DOCSLIB.ORG

GPSM2 Rabbit Polyclonal Antibody – TA339182 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
GPSM2 Rabbit Polyclonal Antibody – TA339182 | Origene OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA339182 GPSM2 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IF, IHC, WB Recommended Dilution: IHC, WB, IF Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-GPSM2 antibody: synthetic peptide directed towards the N terminal of human GPSM2. Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Concentration: lot specific Purification: Protein A purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 76 kDa Gene Name: G-protein signaling modulator 2 Database Link: NP_037428 Entrez Gene 29899 Human P81274 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 GPSM2 Rabbit Polyclonal Antibody – TA339182 Background: Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]). [supplied by OMIM] Synonyms: CMCS; DFNB82; LGN; PINS Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 86% Protein Families: Druggable Genome Product images: GPSM2 antibody - N-terminal region validated by WB using Fetal Liver Lysate at 1 ug/ml. IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin- fixed, paraffin-embedded tissue after heat- induced antigen retrieval. Antibody concentration 5 ug/ml. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 GPSM2 Rabbit Polyclonal Antibody – TA339182 Rabbit Anti-GPSM2 Antibody; Paraffin Embedded Tissue: Human Liver; Antibody Concentration: 5 ug/ml Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. GPSM2 antibody - N-terminal region in human cell lines with GFP-LGN fusion using Immunofluorescence. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Supplementary Materials
    Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
    [Show full text]
  • Genomic and Transcriptome Analysis Revealing an Oncogenic Functional Module in Meningiomas
    Neurosurg Focus 35 (6):E3, 2013 ©AANS, 2013 Genomic and transcriptome analysis revealing an oncogenic functional module in meningiomas XIAO CHANG, PH.D.,1 LINGLING SHI, PH.D.,2 FAN GAO, PH.D.,1 JONATHAN RUssIN, M.D.,3 LIYUN ZENG, PH.D.,1 SHUHAN HE, B.S.,3 THOMAS C. CHEN, M.D.,3 STEVEN L. GIANNOTTA, M.D.,3 DANIEL J. WEISENBERGER, PH.D.,4 GAbrIEL ZADA, M.D.,3 KAI WANG, PH.D.,1,5,6 AND WIllIAM J. MAck, M.D.1,3 1Zilkha Neurogenetic Institute, Keck School of Medicine, University of Southern California, Los Angeles, California; 2GHM Institute of CNS Regeneration, Jinan University, Guangzhou, China; 3Department of Neurosurgery, Keck School of Medicine, University of Southern California, Los Angeles, California; 4USC Epigenome Center, Keck School of Medicine, University of Southern California, Los Angeles, California; 5Department of Psychiatry, Keck School of Medicine, University of Southern California, Los Angeles, California; and 6Division of Bioinformatics, Department of Preventive Medicine, Keck School of Medicine, University of Southern California, Los Angeles, California Object. Meningiomas are among the most common primary adult brain tumors. Although typically benign, roughly 2%–5% display malignant pathological features. The key molecular pathways involved in malignant trans- formation remain to be determined. Methods. Illumina expression microarrays were used to assess gene expression levels, and Illumina single- nucleotide polymorphism arrays were used to identify copy number variants in benign, atypical, and malignant me- ningiomas (19 tumors, including 4 malignant ones). The authors also reanalyzed 2 expression data sets generated on Affymetrix microarrays (n = 68, including 6 malignant ones; n = 56, including 3 malignant ones).
    [Show full text]
  • A Network View of Microrna and Gene Interactions in Different Pathological Stages of Colon Cancer Jia Wen, Benika Hall and Xinghua Shi*
    Wen et al. BMC Medical Genomics 2019, 12(Suppl 7):158 https://doi.org/10.1186/s12920-019-0597-1 Research Open Access A network view of microRNA and gene interactions in different pathological stages of colon cancer Jia Wen, Benika Hall and Xinghua Shi* From 14th International Symposium on Bioinformatics Research and Applications (ISBRA’18) Beijing, China. 8–11 June 2018 Abstract Background: Colon cancer is one of the common cancers in human. Although the number of annual cases has decreased drastically, prognostic screening and translational methods can be improved. Hence, it is critical to understand the molecular mechanisms of disease progression and prognosis. Results: In this study, we develop a new strategy for integrating microRNA and gene expression profiles together with clinical information toward understanding the regulation of colon cancer. Particularly, we use this approach to identify microRNA and gene expression networks that are specific to certain pathological stages. To demonstrate the application of our method, we apply this approach to identify microRNA and gene interactions that are specific to pathological stages of colon cancer in The Cancer Genome Atlas (TCGA) datasets. Conclusions: Our results show that there are significant differences in network connections between miRNAs and genes in different pathological stages of colon cancer. These findings point to a hypothesis that these networks signify different roles of microRNA and gene regulation in the pathogenesis and tumorigenesis of colon cancer. Background survival rate is significantly decreased to approximately Colon cancer, which is reported to be one of the few cur- 12%. The drastic decrease in survival rate in colon can- able cancers, is one of the most common cancers around cer speaks to the need for better early diagnostic and the world.
    [Show full text]
  • Non‑Small‑Cell Lung Cancer Pathological Subtype‑Related Gene
    356 MOLECULAR AND CLINICAL ONCOLOGY 8: 356-361, 2018 Non‑small‑cell lung cancer pathological subtype‑related gene selection and bioinformatics analysis based on gene expression profiles JIANGPENG CHEN1, XIAOQI DONG2, XUN LEI1, YINYIN XIA1, QING ZENG1, PING QUE1, XIAOYAN WEN1, SHAN HU1 and BIN PENG1 1School of Public Health and Management, Chongqing Medical University, Chongqing 400016; 2Department of Respiratory Diseases, The First Affiliated Hospital of Zhejiang University, Hangzhou, Zhejiang 310003, P.R. China Received March 21, 2016; Accepted November 21, 2017 DOI: 10.3892/mco.2017.1516 Abstract. Lung cancer is one of the most common malignant Introduction diseases and a major threat to public health on a global scale. Non-small-cell lung cancer (NSCLC) has a higher degree of Lung cancer is one of the most common malignant diseases malignancy and a lower 5-year survival rate compared with that and a major threat to public health on a global scale. The main of small-cell lung cancer. NSCLC may be mainly divided into types of lung cancer are small-cell lung cancer (SCLC) and non- two pathological subtypes, adenocarcinoma and squamous cell small-cell lung cancer (NSCLC). NSCLC has a higher degree carcinoma. The aim of the present study was to identify disease of malignancy and a lower 5-year survival rate compared with genes based on the gene expression profile and the shortest path SCLC, and may be divided into two major histopathological analysis of weighted functional protein association networks subtypes, namely adenocarcinoma (ADC) and squamous cell with the existing protein-protein interaction data from the Search carcinoma (SCC).
    [Show full text]
  • Evidence for Association with Antibody Response to Anthrax Vaccine Adsorbed
    Genomic Copy Number Variants: Evidence for Association with Antibody Response to Anthrax Vaccine Adsorbed Michael I. Falola1., Howard W. Wiener1., Nathan E. Wineinger2, Gary R. Cutter3, Robert P. Kimberly4, Jeffrey C. Edberg4, Donna K. Arnett1, Richard A. Kaslow1¤, Jianming Tang5, Sadeep Shrestha1* 1 Department of Epidemiology, University of Alabama at Birmingham, Birmingham, Alabama, United States of America, 2 Scripps Translational Science Institute, La Jolla, California, United States of America, 3 Department of Biostatistics, University of Alabama at Birmingham, Birmingham, Alabama, United States of America, 4 Clinical Immunology and Rheumatology, Department of Medicine, University of Alabama at Birmingham, Birmingham, Alabama, United States of America, 5 Department of Medicine, University of Alabama at Birmingham, Birmingham, Alabama, United States of America Abstract Background: Anthrax and its etiologic agent remain a biological threat. Anthrax vaccine is highly effective, but vaccine- induced IgG antibody responses vary widely following required doses of vaccinations. Such variation can be related to genetic factors, especially genomic copy number variants (CNVs) that are known to be enriched among genes with immunologic function. We have tested this hypothesis in two study populations from a clinical trial of anthrax vaccination. Methods: We performed CNV-based genome-wide association analyses separately on 794 European Americans and 200 African-Americans. Antibodies to protective antigen were measured at week 8 (early response) and week 30 (peak response) using an enzyme-linked immunosorbent assay. We used DNA microarray data (Affymetrix 6.0) and two CNV detection algorithms, hidden markov model (PennCNV) and circular binary segmentation (GeneSpring) to determine CNVs in all individuals. Multivariable regression analyses were used to identify CNV-specific associations after adjusting for relevant non-genetic covariates.
    [Show full text]
  • Cell Cycle Arrest Through Indirect Transcriptional Repression by P53: I Have a DREAM
    Cell Death and Differentiation (2018) 25, 114–132 Official journal of the Cell Death Differentiation Association OPEN www.nature.com/cdd Review Cell cycle arrest through indirect transcriptional repression by p53: I have a DREAM Kurt Engeland1 Activation of the p53 tumor suppressor can lead to cell cycle arrest. The key mechanism of p53-mediated arrest is transcriptional downregulation of many cell cycle genes. In recent years it has become evident that p53-dependent repression is controlled by the p53–p21–DREAM–E2F/CHR pathway (p53–DREAM pathway). DREAM is a transcriptional repressor that binds to E2F or CHR promoter sites. Gene regulation and deregulation by DREAM shares many mechanistic characteristics with the retinoblastoma pRB tumor suppressor that acts through E2F elements. However, because of its binding to E2F and CHR elements, DREAM regulates a larger set of target genes leading to regulatory functions distinct from pRB/E2F. The p53–DREAM pathway controls more than 250 mostly cell cycle-associated genes. The functional spectrum of these pathway targets spans from the G1 phase to the end of mitosis. Consequently, through downregulating the expression of gene products which are essential for progression through the cell cycle, the p53–DREAM pathway participates in the control of all checkpoints from DNA synthesis to cytokinesis including G1/S, G2/M and spindle assembly checkpoints. Therefore, defects in the p53–DREAM pathway contribute to a general loss of checkpoint control. Furthermore, deregulation of DREAM target genes promotes chromosomal instability and aneuploidy of cancer cells. Also, DREAM regulation is abrogated by the human papilloma virus HPV E7 protein linking the p53–DREAM pathway to carcinogenesis by HPV.Another feature of the pathway is that it downregulates many genes involved in DNA repair and telomere maintenance as well as Fanconi anemia.
    [Show full text]
  • Mutation Discovery in Mice by Whole Exome Sequencing
    Fairfield et al. Genome Biology 2011, 12:R86 http://genomebiology.com/2011/12/9/R86 METHOD Open Access Mutation discovery in mice by whole exome sequencing Heather Fairfield1, Griffith J Gilbert1, Mary Barter1, Rebecca R Corrigan2, Michelle Curtain1, Yueming Ding3, Mark D’Ascenzo4, Daniel J Gerhardt4, Chao He5, Wenhui Huang6, Todd Richmond4, Lucy Rowe1, Frank J Probst2, David E Bergstrom1, Stephen A Murray1, Carol Bult1, Joel Richardson1, Benjamin T Kile7, Ivo Gut8, Jorg Hager8, Snaevar Sigurdsson9, Evan Mauceli9, Federica Di Palma9, Kerstin Lindblad-Toh9, Michael L Cunningham10, Timothy C Cox10, Monica J Justice2, Mona S Spector5, Scott W Lowe5, Thomas Albert4, Leah Rae Donahue1, Jeffrey Jeddeloh4, Jay Shendure10 and Laura G Reinholdt1* Abstract We report the development and optimization of reagents for in-solution, hybridization-based capture of the mouse exome. By validating this approach in a multiple inbred strains and in novel mutant strains, we show that whole exome sequencing is a robust approach for discovery of putative mutations, irrespective of strain background. We found strong candidate mutations for the majority of mutant exomes sequenced, including new models of orofacial clefting, urogenital dysmorphology, kyphosis and autoimmune hepatitis. Background burdensome and expensive for many laboratories. Targeted Phenotype-driven approaches in model organisms, includ- sequencing approaches are less expensive and the data are ing spontaneous mutation discovery, standard N-ethyl-N- accordingly more manageable, but this technique requires nitrosourea (ENU) mutagenesis screens, sensitized screens substantial genetic mapping and the design and purchase and modifier screens, are established approaches in func- of custom capture tools (that is, arrays or probe pools) [4].
    [Show full text]
  • Gnomad Lof Supplement
    1 gnomAD supplement gnomAD supplement 1 Data processing 4 Alignment and read processing 4 Variant Calling 4 Coverage information 5 Data processing 5 Sample QC 7 Hard filters 7 Supplementary Table 1 | Sample counts before and after hard and release filters 8 Supplementary Table 2 | Counts by data type and hard filter 9 Platform imputation for exomes 9 Supplementary Table 3 | Exome platform assignments 10 Supplementary Table 4 | Confusion matrix for exome samples with Known platform labels 11 Relatedness filters 11 Supplementary Table 5 | Pair counts by degree of relatedness 12 Supplementary Table 6 | Sample counts by relatedness status 13 Population and subpopulation inference 13 Supplementary Figure 1 | Continental ancestry principal components. 14 Supplementary Table 7 | Population and subpopulation counts 16 Population- and platform-specific filters 16 Supplementary Table 8 | Summary of outliers per population and platform grouping 17 Finalizing samples in the gnomAD v2.1 release 18 Supplementary Table 9 | Sample counts by filtering stage 18 Supplementary Table 10 | Sample counts for genomes and exomes in gnomAD subsets 19 Variant QC 20 Hard filters 20 Random Forest model 20 Features 21 Supplementary Table 11 | Features used in final random forest model 21 Training 22 Supplementary Table 12 | Random forest training examples 22 Evaluation and threshold selection 22 Final variant counts 24 Supplementary Table 13 | Variant counts by filtering status 25 Comparison of whole-exome and whole-genome coverage in coding regions 25 Variant annotation 30 Frequency and context annotation 30 2 Functional annotation 31 Supplementary Table 14 | Variants observed by category in 125,748 exomes 32 Supplementary Figure 5 | Percent observed by methylation.
    [Show full text]
  • The Promise of Whole-Exome Sequencing in Medical Genetics
    Journal of Human Genetics (2014) 59, 5–15 & 2014 The Japan Society of Human Genetics All rights reserved 1434-5161/14 www.nature.com/jhg REVIEW The promise of whole-exome sequencing in medical genetics Bahareh Rabbani1, Mustafa Tekin2 and Nejat Mahdieh3 Massively parallel DNA-sequencing systems provide sequence of huge numbers of different DNA strands at once. These technologies are revolutionizing our understanding in medical genetics, accelerating health-improvement projects, and ushering to a fully understood personalized medicine in near future. Whole-exome sequencing (WES) is application of the next-generation technology to determine the variations of all coding regions, or exons, of known genes. WES provides coverage of more than 95% of the exons, which contains 85% of disease-causing mutations in Mendelian disorders and many disease-predisposing SNPs throughout the genome. The role of more than 150 genes has been distinguished by means of WES, and this statistics is quickly growing. In this review, the impacts of WES in medical genetics as well as its consequences leading to improve health care are summarized. Journal of Human Genetics (2014) 59, 5–15; doi:10.1038/jhg.2013.114; published online 7 November 2013 Keywords: cancer; common disease; medical genomics; Mendelian disorder; whole-exome sequencing INTRODUCTION VALUE OF WES IN MEDICINE DNA sequencing is one of the main concerns of medical research Human genome comprises B3 Â 109 bases having coding and nowadays. Union of chain termination sequencing by Sanger et al.1 noncoding sequences. About 3 Â 107 base pairs (1%) (30 Mb) of and the polymerase chain reaction (PCR) by Mullis et al.2 established the genome are the coding sequences.
    [Show full text]
  • Whole Exome Sequencing and Homozygosity Mapping Identify Mutation in the Cell Polarity Protein GPSM2 As the Cause of Nonsyndromic Hearing Loss DFNB82
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector REPORT Whole Exome Sequencing and Homozygosity Mapping Identify Mutation in the Cell Polarity Protein GPSM2 as the Cause of Nonsyndromic Hearing Loss DFNB82 Tom Walsh,1,4,* Hashem Shahin,2,4 Tal Elkan-Miller,3 Ming K. Lee,1 Anne M. Thornton,1 Wendy Roeb,1 Amal Abu Rayyan,2 Suheir Loulus,2 Karen B. Avraham,3 Mary-Claire King,1 and Moien Kanaan2,* Massively parallel sequencing of targeted regions, exomes, and complete genomes has begun to dramatically increase the pace of discovery of genes responsible for human disorders. Here we describe how exome sequencing in conjunction with homozygosity mapping led to rapid identification of the causative allele for nonsyndromic hearing loss DFNB82 in a consanguineous Palestinian family. After filtering out worldwide and population-specific polymorphisms from the whole exome sequence, only a single deleterious mutation remained in the homozygous region linked to DFNB82. The nonsense mutation leads to an early truncation of the G protein signaling modulator GPSM2, a protein that is essential for maintenance of cell polarity and spindle orientation. In the mouse inner ear, GPSM2 is localized to apical surfaces of hair cells and supporting cells and is most highly expressed during embryonic development. Identification of GPSM2 as essential to the development of normal hearing suggests dysregulation of cell polarity as a mechanism under- lying hearing loss. Homozygosity mapping in consanguineous kindreds with was hybridized to biotinylated cRNA oligonucleotide baits nonsyndromic hearing loss has led to the discovery of from the SureSelect Human All Exon kit (Agilent Technol- more than 50 recessive deafness loci.1 Genomic regions ogies), purified by streptavidin-bound magnetic beads, linked to hearing loss by homozygosity mapping are gener- amplified, and sequenced.6 The exome design covers ally multiple megabases in size and can contain hundreds 38 Mb of human genome corresponding to the exons of genes.
    [Show full text]
  • Modeling of RAS Complexes Supports Roles in Cancer for Less Studied Partners H
    The Author(s) BMC Biophysics 2017, 10(Suppl 1):5 DOI 10.1186/s13628-017-0037-6 RESEARCH Open Access Modeling of RAS complexes supports roles in cancer for less studied partners H. Billur Engin, Daniel Carlin, Dexter Pratt and Hannah Carter* From VarI-SIG 2016: identification and annotation of genetic variants in the context of structure, function, and disease Orlando, Florida, USA. 09 July 2016 Abstract Background: RAS protein interactions have predominantly been studied in the context of the RAF and PI3kinase oncogenic pathways. Structural modeling and X-ray crystallography have demonstrated that RAS isoforms bind to canonical downstream effector proteins in these pathways using the highly conserved switch I and II regions. Other non-canonical RAS protein interactions have been experimentally identified, however it is not clear whether these proteins also interact with RAS via the switch regions. Results: To address this question we constructed a RAS isoform-specific protein-protein interaction network and predicted 3D complexes involving RAS isoforms and interaction partners to identify the most probable interaction interfaces. The resulting models correctly captured the binding interfaces for well-studied effectors, and additionally implicated residues in the allosteric and hyper-variable regions of RAS proteins as the predominant binding site for non-canonical effectors. Several partners binding to this new interface (SRC, LGALS1, RABGEF1, CALM and RARRES3) have been implicated as important regulators of oncogenic RAS signaling. We further used these models to investigate competitive binding and multi-protein complexes compatible with RAS surface occupancy and the putative effects of somatic mutations on RAS protein interactions. Conclusions: We discuss our findings in the context of RAS localization to the plasma membrane versus within the cytoplasm and provide a list of RAS protein interactions with possible cancer-related consequences, which could help guide future therapeutic strategies to target RAS proteins.
    [Show full text]
  • An Integrated Analysis Reveals Geniposide Extracted from Gardenia Jasminoides Ellis Regulates Calcium Signaling Pathway Essential for Infuenza a Virus Replication
    An Integrated Analysis Reveals Geniposide Extracted From Gardenia Jasminoides Ellis Regulates Calcium Signaling Pathway Essential for Inuenza a Virus Replication LiRun Zhou China Academy of Chinese Medical Sciences https://orcid.org/0000-0002-1350-940X Lei Bao China Academy of Chinese Medical Sciences Yaxin Wang China Academy of Chinese Medical Sciences Mengping Chen China Academy of Chinese Medical Sciences Yingying Zhang Beijing University of Chinese Medicine Aliated Dongzhimen Hospital Zihan Geng China Academy of Chinese Medical Sciences Ronghua Zhao China Academy of Chinese Medical Sciences Jing Sun China Academy of Chinese Medical Sciences Yanyan Bao China Academy of Chinese Medical Sciences Yujing Shi China Academy of Chinese Medical Sciences Rongmei Yao China Academy of Chinese Medical Sciences Shanshan Guo ( [email protected] ) China Academy of Chinese Medical Sciences Xiaolan Cui China Academy of Chinese Medical Sciences Research Page 1/30 Keywords: Geniposide, Inuenza A virus, RNA polymerase, Calcium signaling pathway, CAMKII Posted Date: August 9th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-764303/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/30 Abstract Background Geniposide, an iridoid glycoside puried from the fruit of Gardenia jasminoides Ellis, has been reported to possess pleiotropic activity against different diseases. In particular, geniposide possesses a variety of biological activities and exerts good therapeutic effects in the treatment of several strains of the inuenza virus. However, the molecular mechanism for the therapeutic effect has not been well dened. Methods This study aimed to investigate the mechanism of geniposide on inuenza A virus (IAV).
    [Show full text]