time, which traces the history of Another addition is a paragraph explaining the business, faith-based and higher-educa- Museum Center has shown a for the new director to take over July 1. dramatic improvement to its bot- Cleveland and Bradley County. the school system is currently awaiting fund- tion communities and within the school sys- Grissom asked the board for a salary range tom line, compared to 2013. He In addition, five to six changing ing for a new elementary school. tem for change prior to its implementation to relate to the candidates, and the board credits this to the outpouring of exhibitions are held each year. The board will also publish its latest mis- and has a record of leadership through decided on $125,000 to $140,000. Ringstaff community support from muse- The museum store has a gallery planned change. sion statement. was being paid $140,000. um members, local foundations, showcasing arts and crafts of the With approval of the selection criteria and The brochure TSBA is sending out, and — A person who can effectively utilize both corporate sponsorships, and local area and of the South. the search timeline, the next round of activi- placing online, includes information about oral and written communication and be an cost-saving investments (includ- The facility is often used for ties will be by TSBA consultants. the position, the selection criteria, facts effective spokesperson for the school system ing an LED lighting switchover private and community events. The state organization has already made about Cleveland City Schools, the school dis- and can build confidence and respect while and replacing several HVAC The museum was first pro- an initial announcement of the position. Now trict, the community and the application communicating the needs of the schools. units). posed in 1992. A committee was officials will distribute the brochure and process. — A person who has the ability to unify “Hassan and the staff invested created on March 9, 1992, to advertise, seeking to recruit quality candi- Board members discussed the possibility diverse groups and build and maintain high many hours into making the study the feasibility of establish- dates. of searching primarily from the Southeast, morale among employees. One who listens museum an educational ing a museum which would be TSBA will then acknowledge and verify the but Grissom said that when the information carefully to individual and community con- resource. Once we started to “an organized and permanent candidates’ files, begin evaluation of creden- is placed online, it becomes a national cerns and involves people in decisions which show the community the muse- nonprofit institution, essentially tials and check references, and screen the search. affect them. A person experienced with team um’s full potential as a cultural educational or aesthetic in pur- candidates according to the criteria adopted This pleased board member Peggy problem solving. leader, our donors took notice pose, with professional staff, by the Cleveland board Thursday. Pesterfield. She explored the possibility there — A person who works with community, and invested in the great things which owns and utilizes tangible Grissom will return to the school board might be someone from Cleveland who might staff, parents and students to develop goals we were doing,” added Griffin. objects, cares for them and May 2 with a list of selected candidates for be qualified and may want to return home. for the school system and works through The Museum Center tripled its exhibits them to the public on discussion. The number of finalists will prob- The criteria approved by the board plans to accomplish them. school attendance last year, and some regular schedule.” ably be determined by the number of applica- Thursday is probably the most important — A person with the ability to obtain fund- continues to attract visitors from Its mission statement is “to tions received. item in the brochure. It says candidates will ing, oversee the fiscal affairs of the school the region and all 50 states. preserve and interpret the history The school board will have access to the be evaluated on individual qualities and pro- system, and ensure that funds are spent “That’s the kind of momentum we and culture of the Ocoee District applications of all applicants, not just those fessional accomplishments, with emphasis wisely. want to sustain,” says Najjar. of Southeast Tennessee by high- recommended by TSBA. that the candidate is: — A person who understands the issues of The Museum Center hopes to lighting the adventures of its peo- Following the May 2 meeting with the — A person who listens carefully and internationalization, globalization, and mul- keep this pace and provide expe- ple.” school board, TSBA will notify unsuccessful processes individual and community con- ticulturalism and the need to prepare stu- riences for learners of all ages. Construction began on the candidates to tell them of their elimination, cerns so that he/she understands the con- dents for the rapid changes of the 21st cen- However, Najjar cautions the museum on May 28, 1998, and it and check the availability of those selected. cerns of people [who] will be affected by a tury. community not to let up on sup- opened to the public on Sept. 11, The state consultants will then assist the decision. — A person familiar with recent education- port. “Often, when an organiza- 1999. school board with preparations for candidate — A person who speaks and writes effec- al technology and committed to utilizing cre- tion does well, the assumption is The Museum Center was cho- visits and interviews. The interviews are tively to communicate the successes as well ative technology innovation. that we aren’t in need. Nothing sen as the 2011 recipient of the expected to be scheduled for May 4 and 5, as as the needs of the school system; is seen as — And finally, a person who is willing to could be further from the truth,” MainStreet Cleveland award. well as May 9-11. an advocate for children and for public edu- reside in Cleveland. he said. The new mission statement of “There is still much to be done “telling the story of the Ocoee to repair our aging building, care Region” was adopted on June 18, Outage for the collections, and attract 2013. From Page 1 locked out again, Borden explained. replacement 69kV breaker for the Ocoee sub- Mehling “Our substation personnel heard the power station. The existing breaker is a 1986 model. From Page 1 transformer fault internally,” he said. “We are working with the Siemens Industry was the low bidder at After the second fault, the Payne Gap feed- transformer manufacturer to $34,650, and was awarded the contract. Akiona also described him as er breakers were switched to adjacent substa- determine the cost to have the n At the request of the city of Cleveland, CU a “jovial character” who was tion breakers, thereby restoring full service to transformer repaired, and with our line crews installed seven new underground- always ready to share a laugh Mehling’s passing the impacted customers. insurance company concerning the feed street light fixtures in the most recent with a student or colleague. follows the losses of Later in the day, with the Payne Gap sub- coverage.” — Bart Borden phase of the Stone Briar subdivision develop- Mehling had been teaching at Brian Gallaher, the station shut down and all affected customers ment along Stonebriar Drive, Stone Castle Walker Valley for about nine Ocoee Middle School being serviced through neighboring facilities, Drive and Bell Tower Lane. years, Akiona said. band director who died CU crews “collected oil samples ... and sent “[Payne Gap] is one of the lowest-loaded n CU crews continued to progress with the The Massapequa, N.Y., native last summer in a car them to TVA’s laboratory services in substations,” Borden cited. “If we’re going to installation of security cameras on Cleveland began his career in Florida after accident, and Ocoee Chattanooga for testing.” have to have a failure, that’s the one.” Utilities property and facilities. Crews graduating from Allegheny Middle School social He added, “The tests were immediately per- Borden said early talks indicate the failed installed five security cameras in the Water College in Meadville, Pa. From studies teacher Stan formed and showed many of the combustible transformer will have to be transfered to the Division Main Office, seven in the Water Florida, he moved with his fami- Green, who died of a gas parts per million were in the upper spec- manufacturer’s facility in Edmonton, Alberta, Division maintenance area and seven in the ly to Cleveland. heart attack in January. ification, which indicates internal arcing (fail- Canada for repair, and the work could require Power Service Center office area and dispatch Mehling is survived by a wife as many as 30 weeks to complete. The trans- ure).” center. and five children. Akiona point- former was originally manufactured in just a colleague, but an excel- A CU vendor, Liberty Power Service, was n In a traffic lighting report, Borden said a ed out that two of Mehling’s Guelph, Ontario, in 1994, Borden noted. lent educator,” Akiona said. then brought in to conduct an internal work order has been issued to remove the sons, twins Kendall and “We are going to evaluate the option of pur- He added counseling services inspection of the power transformer, Borden Sensys puck detection at Paul Huff Parkway chasing a new unit versus the repair of this Kameron, are seniors at Walker have been made available to stu- said. It was determined all phases of the and Peerless Road, and replace it with [existing] unit,” Borden advised. Valley. dents and faculty as they navi- operation “... showed signs of failure.” Wavetronix radar detection. “The puck system “During an internal fault, a power trans- In other developments in Borden’s monthly Akiona said they are “great gate a difficult time. has been failing for some time, causing former experiences tremendous forces that report for the Electric Division: students” who have, between the This is the third time this numerous calls and complaints,” Borden cause the windings to try to telescope and n Installation and relocation work of exist- two of them, amassed college school year educators and stu- bulge, which is exactly what the internal ing steel transmission poles on the Mayor explained. “Most calls were due to the scholarship offers totaling dents at a Bradley County inspection revealed,” Borden told board mem- Tom Rowland Interchange at Stone Lake Peerless extension holding traffic when no “almost a million dollars” school have had to mourn the bers. “We are working with the transformer Road on APD 40 continues. This is a vehicles were present or not being detected because of their commitment to loss of an educator who was manufacturer to determine the cost to have Tennessee Department of Transportation from the same approach. The installation was academic excellence. actively teaching at the time of the transformer repaired, and with our insur- project and TDOT’s electrical contractor is completed Tuesday.” “A lot of that was modeled by his death. ance company concerning the coverage.” Service Electric. n In a traffic signal report, Borden pointed their dad — not just to them but Mehling’s passing follows the CU’s investigation is expected to be thor- n Materials are now being bid and pur- out Tad Bacon (traffic signal coordinator) has to all his students,” Akiona said. losses of Brian Gallaher, the ough because the projected cost of a new chased for the Peach Orchard Hill Road been working with Bradley County govern- He explained Mehling had Ocoee Middle School band direc- power transformer is about $450,000. Community Development Block Grant project ment representatives and TDOT to improve passed away after a fight with tor who died last summer in a Estimated cost for repairing the old one is which is expanding and improving electric the flashing school zone facilities at Valley terminal brain cancer, which car accident, and Ocoee Middle about 70 percent of that amount, or about transmission services in the general area. View Elementary School. CU provided an esti- had spanned several years. School social studies teacher $315,000. Either way, it’s a chunk of change Asplundh Tree Experts has begun the mate of $8,061.29 to replace two poles, install Akiona said Mehling taught as Stan Green, who died of a heart in a utility spreadsheet that is already bur- process of tree trimming for the major project. 12-inch LEDs with larger signs and relocate often and for as long as he was attack in January. dened with budgeted expenditures that n Project installation remains scheduled the time clock from inside the school building able, sharing his “contagious” Visitation with Mehling’s fami- include debt service, routine maintenance, for the Blue Springs Road and APD 40 69 kV to a flasher cabinet on the Volunteer Energy sense of humor and modeled ly will take place on Saturday equipment and service expansions, most of line design. It is expected to begin this spring Cooperative pole line. perseverance until the end. from 9 to 10:30 a.m. at Broad which relate to ongoing municipal growth and when system-load conditions are more favor- “We are presently waiting for a response Though Mehling may be Street United Methodist Church. territory demand. able. “The steep slopes along this line section from TDOT to determine if the project will be missed by his students, Akiona The funeral will follow in the Asked by Cleveland Mayor Tom Rowland are very difficult to navigate during rainy con- funded,” Borden said. “Cleveland Utilities said he was also known as a same location at 11 a.m. about the Payne Gap substation’s customer ditions and will also determine when the work does not maintain the existing school zone friend to and a true professional Arrangements are being handled load, Borden advised the impact — in total can begin,” Borden explained. signal at Valley View Elementary. They were among his fellow educators. by Companion Funeral & customer numbers — was minimal. n Purchase order has been submitted for a installed by a TDOT contractor in May 2014.” “They mourn the loss of not Cremation Service. www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 11 In court fight, Democrats pressure Republicans at home for decision WASHINGTON (AP) — In some states, incumbent ended the chatter when he Searching for a way to put a new Republicans are worried about announced he was honored, but justice on the nation’s highest challenges from even more con- not interested. court, President Barack Obama servative candidates, but Obama’s nominee will almost is hoping that all politics really is Democrats hope GOP opposition certainly come with some new local — even Supreme Court pol- to a confirmation vote will cudgel in a go-local push. Among itics. become untenable once the pri- the judges floated as a possibility The president and his allies mary gives way to the general is Jane Kelly, a former public are pressuring Republican sena- election. defender in Iowa who once tors back home, aiming to make That’s why People for the clerked for a longtime Grassley life politically uncomfortable for American Way and other advo- backer. A Cuban-American — the lawmakers who’ve vowed that cates announced plans to protest such as Judge Adalberto Jordan only Obama’s successor will fill Monday outside Sen. Kelly of the 11th Circuit Court of the seat of the late Antonin Ayotte’s Manchester, New Appeals — could put Sen. Marco Scalia. Hampshire, office. Last week, the Rubio in a tough spot with It’s a long shot. Only a few group asked actor Martin Sheen Florida’s Cuban community. An Republicans have expressed to record robocalls in Wisconsin African-American could add openness to even hold hearings urging Sen. Ron Johnson to “put pressure in Pennsylvania, Ohio on a nominee. Obama must first his constitutional duties first.” and Illinois. get Republicans to break from Meanwhile, the Democratic Regardless of personal profile, leadership on that and then win Senatorial Campaign Committee, the president is expected to pick confirmation support from 14 an arm of Obama’s party, has a nominee with some bipartisan GOP senators. targeted Republicans in credentials — such as clerking The president is still trying to Wisconsin, New Hampshire, for a Republican judge or work- make his case. The White House North Carolina, Nevada and ing in a GOP administration. said Thursday Obama will meet Florida for opposing considera- Such a move, Democrats argue, next week with Senate tion of Obama’s nominee. The would expose Republican objec- Republican leader Mitch Senate Majority PAC, a super tions as political rather than AP Photo McConnell, Democratic leader PAC working to elect Senate merit-based. Sen. PAtrick LeAhy, D-Vt., the ranking member of the Senate Judiciary Committee, with Senate Harry Reid, Judiciary Committee Democrats, is attacking Sens. Republicans maintain it’s Minority Leader Harry Reid, D-Nev., right, and other Democrats, holds a copy of the Constitution as he Chairman Chuck Grassley and Rob Portman of Ohio, Pat about the principle of the presi- urges Senate Republicans to relent on their decision to take no action on anyone President Barack Patrick Leahy, the committee’s Toomey of Pennsylvania, dent nominating in an election Obama nominates to fill the Supreme Court vacancy created by the death of Justice Antonin Scalia, at top Democrat. Meanwhile, Johnson and others as part of a year. the Supreme Court on Capitol Hill in Washington, Thursday. Obama has talked to at least two $1.5 million ad campaign. Sen. Richard Burr, R-N.C., up senators directly at the White The effort has been aided by for re-election this year, said House. the editorial pages of local news- there could be a Republican in The president spoke briefly papers, still an influential force the White House and he still Wednesday with Orrin Hatch of in statewide elections. In wouldn’t support holding confir- Utah, a former Judiciary Pennsylvania, the Scranton mation hearings in an election Committee chairman viewed as Times-Tribune’s editorial page year. Nor would he meet with a potentially sympathetic to con- wrote that “Toomey should nominee. cerns about the precedent set by desist” from what it called GOP “No need to because there is the Republican opposition. “defiance of the public will.” And not going to be a hearing on any- Hatch said Thursday he wasn’t the Quad-City Times in Iowa body. That’s it. Period. Done,” swayed, though “I listened very accused Grassley on Thursday of Burr said. carefully.” having “gripped the grenade he’s Moving senators away from Obama spoke to Sen. Lamar clutching and pulled the pin.” that hard line would likely take a Alexander of Tennessee about “It’s only a matter of time groundswell of public pressure. the nomination search on before, one way or another, it There are few signs yet of that Thursday, after an event at the blows up in the GOP’s collective happening. White House, according to a face,” the paper’s editorial board A series of national surveys White House official, who would wrote. show Americans are roughly split not be named discussing private The Democrats’ efforts aren’t about whether Obama should conversations. always direct. Sen. Harry Reid of pick the next justice. The White House and its allies Nevada publicly talked up his Republicans say they’ve only believe the real work is on the home state governor, Republican just begun making their case to ground in places like Ohio, Brian Sandoval, as a possible the public. Wisconsin and New Hampshire nominee. The notion was quickly “I don’t think this is the silver — states where Republican sena- condemned by the Democratic bullet Chuck Schumer and Harry tors face tough re-election cam- base, but it also put the pressure Reid think it is,” Sen. Roger paigns — as well as Nevada, on Dean Heller, who was Wicker, R-Miss., head of the Pennsylvania and Florida, where appointed to the Senate by GOP’s Senate campaign organi- independent voters often hold Sandoval. zation, said of Democratic lead- sway. By Thursday, the governor ers in the Senate. Pentagon sends message with nuke test VANDENBERG AIR FORCE sage can be damaged by signs begin entering the force until BASE, California (AP) — Like a of weakness or instability in the about 2030. giant pen stroke in the sky, an nuclear weapons force. In 2013- Pavel Podvig, an independent unarmed Minuteman 3 nuclear 14 the Associated Press docu- analyst of Russian nuclear missile roared out of its under- mented morale, training, lead- forces and publisher of the ground bunker on the ership and equipment problems RussianForces.org blog, said in California coastline Thursday in the Minuteman force, and in an interview that Moscow puts and soared over the Pacific, January the Air Force acknowl- less stock in the public messag- inscribing the signature of edged to the AP that errors by a ing aspect of missile test American power amid growing maintenance crew damaged an launches than does worry about North Korea’s pur- armed Minuteman in May 2014. Washington. suit of nuclear weapons capable Work said in an interview “They (the Russians) do want of reaching U.S. soil. ahead of Thursday’s launch to make sure the missiles are Dignified Services at When it comes to deterring an that he sees good progress in still functioning,” he said, “But Realistic Prices! attack by North Korea or other fixing the problems in the the message is as much for 2415 Georgetown Road, NE potential adversaries, the mis- nuclear missile corps. He also themselves as for the outside cookeshometowngrocer.com sile is the message. said the Vandenberg test world.” or find us on facebook 473-2620 At 11:01 p.m. Pacific launches are critically impor- North Korea, on the other Standard Time Thursday, the tant. hand, aims for maximum politi- Minuteman missile, toting a “It is a signal to anyone who cal impact when it conducts payload of test instruments has nuclear weapons that we missile test launches or deto- rather than a nuclear warhead, are prepared to use nuclear nates a nuclear device, as it did leaped into the darkness in an weapons in defense of our coun- Jan. 6. The potential for North explosion of flame. It arced try, if necessary,” he said, Korea to field a nuclear warhead toward its test range in the adding later, “We do it to small enough to fit atop an waters of the Kwajalein Atoll, an demonstrate that these missiles intercontinental missile is island chain about 2,500 miles — even though they’re old — among the worries American southwest of Honolulu. they still remain the most effec- officials cite as justification for About 30 minutes later the tive, or one of the most effective, investing tens of billions of dol- re-entry vehicle that carries the missiles in the world.” lars in a new fleet of U.S. ICBMs missile’s payload reached its Air Force officials say the test and other types of nuclear target, Col. Craig Ramsey, com- launches are a morale booster weaponry. mander of the 576th Flight Test because they give launch crews Squadron, told an assembled and others a chance to leave group of observers, including their usual duties and partici- Smithsonian Deputy Defense Secretary pate in an actual launch. They Robert Work and Adm. Cecil otherwise do 24-hour shifts, Haney, the top nuclear war- year-round, in underground unites with fighting commander. missile command posts, hoping The missile test, dubbed the call to combat never comes. Tuskegee “Glory Trip 218,” was the sec- Constance Baroudos, a ond this month and the latest in defense analyst at the Lexington University a series designed to confirm the Institute think tank, sees great reliability of the Cold War-era deterrent value in the TUSKEGEE, Ala. (AP) — The missile and all its components. Minuteman test launches. Smithsonian Institution National The Minuteman 3, first “Deterrence basically doesn’t Museum of African American deployed in 1970, has long work unless the threat is History and Culture will collabo- exceeded its original 10-year deemed credible,” she said. “So rate with the Tuskegee University lifespan. It is so old that vital every time we test ICBMs we Archives to preserve and share parts are no longer in produc- demonstrate not only that the significant parts of the nation’s tion. weapons work but also that Civil Rights Era with the world. The Air Force operates 450 they are ready to be launched. A news release from Tuskegee Minuteman missiles — 150 at When those tests are conduct- University says the museum is each of three missile fields in ed, the Russians, the Chinese scheduled to open Sept. 24. The Wyoming, Montana and North and other international actors Tuskegee University Archives has Dakota. A few times a year, one are watching, and they send a a Memorandum of Understanding missile is pulled from its silo message to a potential aggres- with the museum that will sup- and trucked to Vandenberg, sor that they not do anything port several projects, including minus its nuclear warhead, for they would regret.” digitization of materials, lectures a test launch. Together, the United States and education workshops. Aside from confirming techni- and Russia control the vast For the first phase of the MOU, cal soundness, Minuteman test majority of the world’s nuclear the museum has given $25,000 to launches are the U.S. military’s weapons, and both countries the university to preserve the way of sharpening the message regularly conduct ICBM test legacy of Amelia Boynton that forms the foundation of launches. The Russians gener- Robinson, best known as the U.S. nuclear deterrence theory - ally do them more often, at least beaten woman in the iconic photo that if potential attackers in part because they have new of the 1965 “Bloody Sunday” civil believe U.S. nuclear missiles missiles in development where- rights march. and bombs are ready for war at as the Minuteman 3 is the only Other future projects planned all times, then no adversary U.S. ICBM. The U.S. Air Force is include a civil rights symposium would dare start a nuclear fight. planning a new-generation in 2018 at the university with The credibility of this mes- ICBM, but it is not scheduled to prominent Civil Rights historians. 12—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com
Banner photo, SARALYN NORKUS THE STAFF at Black Fox Elementary school threw a big party for Carli Oliver prior to her extensive cranial surgery. Carli From Page 1 which was the first time out of all piped in. of her surgeries.” The retractors must be in for a Nearly a month after a risky “It took about five total of two months, after which cranial vault reconstruction, the hours and everything they will be surgically removed in second-grader continues to be on went as planned, which an outpatient procedure. the mend and getting back to her was the first time out of Then, the family gets to play a typical “Carli” self. all of her surgeries.” bit of a waiting game. A pleasant surprise arose for — Beth Oliver “At first they told me it would Carli this time around, as she take six to eight months, but was able to avoid having her then said that it could actually was collecting 25 CC’s of blood head shaved. take up to 12 months before they every four hours. “The nurses actually braided know for sure (if the cranial vault her hair. I was joking with the “She’s been such a trooper and reconstruction worked),” Beth girls at the birth defect center was so excited to have the JP stated. “She has had some and was like ‘You know, you drain removed,” she added. headaches and been tired, but need to tell Dr. Boehm that we When looking at the young girl, that is most likely related to the don’t like his hair cutting skills,’ there are almost no signs that surgery.” because he’ll just shave her just a month ago she had been The immediate goal is to get head,” Beth joked. cut from ear-to-ear and had the Carli off of her seizure medicine The first two weeks following process of expanding her skull by and the medicine used to control surgery were some of the riskiest, 15 percent started. All that production of spinal fluid, as it is as the youngster was at the remains to be seen is a zig-zag negatively affecting her kidneys. greatest risk of infection at that scar across part of her scalp and “Hopefully this works and she time. The doctors were able to two dangling, metal retractors or can come off of her medicines. avoid doing any bone grafts on what have been dubbed her That alone would be a blessing,” her skull, but since her shunts “skull piercings” by her family. Beth said. were moved, they are still watch- The retractors, which really do Having not seen her teacher or ing to make sure no infections resemble futuristic, bionic jewel- friends and classmates since her Photo courtesy of Beth Oliver pop up. ry, are held in place by 36 screws pre-surgery party at Black Fox FOR HER 13th surgery, 7-year-old Carli Oliver’s doctors were able to avoid shaving her head, instead “They did have to move her and some metal plates, none of Elementary School on Jan. 25, working along pre-existing scars. Oliver was cut from ear to ear as doctors at the Walter E. Boehm Birth shunts and were worried about which are visible above the skin. Carli was anxious to get back to Defect Center performed a cranial vault reconstruction. Following the major surgery (right photo) Oliver’s (the possibility) of shunt infec- They must be turned with a school. parents must turn her retractors twice a day for a total of two months. tion, which is a huge deal – those screwdriver-like tool twice a day “Black Fox has gone above and are horrible and can get into the for another four to five weeks. beyond,” her mom declared. spinal fluid and possibly kill her,” According to Beth, having to “That party made her feel like a her mom explained. “Fingers basically crank open her daugh- princess. She just talked and crossed, she still won’t get one.” ter’s skull is a bit unnerving, but talked about it.” Following the surgery, Carli vital to ensuring a successful With the OK from Boehm, she had a Jackson-Pratt drain in outcome. was slated to return this week. Cleveland Daily Banner place for a week. The so-called JP For Carli, the process is odd as Slowly but surely, life is drain works as a postoperative well returning to normal for the Oliver 1505 25TH STREET N.W. drain and, according to Beth, “It listens (sounds) weird,” she family. Cleveland, TN 37311 KAB reports major increase 472-5041 in demand for its programs By CHRISTY ARMSTRONG to visit his or her classroom and zation’s monthly Business Banner Staff Writer give a presentation. Beautification Award. Maskew also announced that The next recipient will be Cleveland/Bradley Keep students in the fourth and fifth Trousdale School, which Maskew America Beautiful has been seeing grades will soon get to take part in said has made great improve- an increase in demand for the a new activity called “The ments to its property. educational programs it offers to Incredible Journey.” The educa- KAB is also making plans for its local schools. tional activity was developed by annual Solid Waste Breakfast, During a board meeting the Cleveland Stormwater which will take place Friday, Wednesday, Executive Director Department and will teach stu- March 11, at 7:30 a.m. at Joanne Maskew said efforts to dents about the water cycle. Westwood Baptist Church. The raise awareness of the programs Middle school students will also membership breakfast with the have led to more teachers inviting soon be able to enter an environ- unusual name will feature speak- KAB to their classrooms. mental video contest, while high er Cameron Fisher, chairman of “They are calling and emailing school students will be offered an the Cleveland/Bradley County me right and left,” Maskew said. essay contest. Greenway board. Completely Redesigned Web Page KAB offers a free program “We’ve got a lot of things going,” Board members discussions which teaches students about the Maskew said. during the meeting included plan- importance of protecting the envi- During the meeting, board ning for a new event taking place www.clevelandbanner.com ronment through activities like members also discussed who will in October. planting sunflower seeds. Any be the next recipient of the organi- The organization is expecting to local school teacher can ask KAB put on a masquerade ball fundraiser just in time for Visit Our What’s Happening Section Halloween. While many of the details are still being finalized, the Blood donation event event is currently set to take place Post Your Photos, Stories or Videos on the evening of Oct. 22 at the Cleveland Country Club. to host flu vaccines Board member Jim Davis, who PRINT PLUS 24/7 serves on KAB’s fundraising com- ELECTRONIC Special to the Banner mittee, said this new event is ELECTRONIC EDITIONS Nonprofit regional blood center Blood Assurance and the expected to become the organiza- ONLY Tennessee Department of Health are joining forces to create a tion’s signature annual event, tak- healthier community. ing the place of the multiple Includes full access The initiative launched earlier this year provides flu vaccines fundraisers KAB typically holds Includes full access at a mobile blood drive at Bryan College. throughout the year. on your desktop, “We’re so happy to be partnering with Blood Assurance for “We can put all our effort into tablet and mobile on your desktop, this initiative,” said Amanda Goodhard, assessment and plan- one event,” Davis said. “We really ning coordinator from the state health department’s Southeast want this to be an event people tablet and mobile Regional Office. will look forward to each year.” “Blood Assurance is as passionate as we are about keeping Board member Randall Higgins Daily & Sunday $8.95 Monthly our communities healthy, and through this partnership we can also shared how a local business (3 MONTHS) $21.25 provide two services that are vital to ensuring the health and owner is supporting KAB’s efforts. $2.95 Weekly wellness of our communities,” she added. Glassworks, which is located in (6 MONTHS) $40.25 “Through our partnership, visitors to the Cleveland donor cen- the Old Woolen Mill, is a business $1.95 Daily ter can save even more lives by getting a flu shot which helps owned by Kim Currin which sells (YEAR) $79.25 prevent the spread of the flu virus,” said Dr. Liz Culler, medical artwork and everyday items made director for Blood Assurance. from fused glass. “The flu is especially dangerous for young children, the elderly Higgins said Currin has been CCURRENT URRENT SUBSCRIBERSSUBSCRIIBERS WILLWIILL NEEDNEED TOTO FOLLOWFOLLOW and people with underlying diseases.” recycling glass from bottles found TTHESE HESE SIMPLESIIMPLE STEPSSTEPS TOTO REGISTER.REGIISTER.. Flu vaccines will be available on Friday, March 4 at the littering Mouse Creek, and she is Cleveland Blood Assurance donation center, located at 201 Keith creating a line of glass necklace Click login, then Click “Don’t Have an ID” St. S.W., between 11 a.m. and 4 p.m. All blood donors will pendants and nightlights with receive a complimentary gift and snack. them. A portion of the profits will You will then need to provide your name, email address and To be eligible to donate blood, you must be at least 17 years benefit KAB. zip code so the system can locate your newspaper account. old (16 with parental consent), weigh 110 pounds or more and For more information about be in good health. Donors are asked to drink plenty of fluids — KAB, visit http://www.cleveland- NNEWEW SSUBSCRIBERSUBSCRIBERS WWILLILL NNEEDEED TTOO CCLICKLICK ““SUBSCRIBE”SUBSCRIBE” avoiding caffeine — and eat a meal rich in iron prior to donating. bradleykab.com or call 423-559- NEW SUBSCRIBERS WILL NEED TO CLICK “SUBSCRIBE” 9789. www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 13 FRIDAY
Richard Roberts Sports Editor
Phone 472-5041 or fax 614-6529 SportS [email protected] Local teams open region play tonight
By JOE CANNON Cumberland County for an 8 Banner Assistant Sports Editor o’clock game tonight, plus White County (23-6), the 6-AAA third Five of the half dozen Bradley place teams will be in Athens this County high school basketball evening to face the Lady teams advanced to TSSAA region Cherokees (16-15). play, two of which are wearing The girls’ region semifinals will the District 5-AAA crowns. be played Monday in Cookeville, The Bradley Central girls, with the championship game set ranked sixth in the final for Wednesday. Associated Press state poll, cap- The boys will take to the hard- tured their sixth straight district wood Saturday evening with title with a buzzer-beating 3- Walker valley (19-9) looking for pointer from 5-AAA Player of the its 20th win of the season with Year Rhyne Howard, while the Cumberland County (12-17) Walker Valley boys got a 30-point coming to “The Stable” at 7 p.m. performance from senior Josh Scoring in the 80s a half dozen Jones to lead them to their third times this season, the Mustangs’ league championship in the last potent offensive combination fea- four years. tures four All-District 5-AAA Both champs, as well as dis- Team members in 6-foot-6 trict runners-up Bradley Bears Lipscomb signee Kenny Bunton and McMinn County Lady patrolling the paint while guards Cherokees will open the Region Jones, Bryce Nunnelly and 3-AAA tournaments on their Kolten Gibson lead a plethora of home courts the next two nights. 3-point bombers on the squad. Cleveland High finished third Walker Valley, which has won in the boys’ district event, while 11 of its last 13 games, has Walker Valley was fourth in the pumped in 1,888 (67.4 average) girls’ event, meaning both squads points so far this campaign, will have to hit the road for their including 161 against the Jets. region openers. Banner photo, JOE CANNON The Mustangs claimed an 81-41 The girls will go first this THE BRADLEY CENTRAL Bearettes defeated McMinn County on Monday to claim the District 5-AAA girls basketball championship. November victory in Crossville, evening with the Bearettes (27-3) Bradley hosts Stone Memorial tonight in the opening round of the Region 3-AAA tournament. The 2015-16 Bearettes are Anna Roberts, Katie plus an 80-53 win when bringing a 15-game winning Brown, Sidney Morgan, Julia Gaither, Hannah Lombard, Halle Hughes, Emma Kate Brown, Emily Peterson, Savana Davis, Missy Abbott, Cumberland County made a streak into Jim Smiddy Arena for Kaleigh Hughes, Rhyne Howard and Kailey McRee. Jason Reuter is the head coach and assistant coaches are Katie Frazier and Amy Tinsley. January visit. their Region 3 opener against With only one win in their last Stone Memorial (13-17) at 7 p.m. half dozen games, the Jets fell to “We struggled some during the Warren County 68-61 in the 6- last two games (in the district AAA consolation game Tuesday tournament), so we need to get evening. back to what we’ve done all year By virtue of winning that game, — tough defense and hitting our the Pioneers out of McMinnville shots,” proclaimed Bradley head will bring a 16-19 record into Jim coach Jason Reuter, who has Smiddy Arena Saturday evening won better them 86 percent of his against the 22-6 Bradley boys. games (163-26) since taking over Led by two-time District Player in 2010. of the Year Cole Copeland, who “Stone Memorial is one of those has averaged a double-double teams, like McMinn County (21.5 points, 11.5 rebounds) each (whom the Bearettes just beat time out this season, and senior 50-47 Monday night), is also a Bradley McCurdy (15.9 ppg), an team we’ve beaten twice this year all-district performer, the Bears by a combined 60-plus points, so have lit up the scoreboard for we can’t afford to overlook them,” 1,944 points (69.4 average), he assessed. including five tallies in the 80s In their previous meeting with this season. the Lady Panthers, Bradley Winners of 14 straight games claimed a 66-32 win in Crossville before Tuesday’s district final, and a 67-37 victory earlier this Bradley will be facing Warren month. County for the first time in the The Bearettes are tied with top- 94-year history of the Bear pro- ranked Middleton (Class A) for gram. the eighth best defense in the Making just their third region state, having given up just 35 appearance in 14 years, the points a game so far this season, Pioneers dropped a pair of regu- while sizzlin’ the strings for 1,832 lar season games to Cumberland points (61.1 average) on the other County, which the Bears defeated end of the court. twice by a combined 17 points. Bradley’s stifling defense, “We know they’ve got a 6-foot- which averages 10 steals an out- 6, 250-pound football player at ing, and explosive offense are led post and another big kid under- by a trio of All-District 5-AAA Banner photo, JOE CANNON neath as well,” reported Bradley performer, including Howard THE WALKER VALLEY Mustangs defeated Bradley Central to win the District 5-AAA boys championship Tuesday night. The Mustangs head coach Chuck Clark. (17.9 points per game, 7.7 host Cumberland County on Saturday night in the opening round of the Region 3-AAA tournament. The 2015-16 Mustangs are Wes Wagner, Should the Bears advance, rebounds per game), junior Halle Kolten Gibson, Bryar Hambright, Nathan Zakkas, Cooper Melton, Trevor Rathbun, Zeke Westfield, Zach Eslinger, Dakota Murphy, Isiah they could face second-ranked Hughes (16.6, 3.5) and senior Alston, Skylar Swafford, Bryce Nunnelly, Josh Jones, Kenny Bunton and Brady Swafford. Walker Valley’s head coach is Bob Williams and and unbeaten White County, the Julia Gaither (8.8, 2.8). assistant coaches are Will Campbell and Dine Patterson. District 6-AAA champions in the All three, plus junior teammate region semifinals Tuesday. Emma Kate Brown, averaged bet- region bracket is 6-AAA runner- eighth-ranked Cumberland behind Bradley during the regu- Valley. The 28-0 Warriors, who set a ter than 40 percent from behind up Cookeville (19-9), which will County 63-60 in the 6-AAA title lar season district play, but were The other end of the region state record by making 31 3- the 3-point line, having sunk a host the region semifinals and game and will host East Hamilton upset by McMinn County in the bracket finds Coach Paul pointers in a game against Rhea 155 during the regular season. championship games. (24-8) this evening. The Lady 5-AAA semifinals before taking Cretton’s Lady Mustangs (12-17) On the same end of the Bradley The Lady Cavaliers fell to Hurricanes finished second the consolation game over Walker climbing the mountain to See REGION, Page 15 Flame hoopsters come up ‘Short’ From Lee Sports Information and converted only six. While Shorter was going to ROME, Ga. — Host Shorter University jumped the free-throw line 21 times and making 15, the out to a 23-14 advantage at the end of the first peri- Lady Flames were awarded just eight charity tosses od and the Lady Hawks' defense never allowed the and cashed in on six. Lee Lady Flames to get on track in posting a 57-46 Lee did win the rebounding battle, 45-40. Tori hardcourt victory on Thursday evening. Lentz and Kayla Beavers had five rebounds each to Shorter's Taylor Adams and Shakierya help out Cheeks and Brown in that department. McClendon scored 43 of the Lady Hawks’ 57 points. Christina Johnson, who was saddled with early foul Adams, who was held to only seven points in the problems, pulled down four boards. loss to Lee on Jan. 16, had a huge effort in The Lady Flames will have to wait until West Thursday evening's game. She Florida and Valdosta State meet on Saturday after- produced a double-double, 23 noon to know exactly where they will be headed for points and 16 rebounds. their quarter-final game in the Gulf South McClendon hit 7-of-13 shots from Conference Tournament. If West Florida wins as the field and 5-of-6 free throws in expected, Lee travels to Pensacola finishing with 20 points. on Tuesday to face the Argonauts. "This loss is on me," said Lee coach Hawks 79, Flames 73 Marty Rowe. "I guess we didn't do a The Lee University men’s basket- ball season came to an end with a 79- Lee University photo good enough job of preparing LEE UNIVERSITY sophomore Shelby Brown, center, had a double-double with 10 points and 11 our team for a Shorter team 73 defeat at Shorter rebounds in the Lady Flames’ loss to Shorter University Thursday evening in Rome, Ga. that is very good. We had no University in the Winthrop- answer for Adams or McClendon the entire game." King Centre. The Flames end On the offensive end the Lady Flames could the season with an overall record of 10-18 and 7-15 never get in sync. Carrie Cheeks tossed in 13 points in the Gulf South Conference. and grabbed nine rebounds to try to help spark the Lee entered the contest one game behind Shorter Lady Hawks claim second SCAA Lee offense. Shelby Brown also produced a double- (14-14, 9-13 GSC) and West Alabama for the final double, 10 points and 11 rebounds, but no other spot in the GSC Tournament. With a win and a loss Lady Flame had more than six points. by UWA at West Georgia, the Flames would have championship in as many years "Our forwards kept the game from really getting earned the tie-breaker and the tournament berth. Keevin Tyus and Levi Woods each scored a game- the Lady Hawks and Knoxville straight to the hoop as Holly bad," pointed out Rowe. "We didn't get anything out Special to the Banner of our guard play tonight. We just weren't ready to high 19 points to lead the Flames. Tyus finished the The Tennessee Christian Christian. Sutton sank the field goal for the play and they spread our defense out and really did double-double with 11 rebounds. Woods made 4-of- Preparatory School Lady Hawks Ultimately, it was TCPS which first score of the game and the a good job. We never did what we were supposed to 7 shots from behind the arc and added five completed the final phase of picked up the championship, lead. This lead was short lived, do the entire game. We knew we would have to rebounds, two assists and one steal. their championship journey with a 41-38 win over Knox however, as Knoxville Christian come in and play at a high level tonight and that Rico Overall made two 3-pointers on his way to Thursday night in Rossville, Ga. Christian. marched back down the court to just didn't happen." 16 points. Chase Cullen finished with 10 rebounds The game was played between The opening tip was controlled The Lady Flames shot only 27 percent from the two SCAA North Region powers, by TCPS, who took the ball See LADY HAWKS, Page 15 field for the game. They fired up 23 3-point shots See FLAME, Page 15 14—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com
SCOREBOARD Vol AD stands by embattled Jones KNOXVILLE (AP) — Tennessee athletic director Dave Hart stood Boston 112, Milwaukee 107 Ken Duke 37-38—75 +5 by his embattled football coach New Orleans 123, Oklahoma City 119 Mark Wilson 37-38—75 +5 ON AIR Brooklyn 116, Phoenix 106 Fabian Gomez 38-37—75 +5 Thursday and said his depart- Houston 119, Portland 105 Matt Jones 33-42—75 +5 Sports on TV San Antonio 96, Utah 78 Zach Johnson 40-35—75 +5 ment doesn’t interfere with the Friday, Feb. 26 Friday’s Games Luke Donald 38-37—75 +5 school’s disciplinary process, two AUTO RACING Charlotte at Indiana, 7 p.m. Patton Kizzire 37-38—75 +5 9 a.m. Washington at Philadelphia, 7 p.m. Morgan Hoffmann 38-37—75 +5 weeks after a lawsuit alleged that FS1 — NASCAR, Xfinity Series, Heads Up Georgia 250, prac- Cleveland at Toronto, 7:30 p.m. Chad Collins 36-40—76 +6 tice, at Hampton, Ga. Orlando at New York, 7:30 p.m. Patrick Rodgers 38-38—76 +6 the university mishandles sexual 10 a.m. Chicago at Atlanta, 8 p.m. Dicky Pride 38-38—76 +6 assault complaints against ath- FS1 — NASCAR, Camping World Truck Series, Georgia 200, Denver at Dallas, 8:30 p.m. Chris Kirk 37-39—76 +6 practice, at Hampton, Ga. L.A. Clippers at Sacramento, 10 p.m. Rory Sabbatini 39-37—76 +6 letes. 11 a.m. Memphis at L.A. Lakers, 10:30 p.m. Kyle Reifers 38-38—76 +6 FS1 — NASCAR, Sprint Cup Series, Folds of Honor QuikTrip Saturday’s Games Whee Kim 33-43—76 +6 “I trust Butch Jones implicitly,” 500, practice, at Hampton, Ga. Miami at Boston, 3 p.m. Tyler Aldridge 39-37—76 +6 Hart said. “I know who he is. I 12:30 p.m. Minnesota at New Orleans, 7 p.m. Alan Morin 37-39—76 +6 FS1 — NASCAR, Xfinity Series, Heads Up Georgia 250, prac- Portland at Chicago, 8 p.m. Scott Piercy 36-41—77 +7 know what his work ethic is. I tice, at Hampton, Ga. San Antonio at Houston, 8 p.m. David Hearn 38-39—77 +7 1:30 p.m. Detroit at Milwaukee, 8:30 p.m. Tom Gillis 37-40—77 +7 know what he’s meant to this uni- FS1 — NASCAR, Camping World Truck Series, Georgia 200, Golden State at Oklahoma City, 8:30 p.m. Keegan Bradley 38-39—77 +7 versity, well beyond the depart- practice, at Hampton, Ga. Brooklyn at Utah, 9:30 p.m. Ben Crane 39-38—77 +7 2:30 p.m. Memphis at Phoenix, 9:30 p.m. Martin Laird 38-39—77 +7 ment of athletics, and I know how FS1 — NASCAR, Xfinity Series, Heads Up Georgia 250, final Top 25 Fared Johnson Wagner 38-39—77 +7 practice, at Hampton, Ga. Thursday Brian Harman 39-39—78 +8 he’s represented the university.” 4 p.m. 1. Villanova (24-4) did not play. Next: at Marquette, Saturday. Scott Stallings 39-39—78 +8 Jones was at the center of an FS1 — NASCAR, Camping World Truck Series, Georgia 200, 2. Kansas (24-4) did not play. Next: vs. Texas Tech, Saturday. Jon Curran 39-39—78 +8 final practice, at Hampton, Ga. 3. Oklahoma (22-5) did not play. Next: at No. 25 Texas, Nicholas Thompson 38-41—79 +9 amended complaint filed Adam Lau/Knoxville News Sentinel via AP 5:30 p.m. Saturday. Jason Kokrak 39-40—79 +9 FS1 — NASCAR, Sprint Cup Series, Folds of Honor QuikTrip 3. Virginia (21-6) did not play. Next: vs. No. 7 North Carolina, Zac Blair 41-39—80 +10 Wednesday. The complaint stated TENNESSEE ATHLETIC DIRECTOR Dave Hart answers ques- 500, qualifying, at Hampton, Ga. Saturday. Mark Blakefield 41-40—81 +11 former Tennessee football player COLLEGE BASKETBALL 5. Xavier (25-3) did not play. Next: at Seton Hall, Sunday. Carl Pettersson WD tions during a press conference at University of Tennessee’s Ray and 7 p.m. 6. Michigan State (23-5) did not play. Next: vs. Penn State, Leaderboard at time of suspended play Drae Bowles assisted a woman CBSSN — Bowling Green at Akron Sunday. SCORE THRU Lucy Hand Digital Studio in Knoxville Thursday. Hart stood by his ESPN2 — Valparaiso at Milwaukee 7. North Carolina (23-5) did not play. Next: at No. 3 Virginia, Michael Thompson -5 F who said she had been raped by ESPNU — Iona at Manhattan Saturday. Sergio Garcia -5 F two other players and that later he embattled football coach during the news conference Thursday at the FS1 — Harvard at Yale 8. Iowa (20-7) did not play. Next: at Ohio State, Sunday. Rickie Fowler -4 F 9 p.m. 9. Arizona (22-6) did not play. Next: at No. 22 Utah, Saturday. William McGirt -4 F was attacked by teammates and university, two weeks after a federal lawsuit was filed Feb. 9 in ESPN2 — Rider at Monmouth 10. Maryland (23-5) did not play. Next: at No. 20 Purdue, David Lingmerth -3 F Nashville alleging that Tennessee mishandles assault complaints ESPNU — Detroit Mercy at Oakland Saturday. Jimmy Walker -3 F told by Jones he had “betrayed the COLLEGE HOCKEY 11. Louisville (22-6) did not play. Next: at No. 12 Miami, George McNeill -3 F team.” against athletes. 7:30 p.m. Saturday. Shane Lowry -3 F NBCSN — Boston U. at Notre Dame 12. Miami (22-5) did not play. Next: vs. No. 11 Louisville, Justin Hicks -3 F The coach has said he only tried GOLF Saturday. 5 a.m. 13. Oregon (22-6) did not play. Next: vs. Washington, Sunday. to assist Bowles. Wednesday included a signed dec- “betrayed the team,” according to GOLF — European PGA Tour, Perth International, second 14. West Virginia (21-7) did not play. Next: at Oklahoma State, Hart, who said he couldn’t laration from Rogers confirming the complaint. It states Jones round, at Perth, Australia (same-day tape) Saturday. HOCKEY 2 p.m. 15. Duke (21-7) beat Florida State 80-65. Next: at Pittsburgh, address the specifics of the law- the accuracy of statements made called Bowles several hours later GOLF — PGA Tour, Honda Classic, second round, at Palm Sunday. National Hockey League Beach Gardens, Fla. 16. Kentucky (21-7) did not play. Next: at Vanderbilt, Saturday. EASTERN CONFERENCE suit, did say he has tremendous about him. to apologize for his comments. 1 a.m. (Saturday) 17. Iowa State (19-9) did not play. Next: vs. Kansas State, Atlantic Division empathy and sympathy for alleged GOLF — LPGA Tour, Honda Thailand, third round, at Saturday. GP WLOT Pts GF GA “My response (to Hart’s com- The woman’s report of the Chonburi, Thailand 18. Indiana (23-6) beat Illinois 74-47. Next: at No. 8 Iowa, Florida 60 35 18 7 77 167 139 victims and all victims of sexual ments) is read the lawsuit, read attack led to the arrests of former NBA BASKETBALL Tuesday. Tampa Bay 60 34 22 4 72 165 149 8 p.m. 19. Baylor (20-8) did not play. Next: at TCU, Saturday. Boston 61 33 22 6 72 190 170 assault across the country. the declarations under oath under linebacker A.J. Johnson and ESPN — Chicago at Atlanta 20. Purdue (21-7) did not play. Next: vs. No. 10 Maryland, Detroit 61 30 20 11 71 153 158 “It is simply an unacceptable 10:30 p.m. Saturday. Ottawa 62 29 27 6 64 179 192 penalty of perjury, and we’ll go defensive back Michael Williams, ESPN — Memphis at L.A. Lakers 21. Texas A&M (21-7) did not play. Next: at Missouri, Saturday. Montreal 61 29 27 5 63 167 168 act,” Hart said, adding that uni- from there,” said David Randolph who were indicted on aggravated SOCCER 22. Utah (22-7) beat Arizona State 81-46. Next: vs. No. 9 Buffalo 61 24 30 7 55 144 167 2:20 p.m. Arizona, Saturday. Toronto 59 21 28 10 52 145 176 versity Chancellor Jimmy Cheek Smith, the lawyer representing rape charges in February 2015. FS1 — Bundesliga, Hertha BSC Berlin at Koln 23. Notre Dame (19-8) did not play. Next: at Florida State, Metropolitan Division has made this his top priority. WOMEN’S COLLEGE BASKETBALL Saturday. GP WLOT Pts GF GA the plaintiffs. Hart said Thursday that “obvious- 9 p.m. 24. SMU (23-4) beat Memphis 69-62. Next: vs. Tulane, Washington 59 44 11 4 92 197 137 “This has to gain the attention of Hart said he was proud of the ly we’re concerned” with the num- FS1 — Xavier at Villanova Sunday. N.Y. Rangers 61 35 20 6 76 175 156 Sunday, Feb. 28 25. Texas (18-10) did not play. Next: vs. No. 3 Oklahoma, N.Y. Islanders 59 33 19 7 73 170 146 everyone.” athletic department’s culture but ber of sexual assault complaints AUTO RACING Saturday. Pittsburgh 59 30 21 8 68 155 156 Hart added that Tennessee ath- 1 p.m. Women’s Top 25 Fared New Jersey 62 30 25 7 67 139 149 acknowledged improvement is made against Tennessee football FOX — NASCAR, Sprint Cup Series, Folds of Honor QuikTrip Thursday Carolina 62 28 24 10 66 152 164 letes who have allegedly commit- needed. players the last two years. 500, at Hampton, Ga. 1. UConn (27-0) did not play. Next: vs. Tulane, Saturday. Philadelphia 60 27 22 11 65 148 163 COLLEGE BASKETBALL 2. Notre Dame (27-1) beat Clemson 71-52. Next: vs. Boston Columbus 62 25 29 8 58 162 191 ted a crime don’t get treated any “We should take a leadership The amended complaint includ- Noon College, Saturday. WESTERN CONFERENCE differently than general students BTN — Penn St. at Michigan St. 3. South Carolina (27-1) beat Mississippi 66-45. Next: vs. LSU, Central Division role in trying to address (sexual ed an affidavit from Bowles that 12:30 p.m. Sunday. GP WLOT Pts GF GA facing the same circumstances. assault),” Hart said. “That has stated the allegations in the suit FS1 — Xavier at Seton Hall 4. Baylor (28-1) did not play. Next: at Kansas State, Saturday. Dallas 62 38 18 6 82 202 178 1 p.m. 5. Ohio State (23-5) did not play. Next: at No. 20 Michigan Chicago 63 38 20 5 81 177 151 “We are not the judge and jury,” been our intent and will remain “are true with respect to the state- CBSSN — Houston at UConn State, Saturday. St. Louis 63 35 19 9 79 157 152 Hart said. “We have to remember 2 p.m. 6. Maryland (26-3) beat Wisconsin 83-77. Next: vs. Minnesota, Nashville 62 30 21 11 71 162 158 our intent. We’re not perfect. We’re ments and descriptions of events CBS — Duke at Pittsburgh Sunday. Colorado 63 32 27 4 68 169 176 that each person is entitled to due far from it. I think anybody that pertaining to me.” 2:30 p.m. 7. Oregon State (24-3) did not play. Next: at No. 13 Stanford, Minnesota 61 27 24 10 64 159 155 FS1 — St. John's at Creighton Friday. Winnipeg 60 26 30 4 56 158 179 process. We don’t engage in that. would claim they’ve got everything Bowles transferred to 3 p.m. 8. Texas (25-2) did not play. Next: vs. TCU, Saturday. Pacific Division We don’t engage in the investiga- CBSSN — Tulane at SMU 9. Arizona State (24-4) did not play. Next: at Southern Cal, GP WLOT Pts GF GA under control is probably drifting Chattanooga after the 2014 sea- 4 p.m. Friday. Los Angeles 60 36 20 4 76 161 139 tions that take place, be they with around with blinders on.” son. CBS — Iowa at Ohio St. 10. Louisville (23-6) beat No. 17 Miami 79-51. Next: vs. Anaheim 59 32 19 8 72 147 141 ESPNU — Tulsa at Memphis Pittsburgh, Sunday. San Jose 59 32 21 6 70 177 161 law enforcement or student con- Outside the studio where Hart “The assertion that I ever 6 p.m. 11. Texas A&M (21-7) beat Auburn 57-49. Next: vs. No. 15 Vancouver 60 24 24 12 60 147 171 duct. That’s not our role.” BTN — Michigan at Wisconsin Kentucky, Sunday. Arizona 61 27 28 6 60 166 188 was speaking, about 20 students attempted to belittle or demean a 6:30 p.m. 12. Florida State (22-6) beat N.C. State 56-52. Next: vs. No. 17 Calgary 60 26 30 4 56 162 184 The lawsuit, which was filed gathered in protest. They carried young man for taking action to ESPNU — Virginia Tech at Wake Forest Miami, Sunday. Edmonton 62 22 34 6 50 152 190 8 p.m. 13. Stanford (22-6) did not play. Next: vs. No. 7 Oregon State, NOTE: Two points for a win, one point for overtime loss. Feb. 9 in Nashville, states signs bearing such messages as help another person is absolutely BTN — Minnesota at Illinois Friday. Wednesday’s Games Tennessee has violated Title IX FS1 — Southern Cal at California 14. UCLA (20-7) did not play. Next: vs. Arizona, Friday. Colorado 4, San Jose 3, SO “Stop UT Rape Culture” and false,” Jones said in a statement 8:30 p.m. 15. Kentucky (20-6) beat No. 24 Missouri 69-59. Next: at No. Montreal 4, Washington 3 regulations and created a “hostile chanted “Vols For Jane,” in refer- late Wednesday night. “To the ESPNU — Washington at Oregon 11 Texas A&M, Sunday. Boston 5, Pittsburgh 1 DRAG RACING 16. Mississippi State (23-6) beat Vanderbilt 65-59. Next: vs. Anaheim 1, Buffalo 0 sexual environment” through a ence to the eight “Jane Does” list- contrary, I did all I could to assist 5 p.m. Alabama, Sunday. Thursday’s Games policy of indifference toward FS1 — NHRA, Carquest Auto Parts Nationals, finals, at 17. Miami (22-6) lost to No. 10 Louisville 79-51. Next: at No. 12 Philadelphia 3, Minnesota 2 ed as plaintiffs in the lawsuit. the former student in question. Phoenix Florida State, Sunday. Columbus 6, New Jersey 1 assaults by athletes. It also states According to the amended com- During the course of the judicial GOLF 18. Syracuse (23-6) beat Boston College 71-55. Next: ACC Toronto 3, Carolina 1 5 a.m. Tournament. Florida 3, Arizona 2 the school interfered with the dis- plaint, a woman called 911 from process, campus officials, as well GOLF — European PGA Tour, Perth International, final round, 19. DePaul (23-7) did not play. Next: at Marquette, Saturday. N.Y. Rangers 2, St. Louis 1 ciplinary process to favor male at Perth, Australia 20. Michigan State (21-7) did not play. Next: vs. No. 5 Ohio Nashville 3, Chicago 1 Bowles’ car to report a rape in the as the young man’s own words, 1 p.m. State, Saturday. Winnipeg 6, Dallas 3 athletes. The suit now includes early morning hours of Nov. 16, will clearly establish that I have GOLF — PGA Tour, Honda Classic, final round, at Palm Beach 21. South Florida (20-7) did not play. Next: vs. Temple, N.Y. Islanders 2, Calgary 1, OT Gardens, Fla. Saturday. Vancouver 5, Ottawa 3 eight unidentified women as 2014. done nothing wrong. 3 p.m. 22. Oklahoma State (20-7) did not play. Next: at West Virginia, Los Angeles 2, Edmonton 1 plaintiffs. NBC — PGA Tour, Honda Classic, final round, at Palm Beach Saturday. Friday’s Games The complaint also states that “I will fight all of these false Gardens, Fla. 23. Oklahoma (18-9) did not play. Next: vs. Iowa State, Tampa Bay at New Jersey, 7 p.m. According to the suit, Tim Bowles suffered a bloody lip when attacks on my character, and I NBA BASKETBALL Saturday. Minnesota at Washington, 7 p.m. 7 p.m. 24. Missouri (21-7) lost to No. 15 Kentucky 69-59. Next: vs. Boston at Carolina, 7 p.m. Rogers stepped down as teammate Curt Maggitt punched know that once this process has NBA — Minnesota at Dallas Vanderbilt, Sunday. Edmonton at Anaheim, 10 p.m. Tennessee’s vice chancellor in NHL HOCKEY 25. Colorado State (25-1) did not play. Next: vs. Nevada, Buffalo at San Jose, 10:30 p.m. him in the mouth later that day been completed, my reputation 12:30 p.m. Saturday. Saturday’s Games 2013 “in protest over the violation and that he was confronted by will be affirmed.” NBC — Washington at Chicago Arizona at Philadelphia, 1 p.m. 6:30 p.m. Winnipeg at Pittsburgh, 3 p.m. of Title IX and the UT administra- teammates Geraldo Orta and Tennessee’s lawyer, Bill NBCSN — Tampa Bay at Boston Florida at Columbus, 3 p.m. tion’s and athletic department’s Marlin Lane the following day. Ramsey, issued a statement 9 p.m. GOLF St. Louis at Nashville, 3 p.m. NBCSN — Los Angeles at Anaheim N.Y. Rangers at Dallas, 4 p.m. deliberate indifference to the clear Bowles called Jones to tell him Wednesday saying that the uni- SOCCER PGA Tour-Honda Classic Par Scores Toronto at Montreal, 7 p.m. 9 a.m. Thursday Detroit vs. Colorado at Denver, CO, 8 p.m. and present danger of sexual about being punched, and Jones versity has reviewed the amended NBCSN — Premier League, Arsenal at Manchester United At PGA National Resort and Spa, The Champion Ottawa at Calgary, 10 p.m. 9:20 a.m. Palm Beach Gardens, Fla. Buffalo at Los Angeles, 11 p.m. assaults by UT athletes.” The said he was very disappointed in complaint “and we continue to FS2 — Bundesliga, Borussia Mönchengladbach at Augsburg Purse: $6.1 million amended complaint submitted Bowles and that the receiver had stand by our actions.” 11:30 a.m. Yardage: 7,140; Par 70 (35-35) FS2 — Bundesliga, Bayer 04 Leverkusen at F.S.V. Mainz Partial First Round WOMEN'S COLLEGE BASKETBALL Sergio Garcia 31-34—65 -5 LOCAL NOTES 1 p.m. Michael Thompson 31-34—65 -5 ESPN2 — Game TBA William McGirt 32-34—66 -4 BASEBALL 2 p.m. Rickie Fowler 32-34—66 -4 BASEBALL INSTRUCTION Bama snaps schneid to Lady Vols BTN — Michigan at Rutgers George McNeill 32-35—67 -3 Cleveland State Community College assistant baseball ESPNU — Game TBA Shane Lowry 34-33—67 -3 coach Ryne Foster will be offering baseball instruction and les- SEC — Vanderbilt at Missouri David Lingmerth 32-35—67 -3 sons for individuals or small groups. Lessons will be offered on From UT Sports Information 18-1 against the Crimson Tide in Tuscaloosa. 3 p.m. Jimmy Walker 34-33—67 -3 weeknights and weekends for hitting, catching, infield play, out- The Lady Vols had won the previous 42 games in ESPN2 — Game TBA Justin Hicks 33-34—67 -3 field play and pitching. For times and pricing, contact coach FS2 — Creighton at St. John's Jason Dufner 35-33—68 -2 Foster at (317)650-1064 or email rfoster01@clevelandstate- TUSCALOOSA, Ala. — Bashaara Graves led the UT-Alabama series entering Thursday's game. 4 p.m. Si Woo Kim 37-31—68 -2 cc.edu. BTN — Northwestern at Nebraska Adam Hadwin 33-35—68 -2 BASKETBALL Tennessee with 15 points, but the Lady Vols could Graves moves ESPN — Game TBA Erik Compton 33-35—68 -2 TEAM POWER not battle back from an 11-point halftime deficit, up career lists SEC — Mississippi at Arkansas Sean O’Hair 34-35—69 -1 Team Power is looking for seventh-grade girls interested in 5 p.m. Justin Thomas 33-36—69 -1 playing travel basketball. For more information, contact Nathan falling to Alabama, 54-46, on Thursday at Foster Graves collected eight rebounds in the game and ESPN2 — Minnesota at Maryland Phil Mickelson 37-32—69 -1 Cox at (423)618-0942. Auditorium. now has 979 for her career. She passed Tennessee Paul Casey 34-35—69 -1 KILBY INDIVIDUAL INSTRUCTION Sam Saunders 31-38—69 -1 Individual basketball instruction for male and female ele- The loss ended Tennessee's (16-12, 7-8 SEC) 42- legend Candace Parker (972 from 2005-08) for sixth Ollie Schniederjans 34-35—69 -1 mentary, middle school, high school and post graduate ath- ON TAP Greg Owen 35-34—69 -1 letes is being offered by former Junior College and Universtiy game winning streak against Alabama (15-13, 4-11) place on Tennessee's all-time rebounding list. She Darron Stiles 33-36—69 -1 Friday, Feb. 26 coach L.J. Kilby. Coach Kilby brings 10 years of head coaching and marked the Lady Vols' first-ever loss in is 15 away from Mary Ostrowski (994 from 1980- Vijay Singh 33-36—69 -1 experience as well as 30 years experience in junior college, BASKETBALL Cameron Tringale 34-36—70 E Region 3-AAA Tournament NAIA and NCAA Division I basketball. For more information, Tuscaloosa. UT's last loss to Alabama entering 84) and fifth place. Scott Brown 35-35—70 E contact Coach Kilby at (423)596-2515. Girls’ quarterfinals Brendon de Jonge 37-33—70 E Thursday was on March 3, 1984. With 15 points, Graves also passed Shelia Collins Stone Memorial at Bradley Central, 7 Stuart Appleby 35-35—70 E FISHING White County at McMinn County, 7 Smylie Kaufman 34-36—70 E CLEVELAND BASSMASTERS Graves finished with 15 points and eight (1,423 points from 1981-85) for 25th place on UT's Walker Valley at Cumberland County, 8 Adam Scott 34-36—70 E The Cleveland Bassmasters meet the first Thursday of rebounds. Mercedes Russell recorded a double- all-time scoring list. Graves now has 1,428 career East Hamilton at Cookeville, 8 Russell Knox 35-35—70 E each month at South Cleveland United Methodist Church at 7 Saturday, Feb. 27 Brooks Koepka 36-34—70 E p.m. Cleveland Bassmasters includes boaters and non- double with 10 points and 11 rebounds. Jaime points and is 30 points away from Cindy Brogdon BASEBALL Gary Woodland 35-35—70 E boaters and are associated with FLW. The club fishes and Lee University at Delta State (Miss.) University (DH), 2 Blayne Barber 35-35—70 E holds tournament on Chickamauga Lake, Nickajack Lake, Nared added 13 points and seven boards. (1,458 from 1977-79) and 24th place. BASKETBALL Ricky Barnes 33-37—70 E Lake Guntersville, Lake Weiss, Watts Bar and Neely Henry. Alabama's Karla Middlebrook scored 12 of her 13 Double-double for Russell Region 3-AAA Tournament Will Wilcox 35-35—70 E Dues for the Bassmasters are $35 quarterly. Other fees Boys’ quarterfinals Chesson Hadley 31-39—70 E include $35 FLW joining fee, $8 insurance, $20 per year for points in the first half. Hannah Cook had a double- With 10 points and 11 rebounds, Russell picked Warren County at Bradley Central, 7 Anirban Lahiri 36-34—70 E biggest largemouth or smallmouth bass and $15 for tourna- Cumberland County at Walker Valley, 7 Derek Fathauer 34-36—70 E ment largemouth or smallmouth prize. For more information, double with 10 points and 10 rebounds. up her 10th double-double of the season, tying Cleveland at Cookeville, 8 Harold Varner III 33-37—70 E contact Dewayne Lowe at 423-715-5772. Late in the game, Tennessee went on an 8-0 run Debbie Groover and Karla Horton for the fourth- McMinn County at White County, 8 Tom Hoge 34-36—70 E SOCCER SOFTBALL Hudson Swafford 37-34—71 +1 to pull to within 45-42. Mercedes Russell scored on most by a UT sophomore. Lee University at Delta State (Miss.) University (DH), 3 Matthew Fitzpatrick 37-34—71 +1 GCSA SOCCER Sunday, Feb. 28 Daniel Summerhays 36-35—71 +1 Registration for the Spring 2016 soccer season at The a fast-break layup with 2:21 remaining to make it a Russell is the 15th player to record 10 double- BASEBALL Steve Wheatcroft 36-35—71 +1 Greater Cleveland Soccer Association is now available online Lee University at Delta State (Miss.) University, 3 Tyrone Van Aswegen 33-38—71 +1 at www.GRCSAFC.com. Athletes may register online through one-possession game. Alabama outscored UT, 9-4, doubles in a season, a feat that has been accom- SOFTBALL Hideki Matsuyama 37-34—71 +1 Feb. 29. to close the game. plished 22 times in school history. Lee University at Delta State (Miss.) University, 2 Retief Goosen 34-37—71 +1 SOFTBALL Dawie van der Walt 36-35—71 +1 ASA UMPIRES MEETINGS Tennessee struggled in the first half, going 6-of- Russell is 10th among active players in double- Ernie Els 37-34—71 +1 The Bradley/Cleveland Softball Umpires Association is 30 from the floor and 0-of-7 from 3-point range. doubles with all 10 in her career coming this sea- Ian Poulter 34-37—71 +1 recruiting umpires and scorekeepers for the upcoming season. BASKETBALL Mark Hubbard 35-36—71 +1 Training will be provided. The association will be holding pre- The Crimson Tide shut out the Lady Vols over the son. Sung Kang 36-35—71 +1 season meetings at the Cleveland Community Center on National Basketball Association John Huh 38-33—71 +1 first 5:28 of the second quarter to build a six-point Up next EASTERN CONFERENCE South Church Street on the following dates: March 3 at 6 p.m.; Scott Pinckney 33-38—71 +1 March 13 at 2 p.m.; March 24 at 6 p.m. and April 3 at 2 p.m. Atlantic Division Jerry Kelly 36-35—71 +1 lead at 20-14 and limited UT to three points in the The Lady Vols conclude their regular-season WLPct GB For more information, contact Randy Moore at 504-3839 or Alex Cejka 36-35—71 +1 Rita Hannah at 559-3322. quarter. Alabama took a 28-17 into halftime. schedule against Georgia Sunday at Thompson- Toronto 38 18 .679 — Ben Martin 36-35—71 +1 Boston 34 25 .576 5½ John Senden 35-36—71 +1 Alabama led 14-13 after the first quarter. Nikki Boling Arena. Tip-off is slated for 1 p.m. on ESPN2. New York 24 35 .407 15½ Davis Love III 36-35—71 +1 Hegstetter hit a jumper with four seconds left to Tennessee is 49-15 all-time against Georgia and Brooklyn 16 42 .276 23 Graeme McDowell 35-36—71 +1 TRANSACTIONS Philadelphia 8 49 .140 30½ Jason Bohn 35-36—71 +1 give the Crimson Tide the lead. 20-4 all-time against the Lady Bulldogs in Southeast Division Andrew Loupe 35-36—71 +1 Thursday’s Sports Transactions WLPct GB Andy Sullivan 36-35—71 +1 BASEBALL Series vs. Alabama Knoxville. UT has won the last nine games in the Miami 32 25 .561 — Will MacKenzie 34-37—71 +1 American League Atlanta 31 27 .534 1½ Lucas Glover 35-36—71 +1 BALTIMORE ORIOLES — Designated 1B/OF Efren Navarro Tennessee is 49-3 all-time against Alabama and series. Charlotte 29 27 .518 2½ Freddie Jacobson 37-35—72 +2 for assignment. Agreed to terms with RHP Yovani Gallardo on Washington 26 30 .464 5½ Emiliano Grillo 38-34—72 +2 a two-year contract. Orlando 25 31 .446 6½ Camilo Villegas 35-37—72 +2 DETROIT TIGERS — Agreed to terms with LHPs Blaine Hardy Central Division Kevin Kisner 36-36—72 +2 and Jairo Labourt, C James McCann, INFs Nick Castellanos WLPct GB Vandy pushes for NCAA berth Pat Perez 34-38—72 +2 and Dixon Machado, OF Wynton Bernard and RHPs Jeff Cleveland 41 15 .732 — Tony Finau 38-34—72 +2 Ferrell, Michael Fulmer, Shane Greene, Montreal Robertson, Indiana 31 26 .544 10½ Jeff Overton 37-35—72 +2 Jose Valdez, Drew VerHagen and Alex Wilson on one-year By The Associated Press recently before losing three of eighth in the SEC in scoring Chicago 30 26 .536 11 Brett Stegmaier 35-37—72 +2 contracts. Detroit 29 29 .500 13 Charles Howell III 34-38—72 +2 KANSAS CITY ROYALS — Agreed to terms with LHP Scott their last four games. That stretch (16.3), third in rebounding (9.4) Milwaukee 24 34 .414 18 Angel Cabrera 36-36—72 +2 Alexander; RHPs Miguel Almonte, Alec Mills and Kyle Zimmer; Here are a few things to watch includes home losses to Alabama and second in blocks (2.3). He’s WESTERN CONFERENCE Brendon Todd 34-38—72 +2 INFs Cheslor Cuthbert and Raul Mondesi; and OFs Jorge Southwest Division Rory McIlroy 36-36—72 +2 Bonifacio, Brett Eibner, Terrance Gore, Jose Martinez and this week in Southeastern and Vanderbilt. In an 87-74 loss also shooting 56.2 percent from WLPct GB Geoff Ogilvy 35-37—72 +2 Bubba Starling on one-year contracts. San Antonio 49 9 .845 — Graham DeLaet 35-37—72 +2 TORONTO BLUE JAYS — Agreed to terms with OF Domonic Conference basketball: to Vanderbilt, the Gators gave up the field. Memphis 33 23 .589 15 Jamie Donaldson 36-36—72 +2 Brown on a minor league contract. GAME OF THE WEEKEND: No. their highest single-game point NUMBERS GAME: Kentucky Dallas 30 28 .517 19 Boo Weekley 37-36—73 +3 National League Houston 29 29 .500 20 Peter Malnati 37-36—73 +3 ARIZONA DIAMONDBACKS — Agreed to terms with RHP 16 Kentucky at Vanderbilt: The total since a 104-91 double-over- has scored at least 76 points in 11 New Orleans 23 34 .404 25½ Branden Grace 35-38—73 +3 Edgar Martinez on a minor league contract. Northwest Division Billy Horschel 34-39—73 +3 CHICAGO CUBS — Traded OF Chris Coghlan to Oakland for Commodores (17-11, 9-6 SEC) time victory over Georgia in straight SEC regular-season WLPct GB Robert Streb 34-39—73 +3 RHP Aaron Brooks. Placed LHP Zac Rosscup on the 60-day have resuscitated their NCAA January 2011. Florida visits games for the first time since Oklahoma City 41 17 .707 — Kyle Stanley 36-37—73 +3 DL. Agreed to terms with OF Dexter Fowler on a one-year con- Portland 30 28 .517 11 Francesco Molinari 34-39—73 +3 tract. Tournament hopes by winning slumping LSU, hosts Kentucky 1995-96. ... At least one Kentucky Utah 28 29 .491 12½ Luke List 37-36—73 +3 American Association Denver 23 35 .397 18 Spencer Levin 34-39—73 +3 GARY SOUTHSHORE RAILCATS — Traded INF Dustin four of their last five games, and travels to Missouri in its last player has scored 20 points in 18 Minnesota 18 40 .310 23 Stewart Cink 35-38—73 +3 Geiger to Wichita for a player to be named and cash and RHP including an 87-74 victory at three regular-season matchups. straight games. The last time that Pacific Division Padraig Harrington 36-37—73 +3 Matt Sergey to Laredo for a player to be named and cash. WLPct GB Daniel Berger 37-36—73 +3 JOPLIN BLASTERS — Traded RHP Jorge Martinez to York for Florida on Tuesday. They can give The Gators’ leading scorer — happened was in 1989-90, when Golden State 52 5 .912 — Steve Marino 34-39—73 +3 a player to be named. L.A. Clippers 37 20 .649 15 Ryan Palmer 35-38—73 +3 TEXAS AIRHOGS — Signed RHP Mark Pope. their postseason hopes a boost by Dorian Finney-Smith — has shot the streak reached 21 games. ... Sacramento 24 32 .429 27½ Jonas Blixt 36-38—74 +4 WICHITA WINGNUTS — Signed RHP Jon Link, LHP Anthony knocking off the SEC-leading just 8 of 33 from the field over his Missouri has lost 25 consecutive Phoenix 14 44 .241 38½ Jamie Lovemark 38-36—74 +4 Capra and OF Brent Clevlen. L.A. Lakers 11 48 .186 42 Russell Henley 37-37—74 +4 WINNIPEG GOLDEYES — Signed RHP Eric Sim. Wildcats. Vanderbilt could use a last three games. road games. ... Ole Miss guard Wednesday’s Games Patrick Reed 36-38—74 +4 BASKETBALL Cleveland 114, Charlotte 103 Brendan Steele 37-37—74 +4 National Basketball Association second straight huge performance PLAYER TO WATCH: Arkansas Stefan Moody leads the league Indiana 108, New York 105 Jim Herman 36-38—74 +4 BROOKLYN NETS — Waived G Joe Johnson. from Damian Jones, who scored a F Moses Kingsley: The 6-foot-10 with 23 points per game. He’s Toronto 114, Minnesota 105 Carlos Ortiz 35-39—74 +4 MEMPHIS GRIZZLIES — Reassigned F Jarell Martin to Iowa Golden State 118, Miami 112 Matt Every 35-39—74 +4 (NBADL). career-high 27 points and shot 12 junior from Nigeria has four scored at least 10 points in all 27 Detroit 111, Philadelphia 91 Robert Allenby 35-39—74 +4 MINNESOTA TIMBERWOLVES — Waived G Andre Miller. Chicago 109, Washington 104 Chad Campbell 35-39—74 +4 WASHINGTON WIZARDS — Signed F J.J. Hickson. of 13 against Florida. straight double-doubles, giving games he’s played and scored at Memphis 128, L.A. Lakers 119 Seung-Yul Noh 35-40—75 +5 Women’s National Basketball Association LOOKING AHEAD: Florida is him 15 for the season. He had 21 least 20 points 21 times. Oklahoma City 116, Dallas 103 Mike Weir 36-39—75 +5 MINNESOTA LYNX — Signed G Katerina Elhotova. San Antonio 108, Sacramento 92 Bernd Wiesberger 39-36—75 +5 FOOTBALL looking to stop its recent slide. points, 12 rebounds, four assists ON THE WOMEN’S SIDE: Denver 87, L.A. Clippers 81 Chris Stroud 36-39—75 +5 Canadian Football League Thursday’s Games Colt Knost 36-39—75 +5 WINNIPEG BLUE BOMBERS — Signed RB Martese The Gators (17-11, 8-7) seemed in and three blocks Tuesday in an Golden State 130, Orlando 114 Hiroshi Iwata 38-37—75 +5 Jackson. good position for an NCAA bid 85-65 rout of LSU. Kingsley ranks See VANDY, Page 15 www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 15 FIFA starts voting for new president ZURICH (AP) — Soccer leaders have started Infantino spoke in several languages with- erations passed wide-ranging reforms to pro- voting in Friday’s election for a new FIFA out notes and portrayed himself as a leader tect against corruption and curb the powers president, with Asian confederation head for the world, not just his own wealthy con- of its new president. Sheikh Salman of Bahrain the favorite to suc- federation. Those include preventing presidents from ceed Sepp Blatter. “We have to get Europe to do much more,” serving more than three four-year terms, Four candidates are in the contest after Infantino said. reducing their powers and guaranteeing more South African businessman Tokyo Sexwale The other candidates are Prince Ali of independent oversight for FIFA’s decision- withdrew at the end of a lively, funny and Jordan, who conceded to Blatter after a first- making and spending. The executive commit- unscripted speech to the 207 eligible voters. round vote last year, and former FIFA official tee will be renamed the FIFA Council with “My campaign is suspended as of now,” Jerome Champagne of France. more female members while there will be said Sexwale, who pledged himself ready to “You do not deserve leadership marked by stricter integrity checks will also control top serve the winner and received a standing ova- controversy ... empty promises, fear and con- officials. tion from many delegates. demnation,” Prince Ali said in the first The vote was taken after the Palestine fed- Sexwale, a former anti-apartheid activist address by the candidates. eration argued for a delay to let the new pres- who turns 63 on March 5, revealed during Speaking right after the prince, Sheikh ident lead the process. Blatter ordered the his 15-minute speech that his son was born Salman quickly aimed a barb at Prince Ali for reform review in June after American and three days earlier. reading from notes. Swiss federal investigations hit FIFA. Sheikh Salman is expected to have the The sheikh won applause when he said it FIFA and its lawyers hope the reform will biggest tally in the first round vote, which was “better to speak from the heart rather help show U.S. prosecutors the soccer body could last two hours. A two-thirds majority of than be dictated through a paper.” is serious about changing its culture, and 138 is needed for outright victory. The winner will take over a wealthy but protect its status as a victim in the American Backed by most voters in Asia and Africa, vulnerable soccer body rocked by escalating investigation. A total of 41 people and mar- the Bahraini royal would likely have the corruption scandals. keting agencies have been indicted or made momentum for victory if he gets at least 104 Blatter was re-elected for a fifth term in guilty pleas, and Blatter is a target. votes. That would be a winning simple major- May but bowed to pressure four days later Still, the new era FIFA hopes for will not ity in the second round. and announced he would resign. Blatter was easily escape the fallout from Blatter’s scan- Still, a strong late push was made by subsequently banned for six years for finan- dal-hit leadership. Gianni Infantino, the Swiss general secretary cial mismanagement and was absent Friday “We will set up a FIFA that is more trans- of European governing body UEFA, who was after 40 years as a fixture at FIFA meetings. parent,” interim president Issa Hayatou said already expected to be Sheikh Salman’s main Before electing FIFA’s first new president in a speech. “It will win back the respect of rival. since 1998, 87 percent of the 207 voting fed- everybody throughout the world.”
AP photo Braves hope newcomer can boost offense SERGIO GARCIA, of Spain, tees off on the 17th hole during the first round of the Honda Classic Thursday in Palm Beach Gardens, KISSIMMEE, Fla. (AP) — If the base percentage can be better,” before the workout. “We begged luncheon on Aug. 19 and will be Fla. Garcia shot a 5-under-par 65 to tie Michael Thompson for the Atlanta Braves are going to get he said. “It’s not like last year (Aaron) and begged him to come honored before that night’s game out of the bottom of the National (.338) was bad, but I feel like as a out,” the manager said. “To have against Washington. lead heading into today’s second round. League scoring stats, they might leadoff guy and a guy that wants him in the locker room is really a Schuerholz is beginning his have to start at the top of the bat- to be on base, it’s got to be better special treat for us.” . . . Carolina 26th season with the Braves. ting order. and that’s what I’m going to work Panthers tight end Greg Olsen, a With Schuerholz the team’s gen- Garcia, Thompson tied It’s a big part of the reason they on in spring training games.” friend of new Braves infielder eral manager, the Braves won the acquired Ender Inciarte from Switch-hitting shortstop Erick Gordon Beckham, attended the 1995 World Series and 14 Arizona in December. Aybar, another winter trade workout. . . . The Braves will open straight division titles. He was for Honda Classic lead “If you look at our lineup, we acquisition, is another leadoff their exhibition season Tuesday Kansas City’s GM when the really don’t have that many candidate. But Gonzalez intends against the Baltimore Orioles. Royals won the 1985 World PALM BEACH GARDENS, Fla. side of the island than getting out options,” manager Fredi Gonzalez to give Inciarte the first shot, at Atlanta Braves president John Series. He became the first GM to (AP) — Sergio Garcia made an of the water,” Garcia said. “The said Thursday after the team’s least against right-handed pitch- Schuerholz and former Gold win titles with American League eagle, avoided an alligator and ball, I could see probably half of first full-squad workout of spring ing. Glove-winning center fielder and National League teams. wound up in a share of the lead it, so I knew that I could get it training, “but I think Inciarte “He puts the ball in play, he’s Andruw Jones will be inducted Jones won 10 Gold Glove Thursday in the Honda Classic. out. Almost made 4, which would gives us a really good option.” got some speed, he hit .300,” into the team’s Hall of Fame this Awards and made five All-Star Garcia holed out with an 8-iron have been a great 4. I’m not going That fits fine with Inciarte. Gonzalez said. “Just from playing summer. teams in 12 seasons with the from 142 yards into the wind on to lie, I was happy with a 5.” “I love it,” he said. “I like to play against him, he seems like one of The Braves said Wednesday Braves. He finished his major the second hole for an eagle, and And he was happy with other the small game. I like to run a lot those guys who’s always in the the two will be inducted in a league career with 434 homers. he narrowly missed an eagle putt 60 strokes he took on a typical and be able to bunt, be able to do middle of something or starting on the 18th hole at PGA National. windy day at PGA National. different good things at the something.” The Spaniard shot 5-under 65 Garcia missed the cut last plate.” Gonzalez was encouraged by and shared the lead with Michael week at Riviera, two days in The 25-year-old center fielder the early swings of 32-year-old Relaxed A-Rod ready Thompson, the 2013 Honda which he said he did nothing well. hit .303 in his second major Nick Markakis and 35-year-old Classic winner, who also birdied Hardly anything went wrong for league season, leading off in 101 Nick Swisher. Markakis is return- for diamond season the last hole. him in the Honda Classic, and of the 116 games he started. He ing from back surgery and They were one shot ahead of even when it did, he managed to didn’t have much of an offseason Swisher had knee surgery. TAMPA, Fla. (AP) — Alex the Yankees’ first full-squad Rickie Fowler and William avoid trouble. Garcia had to play after being informed of the five- Catcher A.J. Pierzynski is Rodriguez arrived at spring train- workout. “Liberating to come into McGirt. a 40-yard hook from the rough player trade that sent pitcher encouraged early in spring train- ing feeling relaxed. the season not carrying all the The biggest excitement for left of the 10th fairway to just Shelby Miller to the ing. He reported last February after luggage along with me all off sea- Garcia was on the par-4 sixth short of the green for a simple Diamondbacks. “I’m sure there are people missing 2014 while serving a son. I’m in a good place.” hole, where he made his lone par. “I don’t like to stop hitting,” he around who don’t believe we’re suspension for violations of base- There was no smattering of bogey. Fowler had the only bogey-free said. “I swing every single day any good,” the 39-year-old ball’s drug agreement and labor boos Thursday from several hun- His tee shot found the water round, which included a chip-in when I’m in Venezuela, then in Pierzynski said, “but at the end of contract. And he was sidelined dred fans present at left of the fairway, shallow for par on the 10th hole. McGirt January I go to Tampa and do the day all you can do is control for most of 2013 following hip Steinbrenner Field, unlike a year enough for him to roll up his was more on the wild side by some workout preparation, phys- yourself and your team. If it does- surgery. earlier as A-Rod walked out of the pants and try to play it out to the making seven birdies. ical stuff, to take care of my n’t work out, it doesn’t work out. This year, no such issues for first-base dugout for batting fairway. That part was easy. He “Anything in the red is good speed and reaction and come It’s not we came in this year and the 40-year-old, coming off his practice. looked over his shoulder because around this place,” McGirt said. here 200 percent ready to go.” said, ‘Hey, we’re the World Series first season as a full-time desig- “Look, I made some big mis- of an alligator on the island, mak- “At 4 under, I would say it was Inciarte joins a team that favorites.’ But we honestly believe nated hitter. He called last spring takes, and that’s never going to ing sure it wasn’t going anywhere bordering on great. This place is scored only 573 runs in 2015, the we can compete every game and training “an extremely challeng- go away,” Rodriguez said. “I think soon. never easy, even when it’s calm. fewest in the major leagues. His have a chance.” ing situation.” last year I made some great “I was more worried about the You can’t fall asleep on any shot job, the way he sees it, will be to NOTES: Gonzalez introduced “Overall, I just feel so much progress both on and off the field, alligator that was on the other out here.” get on base. Braves Hall of Famers Hank better coming into this year,” but I’m at first base. I’ve got a “Hopefully this year my on- Aaron and Bobby Cox to the team Rodriguez said Thursday after long ways to go.” Region Lady Hawks From Page 13 From Page 13 County a couple of weeks ago, to play them on their home will entertain McMinn County court will be tough,” related hit a 3-pointer, quickly followed by Sutton sank a free throw to (11-18) in Sparta Saturday Raider head coach Jason another. complete another three-point play evening. McCowan. After each team traded and the Lady Hawks were sudden- Walker Valley is on the same The Cavaliers fell to White turnovers and another score by ly within three points. end of the bracket as local rival County by three and nine points Sutton, the lead for Knoxville Defensively, TCPS had played Cleveland (18-6) and could during the regular season before Christian grew to 12-4. well for the entire game, but in the square off in the other semifinal, getting blow out by 20 in the 6- Raylee Evans scored for TCPS third quarter kicked into high but the Blue Raiders have a AAA title game. and Eleanor Jenkins came off the gear. tough row to hoe at 6-AAA run- The top two teams from each bench to add two points late in the Hannah Nelms was a defensive ner up Cookeville (22-8) region tournament will advance first period. standout for the Lady Hawks. Saturday evening. to the TSSAA Sectional games The teams continued to trade The top scorer for Knox “Cookeville is a very good with the girls playing on March turnovers and by the end of the Christian, Rebecca Leone, was team and having to go over there 5 and the boys on March 7. first period, the score was 15-10 held to just three points in the Knox Christian. second half due to the hounding As the second period started, defense of Nelms. Merritt Jenkins completed a The battle carried on into the three-point play to bring the Lady fourth quarter as both teams Hawks within two-points of the fought on defense. lead. Knox Christian answered Sutton grabbed an offensive twice to extend its lead by seven rebound and put the ball in the points. hoop for a score then a few sec- TCPS began chipping away at onds later, off a steal, TCPS scored Knox Christian’s lead, with a big again to tie the game with three 3-point shot by Jenkins, which minutes left. Merritt Jenkins then ignited the TCPS faithful in the sunk a free throw to give TCPS its stands. The second quarter would first lead since the opening score end with TCPS trailing by 10. of the game. The third period started with The Lady Hawks continued to several turnovers by both teams, play solid defense for the final but halfway through it Knoxville minutes and did not give up the Lee University photo Christian started getting into foul lead again. LEE UNIVERSITY junior Keevin Tyus goes up for two of his 19 trouble. As the final seconds clicked off points as he recorded a double-double, pulling down 11 rebounds in the clock and the buzzer sounded, the Flames’ season-ending 79-73 loss at Shorter University several TCPS fans stormed the Thursday in Rome, Ga. court to celebrate with the Lady Vandy Hawks as they claimed the victory, 41-38. From Page 14 This is second SCAA Conference Championship for the Flame Tennessee has fallen out of the TCPS Lady Hawks as they have Top 25 for the first time since completed the drill two years in a From Page 13 February 1985, ending a string of row. First year head coach Natalie T J H i c k s 565 consecutive weeks in the poll. Calfee and assistant coach Jared Congratulations to Bradley Central wrestler and six points. Rantavious Lee made 14 trips to the free ... For the second straight year, an Tilley said they are very proud of TJ Hicks for being selected as the Gilbert registered six points, throw line and made 12 (.857), injury has ended Georgia guard what the team has accomplished Check Into Cash Player of the Week. seven rebounds and one blocked while Shorter made 26-of-29 Shacobia Barbee’s season prema- this year in claiming back to back The junior went undefeated this past season, winning 36 of his 42 victories by shot to finish with 93 blocks for (.897) from the charity stripe. turely. Barbee underwent surgery titles. way of pins. Hicks helped lead the Bears to the 2016 TSSAA State Duals and the season. Shorter was led by Alijah Tuesday to repair a broken bone Scoring stats for the Lady Traditional championships, the 23rd and 24th in the program’s history. After The Flames were 27-for-68 Bennett and Phil Taylor with 18 winning the 2015 106-pound crown, he claimed his second state individual title on her lower left leg. She broke the Hawks: Holly Sutton 20, points as well by dominating the 113-pound division this season. (.397) from the floor and made 7- points each. Taylor also had a same bone in her right leg last sea- and 10 rebounds; Merritt Jenkins, of-17 shots from distance. The game-high seven assists. Chris son. Barbee led the Lady Bulldogs 7 points and 5 rebounds; Whitney Hawks made 24-of-62 (.387) Daniels recorded a double-dou- in assists (9.1) and ranked second White 6 points and 3 rebounds; attempts overall and converted 5- ble with 17 points and 10 on the team in points (12.7) and Eleanor Jenkins, 5 points; Raylee of-20 (.250) 3-pointers. boards. assists (3.8). Evans, 2 points. 16—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com Let me introduce myself: Your big ol’ blob of sunshine The last several days have been fairly making our own luck, and here’s why. therefore they usually did. political posts on Facebook. I will abysmal for me. StorieS oF Allow me to tell you about two people. I cannot imagine a better mindset to embrace the appliance repairman when On a professional level, February has a world The first is someone who I knew years carry through life. The best part: It’s a he gets here and kiss him on each cheek been a perfect storm of unpleasant situ- gone mad ago. She is a fine person with a normal choice. That’s all it is. like the Pope does. ations. Some are merely annoyances. life, but she would go each day constant- In “The Power of Positive Thinking,” OK, I will probably stop just short of Others have hit the pocketbook. The Barry Currin ly saying something to the effect of, Dr. Norman Vincent Peale wrote, “The that, but you get the idea. majority did both. “Good Lord, what can happen next?” way to happiness: Keep your heart free I once heard a speaker say, “When And, they all left me gnashing my Every day I saw her, she exuded an from hate, your mind from worry. Live you’re bumped, what you’re full of is teeth. buy an appliance with a feature where it air of gloom and doom while waiting for simply, expect little, give much. Scatter what spills out.” This self-employed gig is fun 90 per- says, “Hey, I’m going to break in a week the next catastrophe. And, it always sunshine, forget self, think of others. Try I know I’m going to get bumped this cent of the time, but that other 10 per- or so.” seemed to work. this for a week and you will be sur- week. You are. We all are. cent can be a challenge. I don’t have a But, I’m not here to talk about that — Bad luck followed her. A perfect prised.” Our reaction to those situations, how- boss’ door to stick my head in and say, even though I could write one of those stranger could see it on her face. I’m going to make a special effort to do ever, will determine our mindset. “The universe is bothering me again. “this could only happen to me” columns Now, let me introduce you to someone that as I spend this week dealing with This week, I’m going to scatter sun- Can you do something about it?” fairly easily right now. else. the unpleasant situations I mentioned shine. On a personal level, our oven perished Today, I am taking a different Luck and good fortune always seem to earlier, as well as whatever challenges And, I just bet I’ll get results. on Friday night, and the clothes dryer approach. I hereby pledge to tackle this lay rose petals at this person’s feet — so are around the next bend. ——— died — apparently of a broken heart week with a positive attitude. I will much so that I once said to him, “You I refuse to give in to negativity. (About the writer: Barry Currin runs because of the oven — the next day. expect good things — even with situa- always seem to be so lucky. What’s your I’m going to be a big ol’ stinking blob BeaverDamUSA.com, a humor, sports I don’t know why our stuff always tions that are seemingly out of my con- secret?” of sunshine at every turn. and entertainment website. “Stories of a tears up on the weekend, but it invari- trol. He told me he simply expected good I will grant amnesty to those who World Gone Mad” is published weekly. ably does. I would be the first in line to I believe we can go a long way toward things were going to happen to him, and don’t use their blinkers. I will ignore Email him at [email protected].)
ANNIE’S Viewpoint MAILBOX
Thought for Today: “Start every day off with a smile and get it over with.” Dear Annie: My youngest son, — W.C. Fields, American comedian (1880-1946) “Ian,” is soon to marry the “love of his life.” I haven’t had much of an opportunity to get to know “Tess,” but my wife has spent time with her and really likes her. Around me, however, Tess How Justice Scalia seems to be reserved and quiet. I asked Ian about her reticence and after some hesitation, he changed my life told me that Tess finds me “creepy” and is uncomfortable here are four deaths attack, head-on, the anesthetiz- being around me. that have shaken me, ing effect of moral relativism I was flabbergasted. I cannot that enraged his critics. How think of one thing I’m doing to Twith seismic force, to make this woman feel this way. I the core. Four brought tears dare he, they thought, tell us have never touched her or leered at the moment I found out how to live our lives? Who is at her. I don’t find her particu- larly attractive, so I cannot imag- about the loss. Only four. he, almighty in those black robes, to dictate behavior? ine that I’m being lascivious The first was when my father without realizing it. I don’t make Where is his tolerance? died after a yearlong death off-color jokes. I dress conserva- And Scalia came back with match with lung cancer. tively. When I speak to her, I look that pragmatic genius and said her in the eye, not the chest. I The second was when Pope that society had a right to dic- can’t figure out what I’m doing John Paul II, who redefined my tate certain standards of moral- wrong. relationship with my baptismal I mentioned it to my wife, and ity, and this manufactured she admitted that she overheard faith, passed. acceptance of everything in the The third was when my moth- Tess and two of her friends name of "compassion" was Despite skepticism, Syrian truce laughing about how creepy I am. er passed away, leaving me, at touchy-feely nonsense having Her opinion of Tess has been 52, an orphan. nothing to do with the substantially lowered. I asked And the fourth came on a my other two daughters-in-law Constitution. may have chance at succeeding whether they thought I was bone-chilling Saturday at twi- Just because light, when I learned that creepy and they were astonished Bruce wants BEIRUT (AP) — After five should earn then a seat at a that anyone would think so. Justice Antonin Scalia had died to be called years of carnage, the Syrian AP NEWS ANALYSIS future negotiating table. If the They both want to talk to Tess, in his sleep. Caitlyn and civil war can seem poised to go fighting ends now, the coalition but I asked them not to. My son on indefinitely. But the “cessa- of rebel groups will remain in Scalia had a powerful impact Cecile wants said that Tess shared her feel- on my life. I was in law school tion of hostilities” engineered by paign against IS militants in control of much of Aleppo and ings about me in confidence and babies doesn't the U.S. and Russia may actu- northeastern Syria, the opposi- Idlib provinces, and key areas he doesn’t want her to know he when President Ronald mean the ally stand a chance, in part tion says most of the sorties along the Lebanese border and told me. Reagan nominated him to the Constitution because of the weakness of the have in fact targeted non-jihadi near Damascus in the south. Should I wait until after the bench, and spent the next three s u p p o r t s mainstream rebels fighting mainstream rebels and were Russia will get credit for help- marriage and try to talk to Tess? Flowers President Bashar Assad. plainly aimed at dislodging them ing end the war. The U.S. will decades absorbing his brilliant them. My other family members say to and revolutionary theories of The so-called Free Syria Army from areas they held in the have avoided a Middle East let it go and that she’ll get to The liberals hated Scalia for — and innumerable other mili- northwest and south. Tellingly, quagmire and ended a situation know me better with time, but the Constitution. Like the pas- being told that sometimes, fol- tias roaming the shattered the Russians have played no that is becoming more embar- I’m not so sure. Ian has been sive Catholic I'd been before lowing a flawed conscience landscape — had clearly strug- role against the Islamic State rassing by the day. dating Tess for nearly three John Paul II, I was unsure of was just as bad as having none gled to even fight Assad to a group in neighboring Iraq, Turkey will be frustrated at years and she’s had plenty of standoff. But Russia’s interven- which is an equal part of the Assad’s continued presence, how to interpret the Founders' at all. And we, on the right, opportunities to get to know me. great philosophical compro- tion on his side in September fight for the U.S.-led coalition. but along with Syria’s other Any advice? — Not a Creepy Guy loved him with equal passion. has given him what now That impressive-seeming coali- neighbors of Lebanon and Dear Guy: We don’t know why mise in my legal life. As iconic as he was in his pro- appears to be a decisive boost. tion, which includes most coun- Jordan, it will be relieved at a Tess thinks you are creepy. Scalia changed that, in dra- fession and in public, he was The rebels have been routed tries in the Arab world, has chance to stem the flow of There may be something about matic fashion. His brand of orig- extremely humble in private. I and besieged in a string of key indeed scored some victories in refugees. you that reminds her of a less- locations in recent months. Iraq, working closely with the With so many of these inalism, one which rejected "liv- met him only twice, briefly, but I savory character. Or her defini- ing document" fads that Dozens of their commanders Iraqi army in dislodging IS refugees now in Europe — tion of “creepy” might be differ- will never forget his spirited have been killed. Most critically, extremists from important places sparking popular resentment ent than yours. It is also possi- seemed to adapt to whatever eyes, his very un-Justice-like pro-Assad forces backed by like Tikrit and Ramadi. A cam- and even a re-evaluation of the ble that Tess is setting the stage social evolution got the most smile and his willingness to Russian air power are close to paign to retake Mosul, the main European Union’s open internal for keeping Ian away from his traction (most recently and speak a few words of Italian. He encircling the rebels in their city held by Islamic State in Iraq, border policy — there will be a family after the marriage. unfortunately seen in the legal- main stronghold of Aleppo, is believed to be imminent. sigh of relief from there as well. You need to discuss this open- elevated my mother's people, Syria’s largest city. The ability There have been scant paral- For all the cynicism and per- ly and your wife has provided the ization of gay marriage), taught and my own identity as an to supply it with fighters and lel successes in Syria, and the haps justified pessimism sur- perfect excuse to do so without me how dangerous it is when Italian woman, to exalted weapons from Turkey has Islamic State is still well- rounding the U.S.-Russian compromising your son. With judges replace their own eso- heights. As my friend Gabriella almost dried up. entrenched in Raqqa, the main agreement for a cease-fire, the other family members present, teric views of due process and said, he showed the country we As the clock ticks toward a city the group holds in that deal offers the most serious especially Ian, tell Tess what equal protection for the men truce meant to take effect at country. A key difference: There effort yet to halt the 5-year-old your wife overheard. Ask her weren't all about meatballs and midnight Friday local time, the can be no cooperation by the conflict. It is based on a U.N. why she thinks you are “creepy” who wisely created a bedrock mafia guys. He reached the top mainstream rebels find them- coalition with Assad’s army as Security Council resolution that and how the two of you can over- document. "Living documents" of the mountain, and took us selves fighting resurgent gov- long as the civil war goes on. endorsed a road map for a come it in order to have a better gave us legalized abortion, with him. ernment forces, battle-hard- And in any case, that army is process designed to end the civil relationship. Frankly, we would racial quotas, same-sex unions Scalia's closest friend on the ened Hezbollah troops and a occupied elsewhere. war and provide a new govern- be wary of any young woman and the demonization of public host of allied Shiite militiamen, In this way, the Syrian war ment in Syria within 18 who turns her future father-in- court was his philosophical as well as the Islamic State has — in addition to causing a months. And the U.S. and law into an object of derision prayer. antithesis, the very liberal Ruth group. migrant crisis in Europe and Russia have put some credibili- with her girlfriends. Tread care- Many critics of Scalia, some Bader Ginsburg. It's another Kurdish forces have cleared unsettling politics in the U.S. — ty on the line. fully. more respectful than others, measure of Antonin Scalia's over 10 kilometers (7 miles) of has also undermined the effort said he was trying to stop for- greatness that he was loved by opposition-held terrain north of to defeat the Islamic State. Aleppo recently and are closing Along with the devastation to ward motion. But as the justice those who knew him as equally in on the opposition strong- Syria itself — where half the himself once famously said, as he was by those who reject- holds of Marea and Azaz near people are displaced and over a Cleveland Daily Banner "Movement is not necessarily ed his view of the law. the Turkish border. quarter of a million have been – Established in 1854 – progress." He went on to shat- In the wake of his death, the “It is clear that (the rebels’) killed — it adds up to an over- ter that old shibboleth of follow- praise and regret were mixed American and European back- whelming global sense that the EDITOR AND PUBLISHER GENERAL MANAGER ers are no longer willing to sup- civil war must end. Stephen L. Crass Jim Bryant ing your conscience by saying with the expected vitriol from port them in winning the fight,” If the cessation of hostilities that it was important "not just to starved intellects. It came from said Randa Slim of the were to become long-term or OFFICE MANAGER CIRCULATION DIRECTOR be zealous in the pursuit of both sides, with liberals and Washington-based Middle East permanent, or lead to a negoti- Herb Lacy your ideals, but to be sure that conservatives politicizing the Institute. “The best they can do ated transition period, it could Joyce Taylor your ideals are the right ones. death. This is the time that is to try to help them get better be a net positive for some key SPORTS EDITOR terms for the deal.” players. That is perhaps the hardest makes me hate partisans, peo- ASSOCIATE EDITOR Richard Roberts The rebels’ main regional For Assad, whose demise was Rick Norton part of being a good human ple who lose their humanity in backers, Turkey and Saudi widely predicted since the early ADVERTISING DIRECTOR being: Good intentions are not the rush to gain an advantage. Arabia, are distracted with their days of the rebellion, any out- Jack Bennett enough. Being a good person They are despicable. own internal troubles. After come that leaves him standing ASSOCIATE EDITOR begins with being a wise per- But in the end, they're irrele- threatening a ground incursion in Damascus is a victory. And Gwen Swiger RETAIL SALES MANAGER in Syria, the Turkish foreign even though few will admit it, son. Then, when you follow vant. What matters, and what Sheena Meyer minister said Monday a land his early claim that his oppo- LIFESTYLES EDITOR your conscience, will you be remains, is the brilliant legacy operation has never been on the nents were in large part import- PRESS SUPERVISOR ed jihadi terrorists will have William Wright headed in the right direction." of Antonin Scalia. I mourn his agenda. Richard Yarber It was that willingness to loss. I celebrate his memory. If the fighting goes on, been at least somewhat vindi- chances are good that many cated by the rise of the Islamic ——— 423-472-5041 rebels would either surrender or State. Telephone (About the writer: © 2016 Christine Flowers. Flowers is an slip away to join jihadi groups For the mainstream rebels, attorney and a columnist for the Philadelphia Daily News, and like the Islamic State group or avoiding total defeat against a 423-614-6529 423-476-1046 can be reached at [email protected]. Opinions the Nusra Front. force that included not just the Even though the Russians Syrian army but also Iran, Newsroom Fax Office & Advertising Fax expressed in guest “Viewpoints” do not necessarily reflect the have defended their intervention Hezbollah and Russia will be views of the Cleveland Daily Banner.) as aligned with the global cam- presentable as a success that 1505 25th Street N.W. - Cleveland, TN 37311 • P.O. Box 3600 Cleveland, TN 37320 www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016—17 tina’s Groove CROSSWORD By Eugene Sheffer
Baby Blues
Blondie
ASTROLOGYASTROLOGY by Eugenia Last Snuffy Smith
SATURDAY, FEB. 27, 2016 Hesseman, 76. and disappointment. Creative opportuni- CELEBRITIES BORN ON THIS Happy Birthday: Question every- ties look promising as long as you nego- DAY: Josh Groban, 35; Rozonda "Chilli" thing and everyone. Your curiosity will tiate on your own behalf and set ground Thomas, 45; Donal Logue, 50; Howard be what saves you from personal loss rules with the people you partner with. Nothing is impossible if you are willing to adapt and make things work. Think big, but enforce practicality and be realistic. Your numbers are 5, 12, 18, 26, 32, 36, 48. Contract Bridge ARIES (March 21-April 19): What by Steve Becker you do to help others will be repaid. Your ability to bring your ideas to the forefront Hagar the Horrible and turn them into something fantastic will make an impression on someone who will pay for your input. Try to find new solutions to old problems. TAURUS (April 20-May 20): Keep a low profile regarding personal affairs, changes you want to make to your appearance or the way you live. Don't let anxiety build up or lead to an argu- ment with someone you love. Work alone for best results. GEMINI (May 21-June 20): Communication, travel and education will all lead to personal and professional benefits. Attend a conference or discuss Dilbert your ideas with people who are forward- thinking and have the components you need to turn your dream into a reality. Romance is highlighted. CANCER (June 21-July 22): Take the initiative and let people see what you are up to. Your innovative plans will take everyone by surprise, allowing you to exploit something you enjoy doing and getting the help you need to turn it into a profitable endeavor. LEO (July 23-Aug. 22): Lend some- one a helping hand. A change at home will cause a rift. Try not to cave under pressure or say things you'll regret. A Garfield calm, gentle approach and a viable solution will do the trick. Make love, not war. VIRGO (Aug. 23-Sept. 22): Show off your uniqueness and handle situations with finesse. Don't depend on anyone to do things for you. By taking control of sit- uations, you will put yourself ahead of any competition you meet along the way. LIBRA (Sept. 23-Oct. 22): Don't overspend to win favors. Learn some- thing new by showing interest in what others do. Your popularity will grow, enabling you to persuade others to see Beetle Bailey things your way. Romance is on the rise, so make special plans for the future. SCORPIO (Oct. 23-Nov. 21): Don't let your emotions come between you and what you have to accomplish. A problem with someone you live with will leave you unsettled. Take time to mull matters over while you work at some- thing you enjoy doing. SAGITTARIUS (Nov. 22-Dec. 21): Proceed with caution. Not everyone will fall for your charms. Make sure you have a realistic plan in mind before you put your reputation on the line. Honesty will be required to reach your goal. Dennis the Menace By Ned Classics CAPRICORN (Dec. 22-Jan. 19): By Conrad Day Don't waffle. When in doubt, ask ques- tions and look for alternatives. Trying something new will open your eyes to a new way of living or an occupational change. Accepting the inevitable will lead to a stable and secure future. AQUARIUS (Jan. 20-Feb. 18): Look for a change that can boost your enthu- siasm. Too much idle time or boring rou- tines will leave you feeling flat and in need of a pick-me-up. A new look, hobby or activity will get you moving. Romance is encouraged. PISCES (Feb. 19-March 20): Follow through with your plans. You won't ben- efit unless you actually do something. Your input to a concern you harbor will help you make a difference and change the way things are done. The improve- ments you make will be recognized and rewarded. Birthday Baby: You are distinctive, adaptable and fearless. You are ener- getic and trendy. 18—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com U.S. military launches aggressive cyberwar against IS
WASHINGTON (AP) — The U.S. “He was right to say they could length over the emerging issues mands to support warfighting military has launched a newly be more forward leaning about surrounding cyberwarfare and operations. There will be 68 teams aggressive campaign of cyberat- what they could possibly do how it should be incorporated. assigned to defend Defense tacks against Islamic State mili- against ISIS,” said James Lewis, a The Pentagon is building 133 Department networks and sys- tants, targeting the group’s abili- cybersecurity expert at the Center cyber teams by 2018, including tems, 13 that would respond to ties to use social media and the for Strategic and International 27 that are designed for combat major cyberattacks against the Internet to recruit fighters and Studies. “You could disrupt their and will work with regional com- U.S., and 25 support teams. inspire followers, U.S. officials support networks, their business told The Associated Press. networks, their propaganda and The surge of computer-based recruitment networks.” military operations by U.S. Cyber However, Lewis added, the U.S. Command began shortly after needs to be careful about disrupt- Defense Secretary Ash Carter ing the Internet to insure that prodded commanders at Fort attacks don’t also affect civilian Meade, Maryland, last month to networks or systems needed for ramp up the fight against the critical infrastructure and other Islamic State group on the cyber public necessities. front. U.S. officials have long been U.S. officials confirmed that AP photo, PATRICK SEMANSKY stymied by militants’ ability to use operations launched out of Fort THE NATIONAL SECURITY ADMINISTRATION campus in Fort the Internet as a vehicle for Meade have focused on disrupting Meade, Md., where the US Cyber Command is located, is shown in inspiring so-called lone wolf the group’s online activities. The this June 6, 2013, file photo. U.S. officials tell The Associated Press attackers in Western nations, rad- officials said the effort is getting that the military has launched a newly aggressive campaign of cyber- icalized after reading propaganda under way as operators try a attacks against Islamic State militants. easily available online. range of attacks to see what works “Why should they be able to and what doesn’t. They declined a public setting. the group’s Internet access could communicate? Why should they to discuss details, other than to The more aggressive attacks hurt intelligence gathering. be using the Internet?” Carter say that the attacks include come after months of pressure Officials said Carter told com- said during testimony before the efforts to prevent the group from from Carter, who has been frus- manders that he wanted creative defense appropriations subcom- distributing propaganda, videos, trated with the belief that the options that would allow the U.S. mittee. “The Internet shouldn’t be or other types of recruiting and Pentagon — and particularly to impact Islamic State without used for that purpose.” messaging on social media sites Cyber Command — was losing the diminishing the indications or He added that the U.S. can con- such as Twitter, and across the war in the cyber domain. warnings intelligence officers can duct cyber operations under the Internet in general. Late last year Carter met with glean about what the group is legal authorities associated with Other attacks could include commanders, telling them they doing. the ongoing war against the attempts to stop insurgents from had 30 days to bring him options On Jan. 27, Carter and Marine Islamic State group. conducting financial or logistical for how the military could use its Gen. Joseph Dunford, chairman The U.S. has also struggled to transactions online. cyberwarfare capabilities against of the Joint Chiefs of Staff, went to defeat high-tech encryption tech- Several U.S. officials spoke the group’s deadly insurgency Fort Meade for an update. niques used by Islamic State and about the cyber campaign on con- across Iraq and Syria, and Officials familiar with Carter’s other groups to communicate. dition of anonymity because they spreading to Libya and meetings said the secretary was Experts have been working to find were not authorized to discuss it Afghanistan. Officials said he told frustrated that as Cyber ways to defeat those programs. publicly. Much of the effort is commanders that beefing up Command has grown and devel- Cyber Command is relatively TELL US WHAT YOU THINK! classified. cyberwarfare against Islamic oped over the past several years, it new. Created in 2009, it did not Carter mentioned the opera- State was a test for them, and that was still focused on the begin operating until October The Banner will be running the new tions briefly Thursday, telling a they should have both the capa- cyberthreats from nations, such 2010. KENKEN puzzle daily. House Appropriations subcom- bility and the will to wage the as Iran, Russia and China, rather Early on, its key focus was on mittee only that Cyber Command online war. than building a force to block the defending military networks, Please contact the Banner offices is beginning to conduct opera- But the military cyber fight is communications and propaganda which are probed and attacked at 472-5041 or email us at tions against the Islamic State limited by concerns within the campaigns of Internet-savvy millions of times a day. But [email protected] group. He declined to say more in defense leaders also argued at intelligence agencies that blocking insurgents. and tell us what you think!
Friday Best Bets 8 p.m. on (WFLI) 9 p.m. on (WFLI) 9 p.m. on (WTCI) 10 p.m. on (WTCI) 10:30 p.m. on (FOOD) The Vampire Diaries The Originals In Performance at the White House American Masters Burgers, Brew & ’Que A new crossover story with the spinoff se- As a new crossover tale shared with “The The new episode “Smithsonian Presents The singer-pianist whose hits included For a new episode called “Decadent Re- ries “The Originals” begins with “Moonlight Vampire Diaries” concludes, “A Streetcar Ray Charles” showcases tunes popularized “Ain’t That a Shame” and “Blueberry Hill” gional Dishes,” in Baton Rouge, La., chef on the Bayou,” as Stefan (Paul Wesley) Named Desire” — a title obviously taken by one of modern music’s most memorable — and whose crossover success had a big Jay Ducote dishes up a juicy burger that goes to New Orleans to draw vampire from the classic play also set in New Or- stars, performed by a cast of established social impact — is recalled in the new of- draws on both French and Cajun influenc- hunter Rayna (guest star Leslie-Anne Huff) leans — makes visitor Stefan (guest star artists and newcomers in the East Room of fering “Fats Domino and the Birth of Rock es. For barbecue fans, a St. Louis eatery away from his friends in Mystic Falls. His Paul Wesley) part of the plan to rescue the White House. Since singer-songwriter ’n’ Roll.” Though his career peaked in the serves burnt ends stuffed inside toasted arrival raises Klaus’ (guest star Joseph Mor- Klaus and Elijah (Joseph Morgan, Daniel Charles is the talent in question, “Georgia 1950s and early 1960s, the New Orleans- ravioli. Among the treats on offer in Austin, gan) concerns. Enzo (Michael Malarkey) Gillies), prisoners in a magical trap. Freya on My Mind,” “What’d I Say,” “Crying Time” born Domino would continue to tour and Texas, are a huge, peach-glazed pork chop tries to keep Stefan safe. Caroline (Candice (Riley Voelkel) also recruits Marcel and and “I Can’t Stop Loving You” are all but perform live for several more decades, with and a peanut-butter mousse pie. Michael King) wants to go to Dallas with Alaric (Matt Hayley (Charles Michael Davis, Phoebe guaranteed to be among the selections his music helping to combat segregation in Symon is host. Davis) and the twins. Tonkin) to retrieve them. Danielle Campbell here. America through its mass appeal. also stars.
FRIDAYAFTERNOON/EVENING FEBRUARY 26, 2016 4 PM 4:30 5 PM 5:30 6 PM 6:30 7 PM 7:30 8 PM 8:30 9 PM 9:30 10 PM 10:30 11 PM 11:30 12 AM 12:30 WRCBNBC 3 The Ellen DeGeneres Show Live at 5:00 Live at 5:30 News Nightly News Ent. Tonight Inside Edition Caught on Camera Dateline NBC ’ Å News Tonight Show-J. Fallon Seth Meyers WELFTBN 4 John Hagee The Bible Praise the Lord Å Creation Supernatural! Potters Trinity Family Hal Lindsey End/ Age Perry Stone Praise the Lord Å F.K. Price Spirit WTNB 5Around Town Body Southern-Fit Game of the Week Around Town Around Town WFLICW 6 Judge Mathis ’ Å Friends ’ Friends ’ Mod Fam Family Feud Family Feud The Middle The Vampire Diaries (N) ’ The Originals (N) ’ Å Tosh.0 Å Crazy Talk Hollywood Paid Program Anger Paid Program WNGHPBS 7 Martha Speak Odd Squad Wild Kratts Wild Kratts PBS NewsHour (N) ’ Å Masterpiece Classic ’ Å (DVS) A Place to (:15) A Place to Call Home GPB Favorites DAYSTAR 8Sam Adeyemi Bill Winston Love a Child Jewish Voice Z. Levitt Creflo Dollar Jewish Voice John Hagee Rod Parsley Joni: Table Gateway Worship WALLS J. Van Impe Jewish Jesus Hour of Sal Kenneth Life Today Joyce Meyer WTVCABC 9 Dr. Phil (N) ’ Å News News News World News Wheel Jeopardy! (N) Last-Standing (:31) Dr. Ken Shark Tank (N) ’ (:01) 20/20 ’ Å News (:35) Jimmy Kimmel Live ’ (:37) Nightline WTCIPBS 10 Ready Jet Odd Squad Wild Kratts Wild Kratts World News Business Rpt. PBS NewsHour (N) ’ Å Washington Chattanooga Performance at White House American Masters (N) Å A Tribute to Toussaint ’ Charlie Rose (N) ’ Å WDSIFOX 11 (3:30) ››› “Star Trek II: The Wrath of Khan” (1982) › “The Pink Panther 2” (2009) Steve Martin. Å›› “At First Sight” (1999) Val Kilmer, Mira Sorvino. Å›› “An Eye for an Eye” (1981) Chuck Norris. Å››› “Arlington Road” WDEFCBS 12 The Dr. Oz Show (N) Å Judge Judy Judge Judy News 12 at 6 CBS News Prime News Andy Griffith The Amazing Race (N) ’ Hawaii Five-0 (N) ’ Å Blue Bloods (N) ’ Å News Late Show-Colbert Corden QVC 13Quacker Factory by Jeanne Bice Josie Maran Argan Oil Cosmetics Quacker Factory FLY LONDON Footwear Isaac Mizrahi Live! Friday Night Beauty (N) Perricone MD CSPAN 14(3:00) Key Capitol Hill Hearings Speeches. ’ Key Capitol Hill Hearings Speeches. ’ Key Capitol Hill Hearings ’ WGN-A 15Blue Bloods “Open Secrets” Blue Bloods ’ Å Blue Bloods ’ Å Person of Interest “Aletheia” Person of Interest “4C” ’ Person of Interest ’ Å Person of Interest ’ Å›› “The Siege” (1998) Denzel Washington. Å HSN 16Vince Camuto Collection (N) Perlier (N) Sigrid Olsen Fashions (N) Fine Jewels by Emily Fine Jewels by Emily Vince Camuto Collection (N) Vince Camuto Collection (N) Andrew Lessman/ProCaps Andrew Lessman/ProCaps E! 23Total Divas Å Total Divas Å Total Divas Å E! News (N) Å›› “He’s Just Not That Into You” (2009) Ben Affleck. Å Kardashian E! News (N) Å (DVS) ESQTV 24CSI: Crime Scene CSI: Crime Scene CSI: Crime Scene CSI: Crime Scene Parks Parks Parks Parks Parks Parks Team Ninja Warrior Å Team Ninja Warrior Å LIFE 25Grey’s Anatomy “Six Days” Bring It! “Rittany’s Revolt” Bring It! Å Bring It! “Bucking Bride” Bring It! (N) Å Bring It! (N) Å (:02) Bring It! Å (:02) Bring It! Å (12:02) Bring It! Å TLC 26Say Yes: ATL Say Yes: ATL Say Yes: ATL Say Yes: ATL Say Yes: ATL Say Yes: ATL Say Yes: ATL Say Yes: ATL Say Yes to the Say Yes: ATL Love; Lust First Swipe Say Yes: ATL Love; Lust First Swipe TBS 27Friends ’ Friends Friends Friends ’ Seinfeld ’ Seinfeld ’ Seinfeld Seinfeld 2 Broke Girls 2 Broke Girls 2 Broke Girls 2 Broke Girls ›› “Jackass 3D” (2010) Johnny Knoxville. Premiere. Å Cougar Town Cougar Town TNT 28Bones ’ Å Bones “Death in the Saddle” Bones ’ Å Bones A Halloween killer. ’›› “I Am Number Four” (2011) Alex Pettyfer. Å (DVS) (:15) ›› “The Island” (2005, Action) Ewan McGregor, Scarlett Johansson. Å (DVS) USA 29Law & Order: SVU Law & Order: SVU Law & Order: SVU Mod Fam Mod Fam Mod Fam Mod Fam Mod Fam Mod Fam Mod Fam Mod Fam Mod Fam Mod Fam ›› “Semi-Pro” (2008) Å FX 30Anger Anger Two Men Two Men ›› “The Hangover Part II” (2011) Bradley Cooper. ’›› “Here Comes the Boom” (2012) Kevin James, Salma Hayek. ’ Å›› “Here Comes the Boom” (2012) Kevin James, Salma Hayek. ’ Å ESPN 31SportsNation Questionable Around/Horn Interruption SportsCenter (N) (Live) Å NBA NBA Basketball Chicago Bulls at Atlanta Hawks. (N) (Live) NBA Basketball Memphis Grizzlies at Los Angeles Lakers. (N) (Live) ESPN2 32The Jump First/Re-Take SportsNation Questionable Around/Horn Interruption College Basketball Teams TBA. (N) (Live) College Basketball Rider at Monmouth. (N) (Live) SportsCenter (N) Å SportsCenter (N) Å FSTN 33Destination Snow Motion UEFA Europa Lg. Highlights UEFA Mag. ACC Access UEFA Champions League Soccer: Arsenal vs Barça UEFA Champions League Soccer World Poker Tour: Alpha8 NHL Hockey SEC 34(3:00) The Paul Finebaum Show Paul Finebaum discusses all things SEC. (N) (Live) Women’s College Gymnastics Women’s College Gymnastics SEC Now (N) (Live) SEC Now SEC Now GOLF 35(2:00) PGA Tour Golf The Honda Classic, Second Round. Golf Central (N) (Live) PGA Tour Golf The Honda Classic, Second Round. From Champions Course in Palm Beach Gardens, Fla. PGA Tour Golf The Honda Classic, Second Round. FS1 36NASCAR Racing NASCAR Racing College Basketball Harvard at Yale. (N) (Live) Å Women’s College Basketball Xavier at Villanova. (N) Å Sports Live Sports Live TMZ Sports Sports Live FSSE 37College Basketball Auburn Bask ACC Access Georgia Tech Future Phen. SportsMoney Hawks Live! NBA Basketball Chicago Bulls at Atlanta Hawks. (N Subject to Blackout) Hawks Live! NBA Basketball Chicago Bulls at Atlanta Hawks. WEA 38(3:00) Weather Center Live (N) Å (5:59) Weather Underground (N) Weather Gone Viral Secrets of the Earth Secrets of the Earth Secrets of the Earth Secrets of the Earth CNBC 39(3:00) Closing Bell (N) Å Fast Money Option Action Mad Money (N) The Filthy The Filthy The Filthy The Filthy The Filthy The Filthy The Filthy The Filthy The Filthy The Filthy “The Queen of Versailles” MSNBC 40MSNBC Live W/ Kate Snow MTP Daily (N) With All Due Respect (N) Hardball Chris Matthews All In With Chris Hayes (N) The Rachel Maddow Show Lockup: Indiana Lockup: Indiana Cutting. Lockup: Indiana CNN 41The Lead With Jake Tapper The Situation Room (N) The Situation Room (N) Erin Burnett OutFront (N) Anderson Cooper 360 (N) CNN Tonight w/ Don Lemon CNN Special Program CNN Special Program HDLN 42Dr. Drew To Be Announced The Situation Room (N) Erin Burnett OutFront (N) Anderson Cooper 360 (N) CNN Tonight w/ Don Lemon Forensic File Forensic File Forensic File Forensic File CNN Special Program FNC 43Your World With Neil Cavuto The Five (N) Special Report Greta Van Susteren The O’Reilly Factor (N) The Kelly File (N) Hannity (N) The O’Reilly Factor Å The Kelly File HIST 44American Restoration Å American Restoration ’ American Restoration ’ American Restoration ’ Pawn Stars Pawn Stars American Restoration Å Million Dollar Genius (N) ’ Join or Die Pawn Stars Pawn Stars Pawn Stars TRUTV 45Fameless Fameless Fameless Fameless Fameless Fameless Top Funniest Top Funniest Top Funniest Top Funniest Top Funniest Top Funniest Top Funniest Top Funniest Those Who Those Who Top Funniest Top Funniest A&E 46The First 48 “10 Pounds” ’ The First 48 ’ Å The First 48 ’ Å Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Jep Jep Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty DISC 47Gold Rush “Goldzilla Gold” Gold Rush ’ Å Gold Rush “Dead Even” ’ Gold Rush ’ Å Gold Rush: Pay Dirt (N) ’ Gold Rush “Frozen Pay” (N) (:01) Deadliest Job Interview (:01) Gold Rush ’ Å Deadliest Job Interview ’ NGC 48Brain Games Brain Games Brain Games Generation X Brain Games Brain Games Brain Games Brain Games Brain Games Generation X Brain Games Generation X TRAV 49Ghost Adventures Å Mysteries at the Museum Mysteries at the Museum Mysteries at the Museum Mysteries at the Museum Mysteries at the Castle (N) Mysteries at the Museum Mysteries at the Museum Mysteries at the Castle FOOD 50Diners, Drive-Ins and Dives Diners, Drive-Ins and Dives Diners, Drive Diners, Drive Diners, Drive Diners, Drive Diners, Drive Am. Diner Diners, Drive Diners, Drive Guy Vacation Brew & ’Que Diners, Drive Diners, Drive Diners, Drive Diners, Drive HGTV 51Love It or List It, Too Å Love It or List It, Too Å Love It or List It, Too Å Love It or List It, Too Å Love It or List It Å Love It or List It Å Hunters Hunters Int’l Dream Home Hunters Love It or List It Å ANPL 52Insane Pools: Deep End Insane Pools: Deep End Insane Pools: Deep End Insane Pools: Deep End Insane Pools: Deep End Insane Pools: Deep End (:02) Treehouse Masters (N) Insane Pools: Deep End (12:04) Treehouse Masters FREE 53The Middle The Middle The Middle ››› “Ferris Bueller’s Day Off” (1986) Matthew Broderick, Alan Ruck. ››› “(500) Days of Summer” (2009) Premiere. Shadowhunters ’ Å The 700 Club ’ Å›› “Along Came Polly” DISN 54Austin & Ally Jessie Å Girl Meets Liv-Mad. K.C. Under. K.C. Under. Best Friends Mako Liv-Mad. Stuck/Middle Girl Meets Best Friends Star-For. Star-For. K.C. Under. Liv-Mad. Jessie Å Jessie Å NICK 55SpongeBob SpongeBob Alvinnn!!! and Alvinnn!!! and Thundermans Thundermans Paradise Run Odd Parents Harvey Beaks Pig Goat Ban. Full House Full House Full House Full House Full House Full House Friends ’ (:33) Friends TOON 56Teen Titans Teen Titans Clarence Steven Univ. Teen Titans Gumball We Bare Regular Show King of Hill Burgers Burgers Cleveland Family Guy Family Guy Childrens Pretty Face Check It Out Aqua Teen TVLND 57Gunsmoke Å Andy Griffith Andy Griffith Andy Griffith Andy Griffith Andy Griffith Andy Griffith ››› “Three Men and a Baby” (1987) Tom Selleck. Premiere. Å King King King King Old Christine AMC 58(3:00) ››› “The Patriot” (2000, War) Mel Gibson. ‘R’ Å››› “3:10 to Yuma” (2007, Western) Russell Crowe, Christian Bale. ‘R’ ›››› “The Shawshank Redemption” (1994, Drama) Tim Robbins. ‘R’ Å The Walking Dead Å TCM 59(3:30) ››› “Day for Night” (1973) ›››› “Close Encounters of the Third Kind” (1977) Richard Dreyfuss. ›››› “Young Frankenstein” (1974) Gene Wilder. Å››› “The Candidate” (1972) Robert Redford. Å›››› “Ninotchka” (1939) HALL 60Little House on the Prairie Little House on the Prairie Last-Standing Last-Standing Last-Standing Last-Standing Home Imp. Home Imp. The Middle The Middle The Middle The Middle Golden Girls Golden Girls Golden Girls Golden Girls OXYGEN 61Sex-City Sex-City Sex-City Sex-City Sex-City Sex-City Sex-City Sex-City ›› “Stepmom” (1998, Drama) Julia Roberts, Susan Sarandon. Å›› “Stepmom” (1998, Drama) Julia Roberts, Susan Sarandon. Å BRAVO 62Housewives Real Housewives/Beverly Real Housewives/Beverly Real Housewives/Beverly ›› “Stepmom” (1998, Drama) Julia Roberts, Susan Sarandon, Ed Harris. The People’s Couch (N) The People’s Couch The People’s Couch SYFY 63(3:30) ››› “The Mummy” (1999) Brendan Fraser. Å›› “The Mummy Returns” (2001, Adventure) Brendan Fraser, Rachel Weisz. › “Gone in Sixty Seconds” (2000) Nicolas Cage, Angelina Jolie. Å›› “Aliens vs. Predator: Requiem” (2007) SPIKE 64Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Bellator MMA Live (N) ’ (Live) (:15) Cops ’ Cops Å Cops Å Jail ’ Å COM 65Trevor Noah-Lost Futurama ’ Futurama ’ Futurama ’ Futurama ’ Trevor Noah-Lost Kevin Hart: Grown Little Man Kevin Hart Presents: Keith Kevin Hart: Plastic Cup Boyz Kevin Hart Presents: Lil Katt Williams: Pimp Chron. MTV 66Greatest Party Story Ever Story Ridiculous. Ridiculous. Ridiculous. Ridiculous. (:45) Ridiculousness ’ Ridiculous. Ridiculous. Ridiculous. ›› “Project X” (2012) Thomas Mann, Oliver Cooper. ’› “21 and Over” (2013) ’ VH1 67Stevie J Stevie J Mob Wives ’ Å Mob Wives ’ Å Mob Wives ’ Å››› “Breakfast Club” (1985) Emilio Estevez, Molly Ringwald. ’ Å››› “Hairspray” (2007) John Travolta, Nikki Blonsky. ’ CMTV 68Reba Å Reba Å Reba Å Reba Å Last-Standing Last-Standing Last-Standing Last-Standing ›› “Raising Helen” (2004, Comedy-Drama) Kate Hudson, John Corbett, Joan Cusack. Steve Austin’s Broken Skull Reba Å Reba Å BET 69House/Payne House of Payne House/Payne Martin Å (:40) Martin ’ Å (:20) Martin ››› “Soul Food” (1997) Vanessa L. Williams, Vivica A. Fox. Å (:25) Martin (10:56) Martin (:28) Martin The Wendy Williams Show SCIENCE 83Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science CSPAN2 85(3:00) U.S. Senate The Senate assembles for a legislative session. ’ Key Capitol Hill Hearings Speeches. ’ Key Capitol Hill Hearings ’ EWTN 100Catholic Cross Grandparents Lenten EWTN News Grace Filled Daily Mass - Olam Life on the Rock (N) EWTN News Holy Rosary The Church Lord, Mercy Bridegrm Women of Grace Daily Mass WPXA ION 107 Criminal Minds ’ Criminal Minds “Route 66” Criminal Minds ’ Criminal Minds ’ Criminal Minds “The Return” Criminal Minds ’ Criminal Minds “The Caller” Saving Hope “Wide Awake” Saving Hope “43 Minutes” DISXD 117Wander Gravity Falls Yo-Kai Watch Star-For. ›› “The Game Plan” (2007, Comedy) Dwayne “The Rock” Johnson. Spider-Man Spider-Man Lab Rats vs. Mighty Med Lab Rats Lab Rats Lab Rats Kirby Buckets Kirby Buckets GSN 144Deal or No Deal ’ Å Deal or No Deal ’ Å Family Feud Family Feud Family Feud Family Feud Chain Rea. Chain Rea. Family Feud Family Feud The Chase Å Chain Rea. Chain Rea. Family Feud Family Feud COOK 153Grandmother Eat St. Å Unique Eats Kitchens Chopped Canada Chopped Canada Chopped Canada Junk Food Sugar Cupcake Wars Good Eats Good Eats Chopped Canada WE 163House “Euphoria, Part 1” House “Euphoria, Part 2” Marriage- Reality Stars Marriage- Reality Stars Marriage- Reality Stars Marriage Boot Camp: Reality Stars (N) Å Ex Isle “Over it, Not Over It” Marriage- Reality Stars GALA 217Llena de amor Cómplices al Rescate El Chavo El Chavo El Chavo El Chavo El Chavo El Chavo Guereja Guereja Familia Diez Familia Diez Guereja Noticiero Con Joaquin Aquí y Ahora TELE 223María Celeste Caso Cerrado Caso Cerrado Decisiones Noticiero Caso Cerrado: Edición ¿Quién es quién? (N) (SS) Eva la Trailera (N) ’ (SS) La Querida del Centauro (N) Al Rojo Vivo Boxeo Telemundo UNIV 224El Gordo y la Flaca (N) Primer Impacto (N) (SS) Hotel Todo Noticiero Uni. Un Camino hacia el Destino Antes Muerta que Lichita (N) Pasión y poder (N) El Hotel de los Secretos (N) Impacto Noticiero Uni Contacto Deportivo (N) NBCSP 311Poker Poker Pro Ftb Talk Skiing College Hockey Boston University at Notre Dame. (N) (Live) Curling Mixed doubles From Eveleth, Minn. (N) Curling From Eveleth, Minn. DLC 319Trauma: Life in the ER ’ Trauma: Life in the ER ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Sin City ER (N) ’ Å Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ www.clevelandbanner.com Cleveland Daily Banner—Friday, February 26, 2016— 19
SATURDAYDAYTIME FEBRUARY 27, 2016 7 AM 7:30 8 AM 8:30 9 AM 9:30 10 AM 10:30 11 AM 11:30 12 PM 12:30 1 PM 1:30 2 PM 2:30 3 PM 3:30 WRCBNBC 3 Eyewitness News: Weekend Today (N) ’ Å LazyTown The Floogals Nina’s World Ruf-Tweet Astroblast Clangers (EI) English Premier League Soccer Goal Zone PGA Tour Golf WELFTBN 4 VeggieTales Dr. Wonder Kids Club Nest Family RocKids TV Auto B. Good Paha. Is. VeggieTales Monster Mary-Hopkins Lassie Å Goliath Ishine Knect Insp. Station Praise the Lord Å WTNB 5(6:00) Around Town Dragon Pancakes Real Life 101 Mouse in the Think Big Real Life 101 Dog Tales Game of the Week WFLICW 6 Dr. Pol Dr. Pol Dog Town Dog Whis Dog Whis Dog Whis Dog Whis Save-Shelter Dream Quest Hatched ›› “Vice Versa” (1988) Judge Reinhold, Fred Savage. ››› “Finding Neverland” (2004, Drama) Johnny Depp. WNGHPBS 7 Daniel Tiger Daniel Tiger Curious Nature Cat Arthur ’ (EI) Wild Kratts Edison’s Lab Odd Squad This Old H’se Old House GPB Favorites DAYSTAR 8(6:30) “The Epic Journey” (2015) Word Alive Dr. Wonder My Destiny Gospel Bill Maralee Donkey Ollie Adventures Ishine Knect Scaly Kerry Pharr Hillsong TV Guillermo Gospel Music JP Jackson Ron Carp. WTVCABC 9 Good Morning America (N) Good Morning Chattanooga Jack Hanna Ocean Mys. Sea Rescue Wildlife Docs Rock-Park Born-Explore UT Basketball UT Basketball Paid Program Paid Program World of X Games (N) Å Shall We Dance on Ice ’ WTCIPBS 10 Arthur ’ (EI) Wild Kratts Curious Sewing Love Quilting Joy/Painting Gardener Live Green Test Kitchen Moveable Lidia Kitchen Sara’s Garden Home Martha Bakes Cooking Pépin Old House This Old H’se WDSIFOX 11 “The Remains of the Day” ››› “Sense and Sensibility” (1995) Emma Thompson, Alan Rickman. Å›››› “Marty” (1955) Ernest Borgnine, Betsy Blair. Å››› “Awakenings” (1990, Drama) Robert De Niro, Robin Williams. Å Coming WDEFCBS 12 Lucky Dog Dr. Chris-Vet Innovation Inspectors CBS This Morning: Saturday (N) ’ Å Hidden Gme Chngers College Basketball Butler at Georgetown. (N) (Live) Å College Basketball Oklahoma at Texas. (N) (Live) Å QVC 13AM Style With Leah Williams Spotlight on fashion and accessories. Saturday Morning Q LOGO by Lori Goldstein Perricone MD CSPAN 14Washington Journal Live call-in program with officials. (N) ’ (Live) Washington This Week ’ (:15) Washington This Week ’ WGN-A 15Paid Program Paid Program Paid Program Paid Program Walker, Texas Ranger Å Walker, Texas Ranger Å Outsiders “Farrell Wine” (:10) Outsiders “Doomsayer” (:10) Outsiders Å (:11) Outsiders Å (:11) Outsiders “Demolition” HSN 16Steven by Steve Madden Perlier (N) Perlier (N) Slinky Brand Fashions (N) Slinky Brand Fashions (N) Andrew Lessman/ProCaps Andrew Lessman/ProCaps Perlier (N) Steven by Steve Madden E! 23I Am Cait Å I Am Cait Å I Am Cait Å E! News Weekend (N) Å The Kardashians The Kardashians The Kardashians The Kardashians The Kardashians ESQTV 24Car Match. Friday Night Tykes Å Friday Night Tykes Å Friday Night Tykes Å Friday Night Tykes Å›› “Highlander” (1986) Christopher Lambert, Sean Connery. Å Team Ninja Warrior Å Team Ninja Warrior Å LIFE 25Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Little Women: Atlanta Å “Sexting in Suburbia” (2012) Liz Vassey, Jenn Proske. Å “Sugar Daddies” (2014) Taylor Gildersleeve. Å TLC 26Paid Program Paid Program Paid Program Paid Program Four Weddings ’ Å Four Weddings ’ Å Four Weddings ’ Å Four Weddings ’ Å Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ TBS 27Full House Full House Full House Full House ››› “Catch Me if You Can” (2002) Leonardo DiCaprio, Tom Hanks. Å (DVS) (:15) ›› “Sherlock Holmes: A Game of Shadows” (2011) Robert Downey Jr. Å Friends ’ Friends ’ TNT 28Law & Order “Turnaround” Law & Order “Showtime” Law & Order “We Like Mike” Law & Order “Passion” ’ Law & Order Å (DVS) Law & Order “Terminal” ’› “Resident Evil: Afterlife” (2010) Milla Jovovich. Å “Resident Evil: Retribution” USA 29Paid Program Paid Program Paid Program Paid Program Suits “Tick Tock” ››› “Skyfall” (2012, Action) Daniel Craig, Judi Dench, Javier Bardem. Å Blindspot “Pilot” ’ Å Blindspot “A Stray Howl” ’ Blindspot “Eight Slim Grins” FX 30Anger Anger ››› “Les Misérables” (2012, Musical) Hugh Jackman, Russell Crowe, Anne Hathaway. ’ Å››› “Argo” (2012) Ben Affleck, Bryan Cranston, Alan Arkin. ’ Å››› “Moneyball” (2011) Brad Pitt, Jonah Hill. ’ Å ESPN 31SportsCenter Å SportsCenter (N) Å SportsCenter (N) (Live) Å College GameDay (N) Å College Basketball Texas Tech at Kansas. (N) (Live) College Basketball Arizona at Utah. (N) (Live) ESPN2 32SEC Storied Å 30 for 30 Å NFL Live Å SportsCenter (N) Å College Basketball Rhode Island at Dayton. (N) (Live) College Basketball Illinois State at Wichita State. (N) (Live) FSTN 33NHL Hockey Game Inside the Big Roy Williams Duke B’ball ShipShape Bob Redfern Inside the Big Game College Basketball Georgia Tech at Boston College. (N) Beneath Predators NHL Hockey SEC 34College Gymnastics SEC Now SEC Now SEC Storied Å SEC Storied Å College Basketball Mississippi at Georgia. (N) (Live) SEC Now (N) College Basketball GOLF 35European PGA Tour Golf Perth International, Third Round. Morning Drive (N) (Live) Golf Central Pregame (N) (Live) PGA Tour Golf The Honda Classic, Third Round. (N) (Live) LPGA Tour Golf FS1 36The 10 Å NHRA Drag Racing NASCAR Racing NASCAR Racing NASCAR Racing RaceDay NASCAR Racing XFINITY Series: Heads Up Georgia 250. (N) (Live) Å FSSE 37BestPan! Paid Program Paid Program Paid Program Ultimate Fish Nuts & Bolts Angling Edge Bass Dr. (N) Georgia Tech Mike Martin College Basketball Fight Sports: KNOCKOUTS! Women’s College Basketball WEA 38AMHQ Weekend (N) Weekend Recharge (N) (Live) Prospectors Prospectors Prospectors Highway Thru Hell CNBC 39Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program MSNBC 40Weekends With Alex Witt Up (N) Melissa Harris-Perry (N) Weekends With Alex Witt (N) Caught on Camera Caught on Camera CNN 41New Day Saturday (N) New Day Saturday (N) Smerconish (N) (Live) CNN Newsroom/ Blackwell CNN Newsroom CNN Newsroom CNN Newsroom CNN Newsroom CNN Newsroom HDLN 42HLN Weekend Express New Day Saturday (N) Smerconish (N) (Live) CNN Newsroom/ Blackwell HLN Weekend Express Forensic File Forensic File CNN Newsroom CNN Newsroom CNN Newsroom FNC 43(6:00) FOX and Friends Saturday (N) Bulls & Bears Business Forbes/FOX Cashin’ In (N) Bob Massi Is Jour. America’s News Headquarters (N) America’s News HQ HIST 44Lost Worlds ’ Å Underwater Universe Deadly ocean zones. ’ Å Civilization Lost Previously unknown civilizations. ’ Å The Lost Pyramid Ancient Egyptian pyramids. ’ Å Atlantis Found ’ Å TRUTV 45Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Genius Genius Genius Genius Genius Genius Genius Genius truTV Top Funniest truTV Top Funniest A&E 46Tiny House Tiny House Tiny House Nation ’ Å Tiny House Nation ’ Å What Would You Do? (N) ’ What Would You Do? (N) ’ What Would You Do? (N) ’ Monster in My Family Å Monster in My Family Å Monster in My Family Å DISC 47Paid Program Paid Program Paid Program Paid Program Dual Survival ’ Å Dual Survival “On Thin Ice” Dual Survival “High and Dry” The Age Of Aerospace ’ Misfit Garage ’ Å Misfit Garage ’ Å Misfit Garage ’ Å NGC 48Paid Program Paid Program Paid Program Paid Program Mick Dodge Mick Dodge The Boonies The Great Human Race Locked Up Abroad Inside Cocaine Submarines King of Coke: Living the Hi Cocaine Sub Hunt TRAV 49Mysteries at the Museum Mysteries at the Museum Bizarre Foods America Bourdain: No Reservations Expedition Unknown Å Wild Things With Dominic Man v. Food Man v. Food Food Paradise Å Food Paradise Å FOOD 50Best- Made Brunch at Daphne D. Southern Farmhouse Pioneer Wo. Pioneer Wo. Trisha’s Sou. The Kitchen Valerie Home Giada-Home All-Star Academy Cake Wars “Shrek” Kids Baking Championship HGTV 51Love It or List It Å Love It or List It Å Love It or List It Å Love It or List It Å Love It or List It Å Love It or List It Å Flip or Flop Flip or Flop Flip or Flop Flip or Flop Flip or Flop Flip or Flop ANPL 52My Cat From Hell ’ Å My Cat From Hell ’ Å Too Cute! ’ Å The Secret Extraordinary Dogs 101 “Rare Breeds” ’ To Be Announced FREE 53›› “Along Came Polly” (2004) Ben Stiller. ››› “(500) Days of Summer” (2009) Zooey Deschanel ››› “Mean Girls” (2004, Comedy) Lindsay Lohan. (:15) ›› “Mamma Mia!” (2008, Musical Comedy) Meryl Streep, Pierce Brosnan. DISN 54Tmrrwland Sofia Mickey The Lion Jessie Å Jessie Å Austin & Ally Liv-Mad. Best Friends Bunk’d Å K.C. Under. Mako Mako Austin & Ally I Didn’t Do It Liv-Mad. K.C. Under. Jessie Å NICK 55SpongeBob SpongeBob Alvinnn!!! and Alvinnn!!! and SpongeBob SpongeBob SpongeBob SpongeBob Harvey Beaks Pig Goat Ban. Rangers Alvinnn!!! and Alvinnn!!! and Alvinnn!!! and Alvinnn!!! and SpongeBob SpongeBob SpongeBob TOON 56Pokémon Nexo Knights Teen Titans Teen Titans Tom/Jerry Bunnicula (N) Wabbit (N) Be Cool Teen Titans Teen Titans Clarence Steven Univ. We Bare Gumball Teen Titans Teen Titans Clarence Steven Univ. TVLND 57(:12) Family Feud ’ Å Family Feud Family Feud Family Feud ››› “Three Men and a Baby” (1987, Comedy) Tom Selleck. Å Reba Å (:36) Reba ’ (:12) Reba ’ Å (1:48) Reba (:24) Reba ’ Reba Å Reba Å AMC 58The Rifleman The Rifleman The Rifleman The Rifleman The Rifleman The Rifleman The Rifleman The Rifleman ›››› “The Shawshank Redemption” (1994, Drama) Tim Robbins. ‘R’ Å›› “Jumanji” (1995, Fantasy) Robin Williams. ‘PG’ Å TCM 59“Dr. Jekyll and Mr. Hyde” ››› “Gaslight” (1944) Charles Boyer. Å (DVS) ›››› “Mrs. Miniver” (1942) Greer Garson, Walter Pidgeon. Å (DVS) ›››› “Goodbye, Mr. Chips” (1939) Robert Donat. ›››› “Gandhi” (1982) Ben Kingsley. HALL 60I Love Lucy I Love Lucy The Middle The Middle Golden Girls Golden Girls Golden Girls Golden Girls “Accidentally in Love” (2010, Drama) Jennie Garth. Å “Stranded in Paradise” (2014) Vanessa Marcil. Å “Love by the Book” (2014) OXYGEN 61Paid Program Paid Program House “Risky Business” ’ House “The Confession” ’ Killerpost Å Killerpost Snapped Snapped Snapped Snapped BRAVO 62Top Chef Real Housewives/Beverly Real Housewives/Beverly Happens Vanderpump Rules Vanderpump Rules Vanderpump Rules Vanderpump Rules After Show Tour Group Housewives/Atl. SYFY 63Paid Program Paid Program Twilight Zone “Grendel” (2007, Adventure) Chris Bruno, Ben Cross. Å›› “The 13th Warrior” (1999) Antonio Banderas. Å›› “Aliens vs. Predator: Requiem” (2007) Å›› “Cloud Atlas” (2012) Tom Hanks. Å SPIKE 64Paid Program Csweat Paid Program Paid Program ››› “The Incredible Hulk” (2008, Action) Edward Norton, Liv Tyler. ’››› “I Am Legend” (2007, Science Fiction) Will Smith, Alice Braga. ’ Cops Å Cops Å Cops Å Cops Å COM 65Paid Program Paid Program Com. Central (:21) ›› “Tower Heist” (2011, Comedy) Ben Stiller, Eddie Murphy. Å (:11) ››› “Coming to America” (1988, Comedy) Eddie Murphy, Arsenio Hall. Å Key & Peele Key & Peele Key & Peele Key & Peele MTV 66Teen Mom ’ Å Teen Mom “Walk Away” ’ MTV Suspect ’ Ridiculous. Ridiculous. Ridiculous. Ridiculous. Ridiculous. (:45) Ridiculousness ’ Ridiculous. Ridiculous. Ridiculous. Ridiculous. White Chicks VH1 67Mob Wives ’ Å Mob Wives ’ Å››› “Hairspray” (2007) John Travolta, Nikki Blonsky. ’››› “Breakfast Club” (1985) Emilio Estevez, Molly Ringwald. ’ Å›› “Couples Retreat” (2009, Comedy) Vince Vaughn. ’ CMTV 68CMT Music ’ CMT Music ’ Hot 20 Countdown Popular music videos and news. (N) Å Party Down South Redneck Island “Tuff Luck” Steve Austin’s Broken Skull ›››› “Stand by Me” BET 69Paid Program Paid Program House/Payne House of Payne House/Payne ››› “Precious” (2009, Drama) Gabourey Sidibe, Mo’Nique, Paula Patton. Å Movie SCIENCE 83How the Universe Works ’ How the Universe Works ’ Trek Nation The legacy of Gene Roddenberry. ’ Å Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science CSPAN2 85Key Capitol Hill Hearings ’ Book TV ’ Book TV ’ EWTN 100St. Michael Holy Rosary Daily Mass - Olam Catholic Fam. With Jesus Truth in Heart At Home with Jim and Joy Holy Rosary Daily Mass - Olam Religious Faces/Mary EWTN on Location (N) Mercy Rosary/Life WPXA ION 107 Elizabeth Paid Program Paid Program Pastor Chris Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU DISXD 117Spider-Man Spider-Man Yo-Kai Watch Yo-Kai Watch The 7D The 7D (N) Phineas, Ferb Gravity Falls Lab Rats vs. Mighty Med Lab Rats: Bionic Island Lab Rats Lab Rats ›› “The Game Plan” (2007, Comedy) Madison Pettis GSN 144Paid Program Paid Program Paid Program Paid Program Deal or No Deal ’ Å Deal or No Deal ’ Å Newlywed Newlywed Newlywed Newlywed Newlywed Newlywed The Chase Å Chain Rea. Chain Rea. COOK 153Unique Eats Unique Eats Unique Unique Korean Food Siba’s Table Food Safari Kitchens Kelsey Home. Kelsey’s Ess. Brunch at Brunch at Real Girl Real Girl Tiffani’s Tiffani’s Tia Mowry Tia Mowry WE 163Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program House “Forever” ’ Å House “Who’s Your Daddy?” House “No Reason” Å House “Meaning” ’ Å House “Cane & Able” Å House “Informed Consent” GALA 217Pagado Pagado Pagado Pagado Pagado Lo Mejor de Aquí y Ahora Tras la Verdad Mojoe Cómplices al Rescate Cómplices al Rescate Chespirito Chespirito TELE 223Pagado Pagado Raggs ’ Raggs ’ Noodle Noodle LazyTown ’ LazyTown ’ Pagado Pagado SOS: Salva Mi Casa (SS) ›› “X-Men Origins: Wolverine” (2009) Hugh Jackman. “Once Upon” UNIV 224Pagado Pagado Pocoyo (SS) Sesame Mickey Mickey Handy Manny Handy Manny Pagado Pagado La Rosa de Guadalupe LAnzate! Sabadazo NBCSP 311Premier English Premier League Soccer Premier (9:55) English Premier League Soccer (N) (Live) Premier College Basketball VCU at George Washington. (N) (Live) College Basketball DLC 319Mystery Diagnosis ’ Å Mystery Diagnosis ’ Å Dr. G: Medical Examiner ’ Dr. G: Medical Examiner ’ Dr. G: Medical Examiner ’ Dr. G: Medical Examiner ’ Dr. G: Medical Examiner ’ Dr. G: Medical Examiner ’ Dr. G: Medical Examiner ’
SATURDAYAFTERNOON/EVENING FEBRUARY 27, 2016 4 PM 4:30 5 PM 5:30 6 PM 6:30 7 PM 7:30 8 PM 8:30 9 PM 9:30 10 PM 10:30 11 PM 11:30 12 AM 12:30 WRCBNBC 3 (3:00) PGA Tour Golf Honda Classic, Third Round. (N) News Nightly News Entertainment Tonight (N) ’ NHL Hockey Detroit Red Wings at Colorado Avalanche. From Coors Field in Denver. (N) News (:29) Saturday Night Live ’ Å WELFTBN 4 Max Lucado News Praise the Lord Å The Bible Precious Memories In Touch W/Charles Stanley Hour Power: Schuller Graham Classic Crusades ›› “Fireproof” (2008, Drama) Kirk Cameron, Erin Bethea. WTNB 5Game Game of the Week First Baptist Church Around Town Around Town Around Town Around Town WFLICW 6 ›› “Planet of the Apes” (2001) Mark Wahlberg. Person of Interest ’ Å Mike & Molly Mike & Molly Mod Fam Mod Fam Big Bang Big Bang 2 Broke Girls 2 Broke Girls Ring of Honor Wrestling Two Men Two Men WNGHPBS 7 (12:00) GPB Favorites Weekend GPB Favorites GPB Favorites DAYSTAR 8Christian Z. Levitt Supernatural Huch Jewish Jesus Israel News “The Epic Journey” (2015, Documentary) Kenneth W. Jay Sekulow In Touch W/Charles Stanley Perry Stone Green Room Hillsong TV Joel Osteen WTVCABC 9 Shall We Dance on Ice ’ Paid Program US DOCTORS News World News Wheel Jeopardy! ’ NBA NBA Basketball Golden State Warriors at Oklahoma City Thunder. (N) News Monopoly Mil. Paid Program Entertainers WTCIPBS 10 Hometime Tennessee Weekend Southern Classic Gospel ’ Å Wait for God Wait for God Keeping Up Keeping Up As Time... As Time... Call the Midwife ’ Å Sun Studio Music Austin City Limits ’ Å WDSIFOX 11 (3:30) ›››› “Coming Home” (1978) Jane Fonda. Å›››› “Platoon” (1986, War) Tom Berenger. Å The Young Riders “Bulldog” The Young Riders ’ Å The Young Riders ’ Å Dead Man’s Gun ’ Å Dead Man’s Gun ’ Å WDEFCBS 12 College Basketball Kentucky at Vanderbilt. (N) (Live) Å Paid Program CBS News Paid Program Fish Oil NCIS: New Orleans “I Do” NCIS “16 Years” ’ 48 Hours ’ Å News Paid Program Paid Program Paid Program QVC 13Dooney & Bourke Handbags and accessories. Perricone MD Serta IT Cosmetics Perricone MD Serta Perricone MD Bose Sound Innovations CSPAN 14(2:15) Washington This Week ’ Communicat Washington This Week ’ Key Capitol Hill Hearings Speeches. ’ Key Capitol Hill Hearings ’ WGN-A 15(:13) ›› “The Siege” (1998, Suspense) Denzel Washington, Annette Bening. Å››› “The Perfect Storm” (2000, Suspense) George Clooney, Mark Wahlberg. Å››› “The Last Samurai” (2003, Adventure) Tom Cruise, Ken Watanabe. Å HSN 16Comfort Cooking (N) Slinky Brand Fashions (N) Jewels by Jen-Jennifer Jewels by Jen-Jennifer Perlier (N) Andrew Lessman/ProCaps Andrew Lessman/ProCaps Steven by Steve Madden High Tech Home Electronics E! 23The Kardashians The Kardashians The Kardashians The Kardashians The Kardashians ›› “Safe Haven” (2013) Josh Duhamel, Julianne Hough. Å (DVS) ›› “Safe Haven” (2013) Josh Duhamel. ESQTV 24Team Ninja Warrior Å Team Ninja Warrior Å Team Ninja Warrior Å Team Ninja Warrior Å››› “Zombieland” (2009) Woody Harrelson. Premiere. Beowulf “Episode 106” (N) ›› “Highlander” (1986) Christopher Lambert. Å LIFE 25“Abducted: The Jocelyn Shaker Story” (2015) Å “His Secret Family” (2015, Drama) Haylie Duff. Å “The Suicide Note” (2016) Kirby Bliss Blanton. Premiere. (:02) “Pregnant at 17” (2016, Suspense) Josie Bissett. Å (12:02) “The Suicide Note” TLC 26Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Untold Stories of the E.R. ’ Sex Sent Me to the E.R. (N) Sex Sent Me to the E.R. ’ Untold Stories of the E.R. ’ TBS 27Friends ’ Friends ’ 2 Broke Girls 2 Broke Girls 2 Broke Girls 2 Broke Girls 2 Broke Girls Big Bang Big Bang Big Bang Big Bang Big Bang Big Bang Big Bang Full Frontal Angie Tribeca ›› “Old School” (2003) TNT 28“Resident Evil: Retribution” ›› “The Island” (2005, Action) Ewan McGregor, Scarlett Johansson. Å (DVS) ›› “Clash of the Titans” (2010) Sam Worthington. › “Wrath of the Titans” (2012, Fantasy) Sam Worthington. “Resident Evil: Retribution” USA 29Blindspot “Bone May Rot” Blindspot “Split the Law” ’ Blindspot “Cede Your Soul” Blindspot “Sent on Tour” ’ Blindspot ’ Å (DVS) Blindspot “Authentic Flirt” Blindspot ’ Å (DVS) Colony “Broussard” Suits “Tick Tock” FX 30(2:00) ››› “Moneyball” ››› “Captain Phillips” (2013, Docudrama) Tom Hanks, Catherine Keener. ’ Å››› “American Hustle” (2013) Christian Bale, Bradley Cooper. ’ Å››› “Zero Dark Thirty” (2012) Jessica Chastain. ’ ESPN 31College Basketball Maryland at Purdue. (N) (Live) College Basketball North Carolina at Virginia. (N) (Live) College GameDay (N) Å College Basketball Florida at LSU. (N) (Live) Å SportsCenter (N) Å SportsCenter (N) Å ESPN2 32College Basketball Notre Dame at Florida State. (N) (Live) College Basketball Kansas State at Iowa State. (N) (Live) College Basketball Gonzaga at BYU. (N) (Live) College Basketball Fresno State at New Mexico. (N) (Live) College Basketball FSTN 33NHL Hockey: Blues at Predators Postgame College Basketball Villanova at Marquette. College Basketball Untold Stories NASCAR Driven College Basketball SEC 34Basketball SEC Now (N) College Basketball Auburn at Alabama. (N) (Live) SEC Now (N) College Basketball Arkansas at Tennessee. (N) (Live) SEC Now (N) (Live) SEC Now SEC Now SEC Now GOLF 35(3:00) LPGA Tour Golf Honda Thailand, Third Round. Golf Central (N) (Live) PGA Tour Golf The Honda Classic, Third Round. From Champions Course in Palm Beach Gardens, Fla. Golf Central FS1 36Setup NASCAR Racing Camping World Truck Series: Georgia 200. Cameras Motorcycle Racing Monster Energy Supercross: Atlanta. (N) (Live) Å NHRA Drag Racing NASCAR Racing FSSE 37Women’s College Basketball Trackside Live Future Phen. SportsMoney Women’s College Basketball Iowa State at Oklahoma. College Basketball Boxing WEA 38Highway Thru Hell Highway Thru Hell Dead of Winter: The Donner Party Highway Thru Hell Highway Thru Hell Highway Thru Hell Natural Born Monsters Natural Born Monsters CNBC 39Paid Program Paid Program Paid Program Paid Program Paid Program Paid Program Undercover Boss ’ Å Undercover Boss ’ Å Undercover Boss ’ Å Undercover Boss “Vivint” ’ Undercover Boss ’ Å Undercover Boss ’ Å MSNBC 40Caught on Camera Caught on Camera Caught on Camera In Coldest Blood The Mind of Manson Lockup: Indiana Lockup: Pendleton Lockup: Pendleton Lockup: Pendleton CNN 41CNN Newsroom CNN Newsroom CNN Special Program CNN Special Program CNN Special Program CNN Special Program CNN Special Program This Is Life With Lisa Ling This Is Life With Lisa Ling HDLN 42Forensic File Forensic File Forensic File Forensic File CNN Special Program CNN Special Program CNN Special Program CNN Special Program Forensic File Forensic File Forensic File Forensic File This Is Life With Lisa Ling FNC 43America’s News HQ The Five America’s News HQ FOX Report (N) Stossel Justice With Judge Jeanine The Greg Gutfeld Show (N) Red Eye With Tom Shillue Justice With Judge Jeanine HIST 44American Pickers ’ Å American Pickers ’ Å American Pickers ’ Å American Pickers ’ Å American Pickers ’ Å American Pickers ’ American Pickers ’ Å (:03) American Pickers ’ (12:01) American Pickers ’ TRUTV 45truTV Top Funniest truTV Top Funniest truTV Top Funniest Carbonaro Carbonaro Carbonaro Carbonaro Those Who Those Who Those Who Those Who Carbonaro Carbonaro Carbonaro Carbonaro A&E 46The First 48 ’ Å The First 48 ’ Å The First 48 ’ Å The First 48 ’ Å The First 48 ’ Å The First 48: Houses The First 48: Houses The First 48: Confessions (12:03) The First 48 Å DISC 47Diesel Brothers ’ Å Diesel Brothers ’ Å Diesel Brothers ’ Å Diesel Brothers ’ Å MythBusters ’ Å Street Outlaws: New Orleans Street Outlaws ’ Å Street Outlaws ’ Å Street Outlaws ’ Å NGC 48Inside Cocaine Wars Inside Cocaine Wars Inside Cocaine Wars Inside Cocaine Wars Mick Dodge Mick Dodge The Boonies The Great Human Race The Boonies The Great Human Race TRAV 49Food Paradise Å Food Paradise Å Ghost Adventures Å Ghost Adventures Å Ghost Adventures Å Ghost Adventures (N) Å Ghost Adventures Å The Dead Files Å Ghost Adventures Å FOOD 50Chopped Restaurant: Impossible Guy Vacation Am. Diner Chopped Chopped Chopped Chopped Chopped Chopped HGTV 51Flip or Flop Flip or Flop Flip or Flop Flip or Flop Flip or Flop Flip or Flop Flip or Flop Flip or Flop Property Brothers Å Property Brothers Å House Hunters Renovation Log Cabin Log Cabin Property Brothers Å ANPL 52To Be Announced Treehouse Masters ’ Dogs 101 Dogs 101 (:01) Pit Bulls and Parolees (:02) Pit Bulls and Parolees (:03) Pit Bulls and Parolees Pit Bulls and Parolees ’ FREE 53››› “Grease” (1978, Musical) John Travolta, Olivia Newton-John. (:45) ››› “Clueless” (1995, Comedy) Alicia Silverstone, Stacey Dash, Brittany Murphy. ››› “Pitch Perfect” (2012) Anna Kendrick, Skylar Astin, Rebel Wilson. › “John Tucker Must Die” DISN 54Girl Meets Best Friends Whenever ’ Liv-Mad. Bunk’d Å››› “Monsters, Inc.” (2001) ’ ‘G’ Å (:10) ››› “Monsters University” (2013) ’ ‘G’ Å Lab Rats Gamer’s G. K.C. Under. Best Friends Jessie Å Jessie Å NICK 55SpongeBob Game Thundermans Thundermans Thundermans Henry Danger Henry Danger Henry Danger Game Nicky, Ricky 100 Things Thundermans Full House Full House Full House Full House Friends ’ (:33) Friends TOON 56We Bare Gumball Teen Titans We Bare Regular Show Regular Show Advent. Time Advent. Time Dragon Ball Z King of Hill King of Hill Cleveland Cleveland Amer. Dad Family Guy Family Guy Dragon Ball Z Akame TVLND 57Reba Å Reba Å Reba Å Reba Å› “Mr. Deeds” (2002) Adam Sandler, Winona Ryder. Raymond Raymond Raymond Raymond Raymond Raymond King King King King AMC 58(2:00) Jumanji ›› “Tremors” (1990, Horror) Kevin Bacon. ‘PG-13’ Å››› “Jurassic Park” (1993, Adventure) Sam Neill, Laura Dern. ‘PG-13’ Å›› “King Kong” (1976, Adventure) Jeff Bridges, Jessica Lange. ‘PG’ Å›› Tremors TCM 59(2:30) ›››› “Gandhi” (1982) Å (:45) ››› “Chariots of Fire” (1981) Ben Cross, Ian Charleson. Å›››› “Breaking Away” (1979) Dennis Christopher. ››› “Diner” (1982) Steve Guttenberg, Kevin Bacon. Å››› “Apollo 13” (1995) HALL 60(3:00) “Love by the Book” “Love, Again” (2015) Teri Polo, Paul Johansson. Å “All of My Heart” (2015, Romance) Lacey Chabert. Å “Dater’s Handbook” (2016) Kristoffer Polaha. Å Golden Girls Golden Girls Golden Girls Golden Girls OXYGEN 61Snapped Snapped Killerpost An “unfriending.” Killerpost Å Killerpost Å Killerpost “Taylor; Mitchell” Snapped Killerpost “Taylor; Mitchell” Snapped BRAVO 62Housewives/Atl. Housewives/Atl. › “Coyote Ugly” (2000) Piper Perabo, Adam Garcia. › “Coyote Ugly” (2000) Piper Perabo, Adam Garcia. ››› “Forgetting Sarah Marshall” (2008) Jason Segel, Kristen Bell. Forget Sarah SYFY 63(2:30) ›› “Cloud Atlas” (2012, Drama) Tom Hanks, Halle Berry. Å› “Gone in Sixty Seconds” (2000) Nicolas Cage, Angelina Jolie. Å›› “The Lone Ranger” (2013, Western) Johnny Depp, Armie Hammer. Å›› “Cloud Atlas” (2012) SPIKE 64Cops Å Jail ’ Å Cops Å Cops Å Cops Å Jail ’ Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å Cops Å››› “Scarface” (1983) ’ COM 65Key & Peele (:44) Key & Peele Å Key & Peele Key & Peele Key & Peele Kevin Hart: Grown Little Man Kevin Hart: Laugh Kevin Hart: Seriously Funny Trevor Noah: African Kevin Hart: Laugh Trevor Noah: African MTV 66(3:40) ›› “White Chicks” (2004) Shawn Wayans. ’›› “Project X” (2012) Thomas Mann, Oliver Cooper. ’› “21 and Over” (2013) Miles Teller, Skylar Astin. ’›› “White Chicks” (2004, Comedy) Shawn Wayans. ’››› “8 Mile” (2002) ’ VH1 67Couples Ret. Mob Wives ’ Å Mob Wives ’ Å Stevie J Stevie J Stevie J Love & Hip Hop ’›› “Space Jam” (1996, Comedy) Michael Jordan. ’›› “Roll Bounce” (2005) Bow Wow, Chi McBride. ’ CMTV 68(3:00) “Stand by Me” (1986) ›› “Raising Helen” (2004, Comedy-Drama) Kate Hudson, John Corbett, Joan Cusack. › “Fool’s Gold” (2008, Action) Matthew McConaughey, Kate Hudson. TBA Cops Rel. BET 69››› “The Help” (2011) Viola Davis, Emma Stone. An aspiring writer captures the experiences of black women. Å›››› “12 Years a Slave” (2013) Chiwetel Ejiofor. Premiere. Å (:18) ››› “Precious” (2009, Drama) Gabourey Sidibe, Mo’Nique. Å SCIENCE 83Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science Outrageous Acts of Science CSPAN2 85(3:00) Book TV ’ After Words ’ Book TV ’ Book TV ’ EWTN 100Web of Faith 2.0 Å Bridegrm Bookmark Worth Living Wales Mother Angelica Live Dominic - Light of the Church Holy Rosary Living Right With Dr. Ray Thirst for Truth - for Souls Daily Mass - Olam WPXA ION 107 Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU Law & Order: SVU DISXD 117Game Plan Gravity Falls Gravity Falls Gravity Falls Gravity Falls Gravity Falls Gravity Falls Star-For. Pickle-Peanut Spider-Man Spider-Man Guardians Star-Rebels Pickle-Peanut Spider-Man Spider-Man Guardians Star-Rebels GSN 144Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Family Feud Idiotest Idiotest Idiotest Idiotest Chain Rea. Chain Rea. COOK 153Suppers Suppers Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Junk Food Unique Sugar Junk Food Junk Food WE 163House “Lines in the Sand” House “Fools for Love” ’ House “Que Sera Sera” ’ House “Son of Coma Guy” House “Whac-A-Mole” ’ House “Finding Judas” ’ House ’ Å House “Words and Deeds” House ’ Å GALA 217Chespirito El Chavo El Chavo El Chavo La Rosa de Guadalupe Como Dice el Dicho (SS) La Rosa de Guadalupe La Rosa de Guadalupe La Rosa de Guadalupe Cuando me enamoro Cuando me enamoro TELE 223“Once Upon” Noticiero Tel. Videos Asom. La Reina del Sur ’ (SS) ·Qué Noche! Con Angélica y Raúl ’ (SS) America’s Funniest Videos T. Telemundo Videos Asom. Decisiones Extremas (SS) UNIV 224(2:00) Sabadazo Durmiendo Noticiero Fútbol Mexicano Primera División: Azul vs Rayados Crónicas de Sábado Sal y Pimienta Durmiendo Noticiero Estrellados (N) (SS) NBCSP 311Basketball Curling Mixed doubles From Eveleth, Minn. NHL Top 10 College Hockey Boston University at Notre Dame. (N) (Live) NHL Top 10 Premier League Match of the Day (N) ’ Running Tokyo Marathon. DLC 319Hoarding: Behind- Doors Hoarding: Buried Alive ’ Hoarding: Buried Alive ’ Hoarding: Buried Alive ’ Mystery Diagnosis ’ Å Mystery Diagnosis ’ Å Monsters Inside Me Å Mystery Diagnosis ’ Å Mystery Diagnosis ’ Å 20—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com ')#, 4$,+%#3+/.2 GOP rivals barrel toward Super Tuesday !% * !(+!* &+(* & ( # . &+%*. * %% )) #/C@73 $/B67A '#!% *! ,) @3E @/<23<0C@5 % %* HOUSTON (AP) — The GOP worker violations. &" * %+$ ( , !* '' (!% 4@=; B63 1=;>:/7>3/@7<5 B6/B 67A 63@ E63@3/0=CBA /@3 C<9<=E< A= B6/B =@27@=13AA 1/<<=B 03 Super Tuesday after a name- had “discovered the issue of A3@D32 C>=< B63 343<2/>3/@ /<2 ;/93 2343 14. Want To Buy 30. Help Wanted - Full Time 40. General Services Offered 50. mobile Homes For Rent 56. Houses For Sale 62. Boats & marine Equipment Wanted to buy Crew Cab, short CRM ReadY Mix now Hiring Con- BoBCat FoR Rent or Hire with CoLLeGetoWn MoBILe eS- 2206 BoWeR Lane- 3 bedroom, 2 bed Pickup. Have maintenance re- crete Ready-Mix truck drivers, trencher or brush cutter, mini exca- tateS: two bedrooms nice and bath, stove, refrigerator, washer/ cords 2006- 2008. Call Class a or B. Good starting pay! vator with thumb, tractor loader with clean. 472–6555. dryer, dishwasher, $99,900. 423-339-2233. Come by 1601 6th Street ne to ap- boxscrape or bushhog. 423-544-4582. ply. 423-478-2724. Move In special 2 and 3 bedrooms, Wanted: R12 FReon. Refrigerant $100 weekly and up, $300 deposit InveSt YoUR tax refund! Remod- 12 collecting dust in your garage? deLIveRY dRIveR needed. Box Bo’S tRee SeRvICe: over 30 and up. no pets, 423-473-3684. eled houses, 3 bedrooms, 2 baths, ePa certified pays Ca$H for R12. truck experience helpful. apply in years experience. Insured, free es- dens, basements. owner/ agent fi- (312)291-9169, person at Scotts Furniture Company timates. Bucket truck. 52. Sleeping Rooms nancing. StonY BRookS ReaLtY 423-479-4514. [email protected]. 1650 South Lee Highway, Cleve- 423-284-9814 or 423-544-2249. $129 PLUS tax weekly special, 1 land. 15. Yard Sales person with ad, HBo/ eSPn. We BUY houses for cash dentaL PRaCtICe looking for a BoX tRaILeRS, 40' goose neck 423-728–4551. 423-829-0447. BaCk FoR the 2nd year. the Yarde full- time dental assistant. the candi- trailer, dump trailer, towable grill for APARTMENTS & BReeZeWaYeXtendedStaY.CoM House. Cleveland's first and only date must be outgoing, dependable, rent. 423-478-2724. 59. mobile Homes For Sale adult consignment sale. Men and WeekLY rate paid in advance, aver- HOMES FOR RENT enthusiastic, and motivated. one dannY'S tRee SeRvICe: tree re- ages $46.43 nightly plus tax. 28X52 doUBLeWIde home, 3 bed- Women clothing, home furnishings, plus year of experience with a li- moval, shrubbery trimmed and rooms, 2 baths, nice! with heat/ air décor, tools, sporting goods, bridal 423-584-6505. 423-476-5518 cense in dental assisting in the state planted, firewood. Senior discounts. unit, 2 decks, $15,500. Online Rental Payment Available etc. dates april 23- May 2nd at the of tennessee. the following certifi- 30 years experience. 423-244-6676. 53. Houses For Rent 423-479-5945, 423-618-1218. armory located at 1985 dalton Pike. cations are a plus: Radiology, ni- ASK ABOUT SELECT “SPECIALS” Follow us on Facebook or email us trous, Coronal Polishing, and Seal- eXtReMe MaIntenanCe Home/ $1,050: 3- 4 Bedroom, 2.5 bath, 62. Boats & marine Equipment www.bender-realty.com at [email protected] for Mobile Home Commercial, residen- ants. Send resume to 1,768 square feet, split foyer with 2005: 16 Foot tracker Bass Boat or come by office more to get a consignor number and [email protected] or mail to: tial, Painting (interior/ exterior). fireplace and 1 car garage with more information. decks, plumbing, electrical, roofing, with 115 hp motor and trailer. $6,000 425 25th Street #753-P, c/o Cleveland daily Banner, opener, large yard. 423-472-4000 or firm. 423-665-3304. siding, all work! 30 years experi- www.jonesproperties.biz CaLL Me BeFoRe YoU doWn- P.o. Box 3600, Cleveland, tn 37320-3600 ence. Free estimates. SIZe or have an estate sale. I buy 423-331-7045. $1,200: 3 Bedroom, 2.5 bi- level used furniture, collectibles, antiques. eaRLY CHILdHood educators home with fireplace, garage and 423-240-8205. needed for 3 Star rated childcare oCoee SeRvICeS: Mowing, large back yard. 423-472-4000 or Landscaping, commercial/ residen- CHILdRen'S BoUtIqUe Clothing program. Please contact www.jonesproperties.biz. (423)894-4734 or (423)280-2329. tial, licensed/ insured. Free esti- Sale: Saturday 10am-4pm at the mates. www.ocoeeservices.com $800: 3 Bedroom, 2 bath ranch, Coffey Barn, 2688 Benton Pike. eaRn tHoUSand$ from home. Be 423-475-7183. 1,024 square foot, close to Lee Uni- CaSH onLY! careful of work-at-home schemes. versity 423-472-4000 or Matilda Jane, Giggle Moon, Chloe Hidden costs can add up, and re- one CaLL cleans it all! Full home www.jonesproperties.biz. & Isobella, Janie & Jack, la Jenns, quirements may be unrealistic. cleaning service. no job to big or lolly Wolly doodle, Jelly the Pug, Learn how to avoid work-at-home small. 931-302-2025 (Cleveland). Customs & Boutique remakes, and scams. Call the Federal trade Com- many more. Sand Salt, San Sun, mission. 1-877-FtC-HeLP. a mes- 41. Professional Services Livie Luca, Minnie Melissa, Postal sage from Cleveland daily Banner Projections, Squeaker, "Blinged and the FtC. or visit our Web site at Wanted: MentaL, Behavioral, In- out" Converse. PRoM dReSSeS. www.ftc.gov dividual, Group, a & d, Professional Counseling position. 423-303-0472. CoMMUnItY HaLL thrift Store will eXPeRIenCed, LICenSed, P & C be closing. We are going to give Individual for local insurance 45. vacation Rentals clothes to the needy Saturday agency. Mail resume to ocoee In- 2 RIveRS CaMPInG: Rv Park, PUBLISHeR'S notICe: all real es- 10am-2pm. 1305 6th Street ne, surance Services, P. o. Box 63, Cabin Rentals, directly on the river tate advertised in this newspaper is 423-472-2178. Cleveland tn 37364. at junction of Hiwassee and ocoee subject to the Federal Fair Housing Rivers. 423-338-7208. act of 1968 and the tennessee Hu- MovInG SaLe: Friday and Satur- FULL tIMe Honda technician man Rights act which makes it ille- Cleveland Daily Banner day 9am-12noon. no eaRLIeS needed. Climate controlled shop, BeaR PaW CottaGeS- 2, 3 bed- gal to advertise "any preference, PLeaSe!! Gold prospecting equip- Monday- Friday, benefits after 90 rooms, $75- $85. Mountains, fire- limitation or discrimination based on is presently accepting applications ment (water pump, hoses, nozzle, days. apply at 2445 South Lee High- place, serenity. 423-476–8480. race, color, religion, sex, or national for independent contracted newspaper carriers etc.) air compressor, drill press, way or call 423-790-7270. origin, handicap/ disability or an in- electric pole saw, assortment of 46. Storage Space For Rent tention to make any such prefer- for the McDonald area. hand tools, variety of lighting fix- FULL tIMe veternarian technician ence, limitation or discrimination." needed for local animal hospital. ex- CaLFee'S MInI Warehouse for rent: tures, pictures, glassware, clothing, Georgetown Pike, Spring Place this newspaper will not knowingly carpet cleaner. Large variety of al- perience and license preferred with accept any advertising for real estate Daily newspapers must be delivered by 5: PM good technical skills, and people Road and Highway 64. Call most everything. 2368 Interlackin 476–2777. which is in violation of the law. our Circle nW Cleveland, tn. skills. Send resume to: #756-P, c/o readers are informed that all dwell- Monday thru Friday Cleveland daily Banner, P.o. Box teMPSaFe StoRaGe ings advertised in this newspaper Sunday by 7: AM 18. Articles For Sale 3600, Cleveland, tn 37320-3600 Climate Controlled are available on an equal opportu- & outside Units eXPeRIenCed CaReGIveRS and nity basis. equal Housing opportu- LG 42" Led Smart tv, $300; ko- downtown Location nity, M/F. balt full size truck stainless steel Cnas who are available to work & Georgetown Road Dependable transportation, valid driver’s license toolbox $175; Ge microwave, 2nd, 3rd, or weekends. Please apply 614-4111 4 BedRooM, 2 bath, hardwood and insurance are required. black, 1200 w, 2 cubic foot $100. in person at 60 25th Street nW #3, floors, garage, $875 monthly. Close Call 790-7235. in Cleveland. Monday- Friday from 47. Business Property For to north Lee elementary. 11am-5pm. Rent 423-280-9333. Applications will be accepted LoSe 30 lbs. in 30 days! Medical doctors say the only way to lose oFFICe/ RetaIL- Star vue Square 3 BedRooMS, 1.5 bath, $850 Monday–Friday 9: AM – 4: PM weight is to eat less and exercise 7,000 square feet, $4,000 monthly. monthly, $850 deposit. more. Learn how to avoid owner/ agent 423-987-9232. 423-310-7906. weight-loss scams. Call the Federal 48. Office Space For Rent attRaCtIve, PRIvate 2 bedroom Cleveland Daily Banner trade Commission at house, front deck, back deck, 1 car 1-877-FtC-HeLP. a message from oFFICe avaILaBLe. Multiple sizes, 1505 25th Street NW 423-991-4984. garage, washer/ dryer hookup, $650 Cleveland daily Banner and the monthly plus deposit. References re- Cleveland TN 37311 FtC. or visit our Web site at JoB FaIR full time positions needed: OFFICE/ RETAIL Space Available, quired. no Smoking. no pets. www.ftc.gov Managers and Crew. Part time posi- short and long term lease. Several 423-472-6641 or 423-650-3335. tions also available. Flexible sched- locations, priced from $300 up. Call MovInG SaLe- Chest freezer, bed- ules, meal discounts and competitive ModeRn one level, 3 bedroom, 2 NO PHONE CALLS PLEASE room suite, velour lounger, Broyhill Jones Properties 423-472-4000 pay. Hiring for all Cleveland loca- www.jonesproperties.biz. bath, cathedral ceilings, hardwood/ couch, large pine tv cabinet, nu- tions. JoB FaIR Wyngate Hotel 110 tile, appliances, 2 car garage, level merous household items. Interstate drive nW, Cleveland, tn 49. Apartments For Rent lot, $1,300 rent, credit check re- 423-650-0186. Saturday, February 27 10am-? quired, 423-667-6555. $1,650, LUXURY, furnished, 2 bed- oLIve GReen suede couch and LoCaL CoMPanY hiring over the room condo, has everything you nICe HoUSe north of town 3 bed- OPEN HOUSE SUNDAY 2-4 loveseat, reversible pillows $250. road drivers Class a CdL. 2 years need! Washer/ dryer, utilities and ca- room, 2 bath, large bonus room, for- coffee table, 2 end tables oak col- minimum experience with good re- ble, flexible lease. mal dining room, double garage ored $75. 423-303-8103. cord. 423-595-8922. 423-618-6383. $1,650 monthly. 423-667-4967. PALLETS!!! LPn, LICenSe in tn, full time. 1- 2 $1,800: LUXURY apartment, fully 56. Houses For Sale FREE WHILE THEY LAST! years experience. Busy Family furnished, utilities paid. Located on Cleveland Daily Banner Medicine practice looking for a nurse quiet side street. Contact Jones ATTENTION with a great attitude to work in an Properties 423-472-4000 FOR SALE BY OWNERS 19. Estate Sales environment where you will be ap- www.jonesproperties.biz I HAvE A BUYER 215 RoBIn Lane, Saturday 9 to 3. preciated. excellent benefits. Send $400: 1 Bedroom, 1 bath close to THAT IS LOOKING FOR antiques, furniture, art, much more, resume aSaP as we need to hire Greenway, water/ sewer paid. A 3-4 BEDROOm, 2-3 BATH north Lee past anatole. soon. email to: 423-472-4000 or HOmE IN NORTH WEST [email protected] or mail www.jonesproperties.biz CLEvELAND WITH 25. Livestock-Horses-Poultry to: #755-P, c/o Cleveland daily Ban- AN IN GROUND POOL ner, P.o. Box 3600, Cleveland, tn $875 LUXURY townhouse new IF YOU HAvE SUCH A HOmE SaLeRS BULLS- calving ease, 37320-3600. Castle drive nW Cleveland 2 bed- CALL OR EmAIL mE performance, great disposition. room, 2 1/2 bath, 423-618-0823. FOR A ONE TImE 5% LISTING Salers Females- unsurpassed neWLY WedS Foods currently has OR IF YOU HAvEN’T BEEN mothers. Call 423-309-3490. web- an opening for an HR generalist in $950: LUXURY townhouse 2 bed- New Construction, Small neighborhood, 3 Bedroom, 2 full room, 2.5 bath, hardwood/ tile/ car- SUCCESSFUL IN SELLING site: www.colmorefarms.com Cleveland. qualified Candidates YOUR HOmE bath Ranch home with Espresso stained Cherry wood should have at least 2 years’ human pet, jacuzzi tub, gas fireplace, with cabinets, beautiful Granite counter tops, kitchen bar. The garage. PRovISIon ReaL eState CALL mE FOR resources experience preferably in a A FREE ASSESSmENT master suite features a trey ceiling with 29. Help Wanted - Part-time manufacturing environment, a and PRoPeRtY ManaGeMent LLC 423-693-0301. HERB LACY crown molding detail, walk-in closet, and a ** SIGN ON BONUS ** for Caregiv- Bachelor’s degree in business, hu- AFFILIATE BROKER master bathroom with a separate garden ers & CNAs Come be a part of our man resources, or a related field. CENTURY 21 tub and stand-up shower. Courtyard style awesome team today! Requires 2 Strong communication skills and 1ST CHOICE REALTORS concrete patio area. Come see it for years of supervised care giving ex- computer skills. Bilingual preferred. [email protected] yourself! Priced at $174,900 perience or Cna with 6 months ex- anyone interested should apply in CELL: 423-593-1508 MLS# 20160817 perience. Must be able to pass back- person at 187 Industrial Lane SW, OFFICE: 423-478-2332 DIRECTIONS: From intersection of Paul Huff Pkwy & Mouse Creek Rd. ground and drug screening. Flexible Cleveland, tn 37311. North on Mouse Creek road for 1 mile. Turn Left on Logan Rd. Turn Listing Agent hours, competitive pay, e o e. Call: Vickie Vernon SaLeS PeRSon/ eStIMatoR, Right into Stone GateSubdivision go to the right of the circle and Home 423-265-2670 or apply online at will be on the Right. 432-3556 www.Sittersetc.com outside Sales position. Requires the ability to measure homes for gutter PUBLISHeR'S notICe: all real es- Kay Mitchell need SoMeone experienced in installation. Responding to estimate tate advertised in this newspaper is requests. Servicing existing ac- Loan Officer landscaping. Must be dependable subject to the Federal Fair Housing NMLS: 156173 counts and calling on new custom- and have drivers license. drug test act of 1968 and the tennessee Hu- 423-708-6027 (Direct) required. 423-472-5399. ers. College degree preferred. Con- 423-242-8500 (Mobile) man Rights act which makes it ille- [email protected] struction sales/ knowledge is a plus. gal to advertise "any preference, PaRtS ReCeIvInG Clerk needed drain Right Guttering, 2077 605 Chestnut Street limitation or discrimination based on BY OWNER: 3 Bedroom, 2 bath, Liberty Tower, Suite 320 20 hours/ week. $9.00/ hour. Must Westland drive, or call race, color, religion, sex, or national 1,552 square feet, propane gas log Chattanooga, TN 37450 PrimeLending NMLS: 13649. Equal Housing Lender be accurate and dependable. apply 423-472-7018. fireplace in living room, black re- at Homestead Lawn & tractor Co, origin, handicap/ disability or an in- tention to make any such prefer- frigerator, glass top stove and dish- 2075 N. OCOEE STREET 3529 aPd-40, Cleveland. StaRS, InC. is hiring Personal as- washer included, white Ge washer/ sistant, wage $8.50. Call ence, limitation or discrimination." this newspaper will not knowingly dryer, large deck on back of house CLEVELAND, TN 37312 RESCARE HOmECARE 423-447-2590 ext. # 1 accessible from master only, dou- of Cleveland accept any advertising for real estate taXI dRIveR needed Chattanooga which is in violation of the law. our ble pane/ storm windows, hard- Ph: (423) 478-2332 4160 N. Ocoee St. Suite 11 wood/ carpet, unfinished base- Cleveland, TN $30 +/ hourly. Call now: readers are informed that all dwell- EQUAL HOUSING ment, 1301 Harrison Pike, Stuart OPPORTUNITY Cna/ Home Health aides needed: 423-593-1255 ings advertised in this newspaper are available on an equal opportu- School Zone, $149,900. Call Each Office Is Independently Owned And Operated Looking for dependable, reliable and teaCHeRS needed to work with 423-593-4574. caring individuals. Must have home nity basis. equal Housing opportu- preschoolers in Christian childcare. nity, M/F. care experience with the ability to Morning, afternoon, and substitute perform household duties and per- positions available. Must be at least 1 oR 2 bedroom available. no pets, sonal care to our clients. to apply: 18 years old with high school di- no smoking in house. For more infor- NO HS DIPLOMA/ www.rescare.com/careers/locations ploma/ Ged. those looking for long mation call 423-227-9146. GED REQUIRED! or call 423-339-5526. term work preferred. experience pre- e o e/ M/ F/ d/ v 2 BedRooM, Clean, dalton Pike ferred, but not required. training area near Walmart, References re- YmCA AFTER SCHOOL provided. north Cleveland Baptist quired. no smoking/ no pets. de- WORKERS NEEDED! 423-472-4172. posit plus $550 monthly. the YMCa needs responsible 423-472-6641, 423-650-3335. adults to supervise students en- UtILItY LIne clearance contractor rolled in after school programs lo- seeks tree trimmers needed to work 2 BedRooMS, 2.5 baths, luxury cated on- campus at local elemen- in athens, tn and the surrounding townhouse with garage, $975 tary schools. Competitive pay, areas. experience in tree trimming is monthly, 423-298-1964. preferred. Health insurance and YMCa membership benefits and 2031 WYnWood- 2 bedroom, den, college scholarships available to 401k are offered. drug screen is re- quired, e-verification is required. We living room, stove, refrigerator, water EARN qualified applicants. Previous furnished. $600 monthly, $275 de- child-related experience preferred. are a drug free company and an e o e. Please call 800-367-6141. posit. no pets. no smoking. noon to Please apply in person at the 6pm call 423-310-0742. Cleveland Family YMCa 220 Ur- 33. Business Opportunities $ bane Road, Cleveland, tn 37312. aPaRtMent FoR Rent off George- INvESTIGATE BEFORE town Road, Winwood drive and YOU INvEST! thompson Lane. 2 Bedroom, 1.5 30. Help Wanted - Full Time always a good policy, especially for bath, full garage, $300 deposit, $500 11 -12 business opportunities and fran- monthly. 423-593-7303. /hr BaIL BondInG aGent/ Con- chise. Call tn division of consumer tRaCtoR needed FoR BRad- affairs at (800) 342-8385 or the Fed- BLYTHEWOOD- STEEPLECHASE LeY CoUntY tn experience in eral trade Commission at (877) APARTmENTS- 1 Bedroom with judicial/ retired law enforcement a FtC-HeLP for free information. or utilities furnished ($389- $579); 2 plus. Send resumes to: visit our Web site at www.ftc.gov Bedroom ($429- $609). appliances [email protected] furnished; duplexes. 423-472–7788. APPLY TODAY—WALK IN : PRoCeSS MedICaL claims from CLean one bedroom apartment, CaB dRIveRS needed. Must must home? Chances are you won’t make have valid driver's license. Cleveland $425 monthly rent, $400 deposit, 6227 Lee Highway, Ste A any money. Find out how to spot a year lease. no pets. no smoking. and Chattanooga areas. Call medical billing scam. Call the Fed- 423-635-2644 for interview. owner/ agent StonY BRookS Chattanooga, TN 37421 eral trade Commission, ReaLtY 423-479-4514. 1-877-FtC-HeLP. Mon-Fri 8AM-5PM CLASS A Drivers needed! Cleve- a message from CLean! 1 bedroom, 1 bath, utilities land based company needing re- Cleveland daily Banner and the not provided. no Pets. Credit Check 423-414-3185 gional drivers with Class- a en- Federal trade Commission. or visit required. 580 Highland drive apt 4. dorsements, home most every our Web site at www.ftc.gov $350 Monthly $350 deposits. Bryan OR APPLY ONLINE: night, we offer health insurance/ 423-902-2293 owner/ agent. paid vacation, holiday pay, quar- 34. money To Lend terly safety bonuses, 2 years over CLeveLand SUMMIt apartments IntegrityTNClevelandBanner.com the road experience required. Con- * LoanS up to $1,250 * Rent is based on income for persons tact us at 423-559-0771. quick approval 62 or older, handicapped or dis- When you apply: Please have ID proving 423-476-5770 abled. We have immediate open- your eligibility to work in the U.S. All job CLeveLand RooFInG Co, Inc. is ings. equal Housing opportunity 44 offers contingent on a background need Ca$H fast but can’t get a Inman Street 479-3005 looking for Roofers and Laborers. a loan? don’t pay for the promise of a check/drug screen. EOE. drivers license is a plus. Must be loan. Call the Federal trade Com- qUIet aRea, very clean, unfur- able to pass a drug test. Hourly pay mission at 1-877-FtC-HeLP to learn nished one Bedroom- Free electric- is based on experience. Must apply how to spot advance-fee loan ity, free water, refrigerator and stove. in person at 307 Industrial Way SW, scams. a message from Cleveland $550 monthly, $175 deposit, 6 Cleveland, tn 37311. no CaLLS daily Banner and the FtC. or visit month lease. no pets, no smoking. PLeaSe. our Web site at www.ftc.gov 423-304-2973. 22—Cleveland Daily Banner—Friday, February 26, 2016 www.clevelandbanner.com WWW.ATHLONSPORTS.COM Think Great Food All Day, Every Day! Don’t forget to follow us! @ AthlonSports / AthlonSports Fast Food Restaurant INSIDECOLLEGE BASKETBALL Located on Keith @ AthlonSports Street • Across from Village Mall A WEEKLY SPIN AROUND THE WORLD OF COLLEGE HOOPS 478-2668 s rr TM Super Deluxe $ Cheeseburger 2.99 LIMIT ONE PER PERSON PER COUPON. NOT VALID WITH ANY OTHER OFFFER. EXPIRES 4/30/16 1. WHICH NORTH CAROLINA WILL WE SEE IN MARCH? This had to be a frustrating week for North Carolina fans. On Wednesday, the Tar Heels collapsed at home to a short-handed Duke team. The Heels led by eight with less than seven minutes left but lost 74–73. Brice Johnson (29 points, 19 rebounds) was a non-factor near the end as the Heels insisted on • Collision Repair shooting 3s (1-of-13). Roy Williams also eschewed a timeout on the Heels’ LOOIDWHG¿QDOSRVVHVVLRQDJDLQVWWKH%OXH'HYLOV1RUWK&DUROLQDWKHQWXUQHG • Frame Work around Saturday to pound Miami 96–71, averaging an astounding 1.41 points • Auto Painting per possession. That team can win a national championship — as long as the Insurance Claims Welcome WHDPIURPWKH¿QDOVL[PLQXWHVDJDLQVW'XNHGRHVQ¶WVKRZXS¿UVW 2. DESPITE BIZARRE FINISH, 2901 Waterlevel Hwy. KENTUCKY GOT BETTER 472-9978 Kentucky’s hot streak came to an end with a ±RYHUWLPHORVVDW7H[DV$ 07KHGH cisive play was a quick change of fortunes. Up 76–75 with nine seconds left in OT, freshman Isaac Humphries drew a charge. In FHOHEUDWLRQRI$ 0¶VWXUQRYHU+XPSKULHV VSLNHGWKHEDOO2I¿FLDOVDVVHVVHGDWHFKQL cal foul — a letter-of-the-law call more than JEWELERS David Fox DVSLULWRIWKHODZFDOO$ 0HQGHGXSZLQ Athlon Sports ning on Tyler Davis’ tip-in off an offensive rebound. The Humphries technical hurt, but Senior Writer North Carolina forward Brice Johnson had 29 points and 19 rebounds in a loss to Duke on Wednesday. WKHIRRW$XVWUDOLDQJDYH.HQWXFN\TXDOLW\ @davidfox615 PLQXWHVLQDSLQFK)RUZDUG$OH[3R\WKUHVV 7. THE BIG TEN WILL GO THROUGH INDIANA was out with injury, and starter Derek Wil- lis went down in the second half with an ankle injury. Humphries stopped the $ZLOGZHHNLQWKH%LJ7HQKDVSXW,QGLDQDLQWRVROHSRVVHVVLRQRI ATHLON SPORTS TOP 25 (FEB. 22) DIAMOND BANDS ¿UVWSODFHRIWKHFRQIHUHQFHOHDGDW±3DUWRIWKDWLVEHFDXVHWKH EOHHGLQJIRU8.RQWKHJODVV$ 0JUDEEHGRIIHQVLYHUHERXQGVLQWKH¿UVW 1. Kansas (23–4) (423) 478-0049 (423) 478-0050 KDOIDORQHDQGRQO\¿YHRIIHQVLYHERDUGVLQWKH¿QDOPLQXWHVLQODUJHSDUW VHFRQGDQGWKLUGSODFHWHDPVVXIIHUHGEL]DUUHXSVHWORVVHV²,RZD 2. Oklahoma (20-4) Stuart Park Plaza because of Humphries’ presence around the basket. ± WR3HQQ6WDWHDQG0DU\ODQG ± WR0LQQHVRWD$OWKRXJK the Hoosiers haven’t played the strongest Big Ten slate, they aren’t 3. Villanova (24–3) 1721 Keith St., N.W. Cleveland, TN 37311 3. SHORT BENCH CATCHES UP TO DUKE EDFNLQJLQWRWKLVHLWKHU7KHLU±ZLQRYHU3XUGXHRQ6DWXUGD\ 4. North Carolina (22–5) In the same week Duke overcame its lack of depth in a 74–73 road win over night was one of their strongest performances of the season; they led 5. Iowa (20–6) North Carolina, the Blue Devils showed why a short bench could derail their by as much as 19 in the second half. Indiana has only three league 6. Xavier (24–3) hopes in March. With Matt Jones sidelined with an ankle injury against Lou- games left, but one is at Iowa and another against Maryland. If the LVYLOOH'XNH¶VVL[PDQURWDWLRQZDVGRZQWR¿YH&KDVH-HWHUSOD\HGPLQ +RRVLHUVSOD\OLNHWKH\GLGDJDLQVW3XUGXHWKH\FDQJUDEWKHVHFRQG 7. Michigan State (22-5) utes against the Cardinals, more than he played in the previous four games Big Ten regular-season title of the Tom Crean era. 8. Virginia (21–5) FRPELQHG1HDUWKHHQGRIWKHJDPHVWDU*UD\VRQ$OOHQIRXOHGRXWIRUFLQJ 8. XAVIER STILL LOOKING FOR ITS BIG BREAK 9. West Virginia (20-7) point guard Derryck Thornton back into action despite a bum shoulder. Lou- 10. Oregon (21-6) In a season in which the top 10 teams are averaging 4.6 losses, why LVYLOOHRXWVFRUHGDQH[KDXVWHG'XNH±LQWKHVHFRQGKDOI7KLVFRXOGVSHOO 11. Maryland (23-5) bad news in a tournament setting. isn’t three-loss Xavier getting more attention? True, the Musketeers DUHUDQNHG¿IWKLQWKH$3EXWWKH\UDUHO\JHWPHQWLRQHGZLWKWKH 12. Baylor (20-7) FOR ALL YOUR 4. OKLAHOMA GOT ITS MOJO BACK OHDGHUVRIWKH$&&%LJ%LJ7HQDQGHYHQ9LOODQRYD;DYLHU 13. Iowa State (19-8) FINANCIAL NEEDS The Sooners entered the weekend losers of three of four, including road losses LVRQHRIVL[WHDPVWRUDQNLQWKHWRSLQERWKRIIHQVLYHDQGGH 14. Arizona (22-5) WR.DQVDV6WDWHDQG7H[DV7HFK2NODKRPD¿QLVKHG6DWXUGD\ORRNLQJOLNHWKH IHQVLYHHI¿FLHQF\RQ.HQ3RPFRPDQGWKHRWKHUVDUHKRXVHKROG 15. Louisville (21–6) Call Today! team that spent three weeks at No. 1 this year. Oklahoma beat West Virginia names (Michigan State, Kansas, Oklahoma, Virginia and Villanova). 16. Indiana (22–6) 76–62 in Morgantown, a critical win for seeding purposes as Kansas grabs If Xavier is able to avenge its 95–64 loss to Villanova on Dec. 31, David Goins 17. Miami (21–5) hold of the Big 12 title. Most important, OU and Buddy Hield proved they the Musketeers won’t be overlooked for long. 95 Second Street could score in spurts again with a decisive 9–0 run in the second half. 18. Kentucky (20–7) 9. DAYTON’S LOSSES ARE ATLANTIC 10’S GAIN 19. Utah (21-7) Cleveland 5. GONZAGA’S NCAA TOURNEY STREAK IS IN DANGER 'D\WRQFOLPEHGWRDVKLJKDV1RLQWKH$3WRSODVWZHHN 20. Notre Dame (18–8) (423) 479-9615 but the Flyers tumbled out of the rankings after losing back-to-back $IWHU6DWXUGD\¶VORVVWR6DLQW0DU\¶V*RQ]DJDSUREDEO\QHHGVWRZLQWKH 21. Duke (20–7) :HVW&RDVW7RXUQDPHQWWRJRWRWKH1&$$V7KHODVWWZRZHHNVKDYHDOOEXW games to St. Joseph’s and St. Bonaventure. The Flyers probably Fax (423) 472-4363 22. SMU (22-4) HQGHG*RQ]DJD¶VDWODUJHKRSHV7KH*DHOVZRQLQ6SRNDQHWRFRPSOHWHD dropped a seed line as an at-large team, but they’re still ranked 17th season sweep of the Bulldogs, and on Feb. 13 the Zags missed an opportunity LQ53,DQGKDYHDZLQRYHU,RZDRQDQHXWUDOFRXUW%DUULQJDWRWDO 23. Purdue (21-7) to earn only their second top-50 win of the year with a 69–60 loss at SMU. If collapse, Dayton is comfortably in the Tournament. The Flyers’ high 24. South Carolina (22-5) *RQ]DJDFDQ¶WZLQWKH:&&7RXUQDPHQWWKHIRXUWKORQJHVWDFWLYHVWUHDNRI UDQNLQJWKRXJKJDYH6W-RH¶V 53,1R DQG6W%RQDYHQWXUH 25. Texas A&M (20-7) FRQVHFXWLYH1&$$7RXUQDPHQWDSSHDUDQFHVZLOOHQG$OOKRSHLVQRWORVW 53,1R DERRVWWRWKHLURZQDWODUJHUpVXPpV *RQ]DJDKDVZRQ:HVW&RDVWWRXUQH\WLWOHVLQWKHODVW\HDUV 10. UTAH IS QUIETLY ASSEMBLING A NICE RÉSUMÉ 6. BEN SIMMONS IS NIT-BOUND /DVWZHHNZHQRWHGWKHGLI¿FXOW\IRU3DFWHDPVRQWKHURDG/LNH COACH OF THE YEAR WATCH FORFNZRUN8WDKSLFNHGXSWKH3DF¶V¿UVWURDGVZHHSRIWKH/RV 8QOHVV/68FDQJHWUHDOO\KRWUHDOO\IDVW%HQ6LPPRQV²DSRWHQWLDO$OO 1. Jay Wright, Villanova The Wildcats $PHULFDQDQGWKHSUHVXPSWLYH1RSLFNLQWKH1%$'UDIW²LVQRWJRLQJWR $QJHOHVVFKRROVLQFOXGLQJD± ZLQ6XQGD\RYHUDVROLG86& have been so steady, it’s easy to forget SOD\LQWKH1&$$7RXUQDPHQW/68ORVW±WR7HQQHVVHHRQ6DWXUGD\HYHQ VTXDG7KH8WHVDUHWKHRQO\3DFWHDPZLWKWZRLQFRQIHUHQFH that Villanova lost three starters since WKRXJKWKH9ROXQWHHUVZHUHZLWKRXW.HYLQ3XQWHUWKH6(&¶VVHFRQGOHDGLQJ road sweeps, having also defeated the Washington schools in Janu- last season. A second consecutive sea- VFRUHU/68LV±DJDLQVWWHDPVUDQNHGEHWZHHQLQWKH53,7KH DU\8WDK¿QLVKHVWKHUHJXODUVHDVRQZLWKKRPHJDPHVDJDLQVW$UL Tigers’ record against the top 100 (6–7) isn’t helping, either. Simmons could ]RQD6WDWH$UL]RQDDQG&RORUDGR7RXJKPDWFKXSVEXWRQHV8WDK son with a No. 1 seed in the NCAA Tour- EHWKH¿UVWFRQVHQVXV$OO$PHULFDQWRPLVVWKH1&$$7RXUQDPHQWVLQFH'D FDQZLQ:LWKQRQFRQIHUHQFHZLQVRYHU'XNH7H[DV7HFKDQG6DQ nament be in the cards. vidson’s Stephen Curry in 2009. The last No. 1 draft pick to miss the Tourney Diego State, Utah should have a nice seed in 2. Fran McCa rey, Iowa Despite re- ZDV3DFL¿F¶V0LFKDHO2ORZRNDQGLLQ WKH1&$$7RXUQDPHQW placing Aaron White, the Hawkeyes are exceeding all expectations as they look to claim a Big Ten title for the fi rst time PRIME TIME PLAYERS since 1979 and a Sweet 16 bid for the strengthen its NCAA Tournament profi le with 21 Johnathan Motley, fi rst time since 1999. Malik Newman drew more attention in points, 11 rebounds and four assists in a 66–52 Baylor 3. Chris Mack, Xavier Xavier has spent November, but he wasn’t Mississippi State’s win at Syracuse on Saturday. … UNLV guard Entering this week, most of this season in the top 10. No star freshman during the Bulldogs’ best week Patrick McCaw had 25 points, 18 rebounds Baylor had lost four coach gets less credit for being consis- of Ben Howland’s fi rst season. Rookie guard and fi ve assists in a 102–91 win over Nevada. tently good than Mack. Quinndary Weatherspoon had 15 points His 3-pointer at the buzzer forced overtime. ... of seven, and their 4. Andy Enfi eld, USC Enfi eld looked in an upset of Alabama on Saturday and 24 Valparaiso forward Alec Peters averaged 21.0 best player, forward in over his head when he started 5–31 points in a comeback against Vanderbilt, points and 11.7 rebounds in three wins in a Rico Gathers, was in conference play. Now, USC is on the including a game-winning 3-pointer at the fi ve-day span over Cleveland State, Oakland and under the weather with verge of the NCAA Tournament for the buzzer. ... Louisville is facing self-imposed Detroit. Peters had 32 points in a 90–74 win the fl u. Johnathan Motley fi rst time since 2011 and 20 wins for the sanctions, but the Cardinals aren’t going Sunday over Detroit. … Wyoming guard Josh stepped up. The sophomore fi rst time since 2008–09. to be an easy out in the ACC. Damion Lee Adams stuffed the stat sheet with 37 points, had 27 points, 10 rebounds had 15 points in a 72–58 rout of Syracuse eight rebounds, seven assists, four steals and 5. Frank Martin, South Carolina In his and four blocks in a 100–91 overtime win over Iowa State and 24 points in a 71–64 win over Duke. ... two blocks in an 84–66 win at Colorado State. fourth season, Martin has led South St. Bonaventure guard Jaylen Adams had … Georgia Tech’s Marcus Georges-Hunt is to complete the season sweep of the Cyclones. He added Carolina to its highest win total since 31 points, six rebounds and six assists in a relishing the spoiler role. Georges-Hunt had 19 24 points in a 78–64 win over Texas on Saturday. Motley 2005-06 and potentially the Gamecocks’ 79–72 upset of Dayton on Saturday. Adams points and seven rebounds in a 63–62 upset of was 22-of-30 for the week. The Bears’ schedule doesn’t fi rst NCAA bid since 2004. had 12 assists and no turnovers for the week. Notre Dame and 27 points in an 86–80 win over get any easier: Three of their fi nal four games are against … Forward Jamel Artis helped Pittsburgh Florida State last Wednesday. Kansas, Oklahoma and West Virginia. Johnson: Newscom; Motley: Baylor Athletics The Cleveland Daily Banner is a SLAMSLAM DDUNK!UNK! Serving Cleveland & Bradley Co. Since 1854 Local, National & International News & Sports 472-5041