AR-Dependent Phosphorylation and Phospho-Proteome Targets in Prostate Cancer
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Cooperative Gene Regulation by Microrna Pairs and Their
Published online 29 May 2014 Nucleic Acids Research, 2014, Vol. 42, No. 12 7539–7552 doi: 10.1093/nar/gku465 Cooperative gene regulation by microRNA pairs and their identification using a computational workflow Ulf Schmitz1,*, Xin Lai2, Felix Winter1, Olaf Wolkenhauer1,3, Julio Vera2 and Shailendra K. Gupta1,4 Downloaded from 1Department of Systems Biology and Bioinformatics, University of Rostock, Rostock, Germany, 2Laboratory of Systems Tumor Immunology, Department of Dermatology, University Hospital Erlangen, Friedrich-Alexander-University Erlangen-Nuremberg, Germany, 3Stellenbosch Institute for Advanced Study (STIAS), Wallenberg Research Centre at Stellenbosch University, Stellenbosch, South Africa and 4Department of Bioinformatics, CSIR-Indian Institute of Toxicology Research, 226001 Lucknow, Uttar Pradesh, India http://nar.oxfordjournals.org/ Received December 22, 2013; Revised April 18, 2014; Accepted May 10, 2014 ABSTRACT fine-tuned through a cellular context-dependent regulation by multiple miRNAs, where miRNAs can either induce MicroRNAs (miRNAs) are an integral part of gene reg- translational repression or target mRNA degradation (4). ulation at the post-transcriptional level. Recently, it Thereby, the miRNA-target regulation machinery can real- at Universitaet Erlangen-Nuernberg, Wirtschafts- und Sozialwissenschaftliche Z on August 3, 2016 has been shown that pairs of miRNAs can repress the ize elaborate gene control functions, including noise buffer- translation of a target mRNA in a cooperative man- ing or homeostasis, and can ultimately mediate distinct tar- ner, which leads to an enhanced effectiveness and get expression patterns appropriate to the demand of differ- specificity in target repression. However, it remains ent biological processes (3,5,6). However, deregulated miR- unclear which miRNA pairs can synergize and which NAs have also been associated with the pathogenesis and genes are target of cooperative miRNA regulation. -
INPP5A Monoclonal Antibody (M05), Clone 3D8
INPP5A monoclonal antibody (M05), clone 3D8 Catalog # : H00003632-M05 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Recombinant protein) Description: INPP5A. Immunoprecipitation Immunogen: INPP5A (NP_005530, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQG EQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGL AQPW enlarge Host: Mouse Sandwich ELISA (Recombinant Reactivity: Human protein) Isotype: IgG2a Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge ELISA Western Blot detection against Immunogen (36.74 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download Immunoprecipitation Page 1 of 3 2016/5/21 Immunoprecipitation of INPP5A transfected lysate using anti-INPP5A monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with INPP5A MaxPab rabbit polyclonal antibody. Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody. Protocol Download ELISA Gene Information Entrez GeneID: 3632 GeneBank NM_005539 Accession#: Protein NP_005530 Accession#: Gene Name: INPP5A Gene Alias: 5PTASE,DKFZp434A1721,MGC116947,MGC116949 Gene inositol polyphosphate-5-phosphatase, 40kDa Description: Omim ID: 600106 Gene Ontology: Hyperlink Gene Summary: The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5- phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. -
Identification of Holocarboxylase Synthetase Chromatin Binding Sites in Human Mammary Cell Lines Using the Damid Technology
University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Biological Systems Engineering--Dissertations, Theses, and Student Research Biological Systems Engineering 12-2010 IDENTIFICATION OF HOLOCARBOXYLASE SYNTHETASE CHROMATIN BINDING SITES IN HUMAN MAMMARY CELL LINES USING THE DAMID TECHNOLOGY Dipika Singh University of Nebraska-Lincoln, [email protected] Follow this and additional works at: https://digitalcommons.unl.edu/biosysengdiss Part of the Biological Engineering Commons Singh, Dipika, "IDENTIFICATION OF HOLOCARBOXYLASE SYNTHETASE CHROMATIN BINDING SITES IN HUMAN MAMMARY CELL LINES USING THE DAMID TECHNOLOGY" (2010). Biological Systems Engineering--Dissertations, Theses, and Student Research. 11. https://digitalcommons.unl.edu/biosysengdiss/11 This Article is brought to you for free and open access by the Biological Systems Engineering at DigitalCommons@University of Nebraska - Lincoln. It has been accepted for inclusion in Biological Systems Engineering--Dissertations, Theses, and Student Research by an authorized administrator of DigitalCommons@University of Nebraska - Lincoln. IDENTIFICATION OF HOLOCARBOXYLASE SYNTHETASE CHROMATIN BINDING SITES IN HUMAN MAMMARY CELL LINES USING THE DAMID TECHNOLOGY by Dipika Singh A THESIS Presented to the Faculty of The Graduate College at the University of Nebraska In Partial Fulfillment of Requirements For the Degree of Master of Science Major: Agricultural and Biological Systems Engineering Under the Supervision of Professors Angela K. Pannier and Janos Zempleni Lincoln, Nebraska December, 2010 Identification of holocarboxylase synthetase chromatin binding sites in human mammary cell lines using the DamID technology Dipika Singh, M.S. University of Nebraska, 2010 Advisers: Angela Pannier and Janos Zempleni Holocarboxylase synthetase (HCS) is a chromatin protein that is essential for mediating the covalent binding of biotin to histones. -
Loss of Inositol Polyphosphate 5-Phosphatase Is an Early Event in Development of Cutaneous Squamous Cell Carcinoma
Published OnlineFirst September 28, 2010; DOI: 10.1158/1940-6207.CAPR-10-0058 Published OnlineFirst on September 28, 2010 as 10.1158/1940-6207.CAPR-10-0058 Research Article Cancer Prevention Research Loss of Inositol Polyphosphate 5-Phosphatase Is an Early Event in Development of Cutaneous Squamous Cell Carcinoma Aleksandar Sekulic1, Su Y. Kim2, Galen Hostetter2, Stephanie Savage2, Janine G. Einspahr3, Anil Prasad4, Paul Sagerman4, Clara Curiel-Lewandrowski4, Robert Krouse4, G. Timothy Bowden3, James Warneke3, David S. Alberts3, Mark R. Pittelkow5, David DiCaudo1, Brian J. Nickoloff6, Jeffrey M. Trent2, and Michael Bittner2 Abstract Cutaneous squamous cell carcinoma (SCC) occurs commonly and can metastasize. Identification of specific molecular aberrations and mechanisms underlying the development and progression of cutane- ous SCC may lead to better prognostic and therapeutic approaches and more effective chemoprevention strategies. To identify genetic changes associated with early stages of cutaneous SCC development, we analyzed a series of 40 archived skin tissues ranging from normal skin to invasive SCC. Using high- resolution array-based comparative genomic hybridization, we identified deletions of a region on chro- mosome 10q harboring the INPP5A gene in 24% of examined SCC tumors. Subsequent validation by immunohistochemistry on an independent sample set of 71 SCC tissues showed reduced INPP5A protein levels in 72% of primary SCC tumors. Decrease in INPP5A protein levels seems to be an early event in SCC development, as it also is observed in 9 of 26 (35%) examined actinic keratoses, the earliest stage in SCC development. Importantly, further reduction of INPP5A levels is seen in a subset of SCC patients as the tumor progresses from primary to metastatic stage. -
Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement. -
Gene Ontology Functional Annotations and Pleiotropy
Network based analysis of genetic disease associations Sarah Gilman Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy under the Executive Committee of the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2013 Sarah Gilman All Rights Reserved ABSTRACT Network based analysis of genetic disease associations Sarah Gilman Despite extensive efforts and many promising early findings, genome-wide association studies have explained only a small fraction of the genetic factors contributing to common human diseases. There are many theories about where this “missing heritability” might lie, but increasingly the prevailing view is that common variants, the target of GWAS, are not solely responsible for susceptibility to common diseases and a substantial portion of human disease risk will be found among rare variants. Relatively new, such variants have not been subject to purifying selection, and therefore may be particularly pertinent for neuropsychiatric disorders and other diseases with greatly reduced fecundity. Recently, several researchers have made great progress towards uncovering the genetics behind autism and schizophrenia. By sequencing families, they have found hundreds of de novo variants occurring only in affected individuals, both large structural copy number variants and single nucleotide variants. Despite studying large cohorts there has been little recurrence among the genes implicated suggesting that many hundreds of genes may underlie these complex phenotypes. The question -
Open Data for Differential Network Analysis in Glioma
International Journal of Molecular Sciences Article Open Data for Differential Network Analysis in Glioma , Claire Jean-Quartier * y , Fleur Jeanquartier y and Andreas Holzinger Holzinger Group HCI-KDD, Institute for Medical Informatics, Statistics and Documentation, Medical University Graz, Auenbruggerplatz 2/V, 8036 Graz, Austria; [email protected] (F.J.); [email protected] (A.H.) * Correspondence: [email protected] These authors contributed equally to this work. y Received: 27 October 2019; Accepted: 3 January 2020; Published: 15 January 2020 Abstract: The complexity of cancer diseases demands bioinformatic techniques and translational research based on big data and personalized medicine. Open data enables researchers to accelerate cancer studies, save resources and foster collaboration. Several tools and programming approaches are available for analyzing data, including annotation, clustering, comparison and extrapolation, merging, enrichment, functional association and statistics. We exploit openly available data via cancer gene expression analysis, we apply refinement as well as enrichment analysis via gene ontology and conclude with graph-based visualization of involved protein interaction networks as a basis for signaling. The different databases allowed for the construction of huge networks or specified ones consisting of high-confidence interactions only. Several genes associated to glioma were isolated via a network analysis from top hub nodes as well as from an outlier analysis. The latter approach highlights a mitogen-activated protein kinase next to a member of histondeacetylases and a protein phosphatase as genes uncommonly associated with glioma. Cluster analysis from top hub nodes lists several identified glioma-associated gene products to function within protein complexes, including epidermal growth factors as well as cell cycle proteins or RAS proto-oncogenes. -
Aurora B/AIM1 Antibody A
Revision 1 C 0 2 - t Aurora B/AIM1 Antibody a e r o t S Orders: 877-616-CELL (2355) [email protected] Support: 877-678-TECH (8324) 4 9 Web: [email protected] 0 www.cellsignal.com 3 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source: UniProt ID: Entrez-Gene Id: WB, IP, F H M R Mk Endogenous 40 Rabbit Q96GD4 9212 Product Usage Information Application Dilution Western Blotting 1:1000 Immunoprecipitation 1:100 Flow Cytometry 1:50 Storage Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA and 50% glycerol. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity Aurora B/AIM1 Antibody detects endogenous levels of Aurora B/AIM1 protein. Species Reactivity: Human, Mouse, Rat, Monkey Source / Purification Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to the amino terminus of human Aurora B/AIM1. Antibodies are purified by protein A and peptide affinity chromatography. Background Aurora A (AIK) is a cell cycle-regulated Ser/Thr protein kinase that is overexpressed in many tumor cell lines (1-3). Phosphorylation of Aurora A at Thr288 within the kinase activation loop results in a significant increase in its activity and may target the protein for proteasomal degradation during mitosis (4). The closely-related kinase Aurora B (AIM1) has been implicated in multiple mitotic events (5), and siRNA silencing of Aurora B expression results in reduced histone H3 phosphorylation, aberrant chromosome alignment/segregation, and altered survivin localization (6). -
Genomic Analyses Reveal Global Functional Alterations That Promote Tumor Growth and Novel Tumor Suppressor Genes in Natural Killer-Cell Malignancies
Leukemia (2009) 23, 1139–1151 & 2009 Macmillan Publishers Limited All rights reserved 0887-6924/09 $32.00 www.nature.com/leu ORIGINAL ARTICLE Genomic analyses reveal global functional alterations that promote tumor growth and novel tumor suppressor genes in natural killer-cell malignancies J Iqbal1,9, C Kucuk1,9, RJ deLeeuw2, G Srivastava3, W Tam4, H Geng5, D Klinkebiel6, JK Christman6, K Patel1, K Cao5, L Shen3, K Dybkaer7, IFL Tsui2, H Ali5, N Shimizu8,WYAu3, WL Lam2 and WC Chan1 1Department of Pathology and Microbiology, University of Nebraska Medical Center, Omaha, NE, USA; 2British Columbia Cancer Research Centre, Vancouver, British columbia, Canada; 3Departments of Pathology and Medicine, University of Hong Kong, Hong Kong, Hong Kong; 4Department of Pathology, Weill Medical College of Cornell University, New York, NY, USA; 5Department of Computer Science, University of Nebraska at Omaha, Omaha, NE, USA; 6Department of Biochemistry and Molecular Biology, University of Nebraska Medical Center, Omaha, NE, USA; 7Department of Hematology, Aalborg Hospital, Aarhus University Hospital, Aalborg, Denmark and 8Medical Research Institute, Tokyo Medical and Dental University, Tokyo, Japan Natural killer (NK)-cell malignancies are among the most rare in western countries but relatively frequent in East Asia, and aggressive lymphoid neoplasms with very poor prognosis. Central and South America.3 The diagnostic characteristics of We performed array comparative genomic hybridization analysis on a number of NK cell lines and primary tumors to NK-cell malignancies include germline T-cell receptor and gain better understanding of the pathogenesis and tumor immunoglobulin gene configurations with expression of NK biology of these malignancies. We also obtained transcriptional cell-associated markers such as CD16 and CD56, but not profiles of genes residing in these regions and compared them surface CD3. -
Nº Ref Uniprot Proteína Péptidos Identificados Por MS/MS 1 P01024
Document downloaded from http://www.elsevier.es, day 26/09/2021. This copy is for personal use. Any transmission of this document by any media or format is strictly prohibited. Nº Ref Uniprot Proteína Péptidos identificados 1 P01024 CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 por 162MS/MS 2 P02751 FINC_HUMAN Fibronectin OS=Homo sapiens GN=FN1 PE=1 SV=4 131 3 P01023 A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=3 128 4 P0C0L4 CO4A_HUMAN Complement C4-A OS=Homo sapiens GN=C4A PE=1 SV=1 95 5 P04275 VWF_HUMAN von Willebrand factor OS=Homo sapiens GN=VWF PE=1 SV=4 81 6 P02675 FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens GN=FGB PE=1 SV=2 78 7 P01031 CO5_HUMAN Complement C5 OS=Homo sapiens GN=C5 PE=1 SV=4 66 8 P02768 ALBU_HUMAN Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2 66 9 P00450 CERU_HUMAN Ceruloplasmin OS=Homo sapiens GN=CP PE=1 SV=1 64 10 P02671 FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens GN=FGA PE=1 SV=2 58 11 P08603 CFAH_HUMAN Complement factor H OS=Homo sapiens GN=CFH PE=1 SV=4 56 12 P02787 TRFE_HUMAN Serotransferrin OS=Homo sapiens GN=TF PE=1 SV=3 54 13 P00747 PLMN_HUMAN Plasminogen OS=Homo sapiens GN=PLG PE=1 SV=2 48 14 P02679 FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens GN=FGG PE=1 SV=3 47 15 P01871 IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 41 16 P04003 C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens GN=C4BPA PE=1 SV=2 37 17 Q9Y6R7 FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens GN=FCGBP PE=1 SV=3 30 18 O43866 CD5L_HUMAN CD5 antigen-like OS=Homo -
Primary Sequence Contribution to the Optical Function of the Eye Lens
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Kingston University Research Repository OPEN Primary sequence contribution to the SUBJECT AREAS: optical function of the eye lens PROTEINS K. Mahendiran1, C. Elie2, J.-C. Nebel1, A. Ryan1 & B. K. Pierscionek1 PROTEIN FUNCTION PREDICTIONS 1Faculty of Science Engineering and Computing, Kingston University, Penhryn Road, Kingston-upon-Thames, KT1 2EE, UK, 2Department of Bioengineering, Nice Sophia Antipolis University Engineering School, Templiers Campus, 06410 Biot, France. Received 25 February 2014 The crystallins have relatively high refractive increments compared to other proteins. The Greek key motif Accepted in bc-crystallins was compared with that in other proteins, using predictive analysis from a protein database, 17 April 2014 to see whether this may be related to the refractive increment. Crystallins with Greek keys motifs have significantly higher refractive increments and more salt bridges than other proteins with Greek key Published domains. Specific amino acid substitutions: lysine and glutamic acid residues are replaced by arginine and 6 June 2014 aspartic acid, respectively as refractive increment increases. These trends are also seen in S-crystallins suggesting that the primary sequence of crystallins may be specifically enriched with amino acids with appropriate values of refractive increment to meet optical requirements. Comparison of crystallins from five species: two aquatic and three terrestrial shows that the lysine/arginine -
DNMT1 and AIM1 Imprinting in Human Placenta Revealed Through A
Das et al. BMC Genomics 2013, 14:685 http://www.biomedcentral.com/1471-2164/14/685 RESEARCH ARTICLE Open Access DNMT1 and AIM1 Imprinting in human placenta revealed through a genome-wide screen for allele-specific DNA methylation Radhika Das1, Yew Kok Lee1, Ruslan Strogantsev2, Shengnan Jin1, Yen Ching Lim1, Poh Yong Ng1, Xueqin Michelle Lin1, Keefe Chng1, George SH Yeo3, Anne C Ferguson-Smith2 and Chunming Ding1* Abstract Background: Genomic imprinting is an epigenetically regulated process wherein genes are expressed in a parent- of-origin specific manner. Many imprinted genes were initially identified in mice; some of these were subsequently shown not to be imprinted in humans. Such discrepancy reflects developmental, morphological and physiological differences between mouse and human tissues. This is particularly relevant for the placenta. Study of genomic imprinting thus needs to be carried out in a species and developmental stage-specific manner. We describe here a new strategy to study allele-specific DNA methylation in the human placenta for the discovery of novel imprinted genes. Results: Using this methodology, we confirmed 16 differentially methylated regions (DMRs) associated with known imprinted genes. We chose 28 genomic regions for further testing and identified two imprinted genes (DNMT1 and AIM1). Both genes showed maternal allele-specific methylation and paternal allele-specific transcription. Imprinted expression for AIM1 was conserved in the cynomolgus macaque placenta, but not in other macaque tissues or in the mouse. Conclusions: Our study indicates that while there are many genomic regions with allele-specific methylation in tissues like the placenta, only a small sub-set of them are associated with allele-specific transcription, suggesting alternative functions for such genomic regions.