Purification of the Goldfish Membrane Progestin Receptor Α (Mprα) Ex- Pressed in Yeast Pichia Pastoris

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Biomedical Research (Tokyo) 35 (1) 47-59, 2014 Purification of the goldfish membrane progestin receptor α (mPRα) ex- pressed in yeast Pichia pastoris 1 2 1 1, 2 Takayuki OSHIMA , Ryo NAKAYAMA , Shimi Rani ROY , and Toshinobu TOKUMOTO 1 Integrated Bioscience Section, Graduate School of Science and Technology, National University Corporation Shizuoka University, Ohya 836, Suruga-ku, Shizuoka 422-8529, Japan; 2 Biological Science Course, Graduate School of Science, National University Corpo- ration Shizuoka University, Ohya 836, Suruga-ku, Shizuoka 422-8529, Japan (Received 22 November 2013; and accepted 12 December 2013) ABSTRACT Membrane progestin receptors (mPRs) are key mediators of rapid, nongenomic actions of proges- tins on plasma membranes. We established a procedure for the expression and purification of re- combinant goldfish mPRα using the methylotropic yeast Pichia pastoris. In P. pastoris, the recombinant protein, which carried C-terminal histidine and c-Myc tags, was expressed in an ac- tive form as the receptor for maturation-inducing steroids of fish. Expressed proteins were bound reversibly with a high affinity (Kd = 9.4 nM) at a single binding site that could be saturated. After solubilization of mPRα with n-dodecyl-β-D-maltoside (DDM) from yeast membranes, the recom- binant protein was purified using three different columns: first it was affinity-purified over nickel- nitrilotriacetic acid (Ni-NTA), then bound to a cellulose resin with free amino groups and finally to a column with affinity for the c-Myc epitope. The identity of the purified protein was verified by MALDI-TOF/MS analysis and its capacity to bind progestin remained. Expression and purifi- cation of mPRα protein in its functional form will enable the screening of ligands and the deter- mination of its three dimensional structure. Progestins are important steroids regulating final trihydroxy-4-pregnen-3-one (20β-S) was identified maturation at reproductive tissues in male and fe- in Atlantic croaker (Micropogonias undulatus) and male vertebrates. They can be divided into natural spotted seatrout (Cynoscion nebulous) (22). The and synthetic types. Natural type is found in humans structural differences between human progestin, pro- and certain animals (32). Natural progestin in human gesterone, and fish progestins are that fish progestins is progesterone. In the medical fields, a variety of have multiple hydroxyl groups on the side chain at synthetic progestins are used. In teleost fishes, two positions 17, 20 and 21. In fish, MIS is produced by distinct progestins have been identified as naturally the follicular envelope in response to luteinizing hor- occurring maturation inducing steroids (MIS), which mone (LH) from the pituitary (15). In salmon, LH control oocyte maturation. 17α,20β-dihydroxy-4- stimulates a number of signaling cascades leading to pregnen-3-one (17,20β-DHP) was identified in ama- the production of 17α-hydroxyprogesterone (17α-HP) go salmon (Oncorhynchus rhodurus) and 17α,20β,21- from progesterone and 17α-hydroxypregnenolone in the theca cells. Then, 17α-HP is converted to 17,20β-DHP by 20β-hydroxysteroid dehydrogenase Address correspondence to: Toshinobu Tokumoto, PhD, (20β-HSD) in the granulosa cells (18, 22). The Integrated Bioscience Section, Graduate School of Sci- ence and Technology, National University Corporation membrane progestin receptor (mPR) mediates the Shizuoka University, Ohya 836, Suruga-ku, Shizuoka nongenomic actions of progestins on the plasma 422-8529, Japan membrane. It was identified in teleost, a ray-finned Tel & Fax: +81-54-238-4778 fish, at first and subsequently identified in other -ver E-mail: [email protected] tebrates including human (44, 45). Research into the 48 T. Oshima et al. functions of mPR have revealed that this receptor cytes, suggesting that the mPRα and β proteins me- mediates the action of steroids that play a role in, diate the action of maturation inducing steroids. for example, oocyte maturation in fish (13, 21, 35, Membranes prepared from breast cancer cells trans- 37, 42). Genome wide phylogenetic analyses have fected with mPRα exhibited single binding sites that shown that mPRs can be classified into a new pro- were specific for a steroid that induced oocyte matu- tein family, the progestin and adipoQ receptor ration in goldfish, 17,20β-DHP (38). We found that (PAQR) family and they have three subtypes named treatment of oocytes with diethylstilbestrol (DES), mPRα, β and γ (corresponding to PAQR7, 8 and 5, an endocrine disrupting chemical, induced their mat- respectively) (33, 36). The mRNAs of mPRs in hu- uration in both goldfish and zebrafish (39). DES man show differential expression in reproductive tis- also bound with high affinity to membranes from sues such as the ovary, testis, placenta, uterus and mPRα-transfected breast cancer cells. These results nonreproductive tissues such as brain, kidney and suggested that mPR proteins are possibly targeted intestinal tissues, suggesting they mediate different by chemicals that affect the endocrine system. nongenomic actions of progestins (35). In goldfish, Recombinant mPR proteins have been expressed mPRs are also expressed in reproductive tissues, in Escherichia coli and several human cancer cell brain, kidney, eye, gill and spleen. The wide tissue lines (38). Although large-scale culturing in E. coli distribution of mPRs suggests mPRs mediates the is possible, post-translational modification required multiple progestin actions in a wide variety of target to obtain an active form of the recombinant protein tissues (37). Recently, based on the analyses of pro- will not occur. On the other hand, expression of teins expressed in yeast, mPRδ and ε (PAQR6 and 9) mPRs in mammalian cell culture, which would re- were proposed to form novel mPR subtypes (31). sult in proteins that are naturally post-translationally Also human orthologs of them, when expressed in modified, will only reach low levels, which is not human breast cancer cells, were found to have pro- suitable for the purification of the amounts of pro- gestin binding activity (24). Therefore, five mPR tein needed for biochemical and structural analysis. subtypes have been described at present. We therefore selected the methanol-utilizing yeast Rapid nongenomic effects of progestin and mPR Pichia pastoris as a host for the expression of mPRα. expression have been investigated in a wide variety P. pastoris has been used for the expression of G of tissues of fishes and mammals. In addition to protein coupled receptors (GPCRs) and can express mPRs, there are two receptor candidates for mediat- proteins in their functional form in large-scale puri- ing progestin signaling from the cell surface: nucle- fications, as has been described in more than 100 ar progestin receptors (nPRs) and progestin receptor reports. For example, mammalian GPCRs expressed membrane components (PGRMCs). Since their tis- in P. pastoris exhibited a natural ligand binding ac- sue-specific expression overlaps, it seems likely that tivity (19, 43). In this way, P. pastoris has been their functions do as well. Thus, physiological roles used to isolate proteins in amounts that enabled of receptors mediating progestin actions might be structural and biochemical studies of GPCRs (3). In complicated and difficult to unravel (12, 17, 46). 2011 and 2012, the structure for two human GPCRs For example, in addition to its function as a nuclear (the histamine H1 and the adenosine A2a receptor) transcription factor, nPR modulates cell signaling could be determined for the first time after being pathways by activating c-Src and downstream purified from P. pastoris (14, 30). MAPK outside the nucleus (5, 27). In Xenopus oo- In the present study, we established a procedure cytes, like mPRβ, nPR was shown to mediate the for the expression and purification of mPR, a new nongenomic action of progestin during oocyte matu- member of the GPCR family. Recombinant goldfish ration, suggesting a potential interaction between mPRα with progestin binding activity could be ex- mPRs and nPRs (46). Also, transactivation of nPRs pressed in P. pastoris as a fusion-protein with the by the activation of mPRs was demonstrated in hu- pre-pro signal sequence of α-factor from Saccharo- man myometrium (16). Although the details about myces cerevisiae to ensure localization to the plas- the signaling pathway through mPRs still remain ma membrane. The protein was biochemically active unclear, several pathways different from those in- with respect to the binding of a typical mPRα-ligand volving nPRs have been suggested (8, 11, 47). and could be purified by sequential column chroma- We cloned and characterized four mPR subtypes, tography after solubilization from the cell-mem- mPRα, β, γ-1 and γ-2 from goldfish (37, 40). Micro- brane. The described procedure can be used to injection of antisense oligonucleotides targeting generate sufficient amounts of goldfish mPRα pro- mPRα and β blocked the maturation of goldfish oo- tein that would allow the determination of its struc- Purification of recombinant mPRα 49 ture, the analysis of intermolecular interactions, and medium in a 500 mL baffled flask which was incu- the production of monoclonal antibodies. bated at 30°C for 1 day. For induction of mPRα- expression by methanol, cells were harvested by centrifugation, and taken up in 1 L of BMMY medi- MATERIALS AND METHODS um (1% yeast extract, 2% bactopeptone, 100 mM P. pastoris strains expressing goldfish mPRα. For potassium phosphate, pH 6.0, 1.34% yeast nitrogen expression in P. pastoris, the cDNA for goldfish base without amino acids, 4 × 10−5% biotin, 0.5% mPRα, isolated from a mammalian expression vec- methanol) to an OD600 of 1.0–3.0. The medium was tor (38), was fused to the pre-pro secretion signal of placed in a 2 L baffled flask and incubated at 20°C α-factor from S. cerevisiae in the P. pastoris expres- for one day, after which the cells were pelleted at sion vector pPICZαC (Invitrogen). The ORF region 3,000 × g for 5 min, frozen with liquid nitrogen and of the resulting expression cassette (Fig.
Recommended publications
  • Progesterone Receptor Membrane Component 1 Promotes Survival of Human Breast Cancer Cells and the Growth of Xenograft Tumors

    Progesterone Receptor Membrane Component 1 Promotes Survival of Human Breast Cancer Cells and the Growth of Xenograft Tumors

    Cancer Biology & Therapy ISSN: 1538-4047 (Print) 1555-8576 (Online) Journal homepage: http://www.tandfonline.com/loi/kcbt20 Progesterone receptor membrane component 1 promotes survival of human breast cancer cells and the growth of xenograft tumors Nicole C. Clark, Anne M. Friel, Cindy A. Pru, Ling Zhang, Toshi Shioda, Bo R. Rueda, John J. Peluso & James K. Pru To cite this article: Nicole C. Clark, Anne M. Friel, Cindy A. Pru, Ling Zhang, Toshi Shioda, Bo R. Rueda, John J. Peluso & James K. Pru (2016) Progesterone receptor membrane component 1 promotes survival of human breast cancer cells and the growth of xenograft tumors, Cancer Biology & Therapy, 17:3, 262-271, DOI: 10.1080/15384047.2016.1139240 To link to this article: http://dx.doi.org/10.1080/15384047.2016.1139240 Accepted author version posted online: 19 Jan 2016. Published online: 19 Jan 2016. Submit your article to this journal Article views: 49 View related articles View Crossmark data Full Terms & Conditions of access and use can be found at http://www.tandfonline.com/action/journalInformation?journalCode=kcbt20 Download by: [University of Connecticut] Date: 26 May 2016, At: 11:28 CANCER BIOLOGY & THERAPY 2016, VOL. 17, NO. 3, 262–271 http://dx.doi.org/10.1080/15384047.2016.1139240 RESEARCH PAPER Progesterone receptor membrane component 1 promotes survival of human breast cancer cells and the growth of xenograft tumors Nicole C. Clarka,*, Anne M. Frielb,*, Cindy A. Prua, Ling Zhangb, Toshi Shiodac, Bo R. Ruedab, John J. Pelusod, and James K. Prua aDepartment of Animal Sciences,
  • PAQR6 Antibody (C-Term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP13667B

    PAQR6 Antibody (C-Term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP13667B

    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 PAQR6 Antibody (C-term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP13667B Specification PAQR6 Antibody (C-term) - Product Information Application WB,E Primary Accession Q6TCH4 Other Accession NP_940798.1, NP_079173.2 Reactivity Human Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Calculated MW 37989 Antigen Region 283-312 PAQR6 Antibody (C-term) - Additional Information PAQR6 Antibody (C-term) (Cat. #AP13667b) Gene ID 79957 western blot analysis in Jurkat cell line lysates (35ug/lane).This demonstrates the PAQR6 Other Names antibody detected the PAQR6 protein (arrow). Progestin and adipoQ receptor family member 6, Progestin and adipoQ receptor family member VI, PAQR6 PAQR6 Antibody (C-term) - Background Target/Specificity The function of this protein remains unknown. This PAQR6 antibody is generated from rabbits immunized with a KLH conjugated PAQR6 Antibody (C-term) - References synthetic peptide between 283-312 amino acids from the C-terminal region of human PAQR6. Kamatani, Y., et al. Nat. Genet. 42(3):210-215(2010) Dilution Smith, J.L., et al. Steroids WB~~1:1000 73(11):1160-1173(2008) Tang, Y.T., et al. J. Mol. Evol. Format 61(3):372-380(2005) Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification. Storage Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. Precautions PAQR6 Antibody (C-term) is for research Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 use only and not for use in diagnostic or therapeutic procedures.
  • PAQR6 (NM 001272108) Human Tagged ORF Clone – RG236776

    PAQR6 (NM 001272108) Human Tagged ORF Clone – RG236776

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG236776 PAQR6 (NM_001272108) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: PAQR6 (NM_001272108) Human Tagged ORF Clone Tag: TurboGFP Symbol: PAQR6 Synonyms: PRdelta Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG236776 representing NM_001272108. Sequence: Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGCTCAGTCTCAAGCTGCCCCAACTTCTTCAAGTCCACCAGGTCCCCCGGGTGTTCTGGGAAGATGGC ATCATGTCTGGCTACCGCCGCCCCACCAGCTCGGCTTTGGACTGTGTCCTCAGCTCCTTCCAGATGACC AACGAGACGGTCAACATCTGGACTCACTTCCTGCCCACCTGTTTCCTGGAGCTGGAAAGCCCTGGGCTC AGTAAGGTCCTCCGCACAGGAGCCTTCGCCTATCCATTCCTGTTCGACAACCTCCCACTCTTTTATCGG CTCGGGCTGTGCTGGGGCAGGGGCCACGGCTGTGGGCAGGAGGCCCTGAGCACCAGCCATGGCTACCAT CTCTTCTGCGCGCTGCTCACTGGCTTCCTCTTCGCCTCCCACCTGCCTGAAAGGCTGGCACCAGGACGC TTTGATTACATCGGCCACAGCCACCAGTTATTCCACATCTGTGCAGTGCTGGGCACCCACTTCCAGCTG GAGGCAGTGCTGGCTGATATGGGATCACGCAGAGCCTGGCTGGCCACACAGGAACCTGCCCTGGGCCTG GCAGGCACAGTGGCCACACTGGTCTTGGCTGCAGCTGGGAACCTACTCATTATTGCTGCTTTCACAGCC ACCCTGCTTCGGGCCCCCAGTACATGCCCTCTGCTGCAGGGTGGCCCACTGGAGGGGGGTACCCAGGCC AAACAACAG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View
  • Expression of Progesterone Receptor Membrane Component 1 (PGRMC1

    Expression of Progesterone Receptor Membrane Component 1 (PGRMC1

    Hindawi Publishing Corporation BioMed Research International Volume 2016, Article ID 8065830, 12 pages http://dx.doi.org/10.1155/2016/8065830 Research Article Expression of Progesterone Receptor Membrane Component 1 (PGRMC1), Progestin and AdipoQ Receptor 7 (PAQPR7), and Plasminogen Activator Inhibitor 1 RNA-Binding Protein (PAIRBP1) in Glioma Spheroids In Vitro Juraj Hlavaty,1 Reinhard Ertl,2 Ingrid Miller,3 and Cordula Gabriel1 1 Institute of Anatomy, Histology and Embryology, University of Veterinary Medicine, 1210 Vienna, Austria 2VetCORE, Facility for Research, University of Veterinary Medicine, 1210 Vienna, Austria 3Institute of Medical Biochemistry, University of Veterinary Medicine, 1210 Vienna, Austria Correspondence should be addressed to Cordula Gabriel; [email protected] Received 27 January 2016; Revised 14 April 2016; Accepted 27 April 2016 Academic Editor: Emeline Tabouret Copyright © 2016 Juraj Hlavaty et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Objective. Some effects of progesterone on glioma cells can be explained through the slow, genomic mediated response via nuclear receptors; the other effects suggest potential role of a fast, nongenomic action mediated by membrane-associated progesterone receptors. Methods. The effects of progesterone treatment on the expression levels of progesterone receptor membrane component 1 (PGRMC1), plasminogen activator inhibitor 1 RNA-binding protein (PAIRBP1), and progestin and adipoQ receptor 7 (PAQR7) on both mRNA and protein levels were investigated in spheroids derived from human glioma cell lines U-87 MG and LN-229. Results. The only significant alteration at the transcript level was the decrease in PGRMC1 mRNA observed in LN-229 spheroids treated with 30 ng/mL of progesterone.
  • Neuroprotection in Perimenopause New Insights for Hormone Therapy

    Neuroprotection in Perimenopause New Insights for Hormone Therapy

    ISSN: 2573-9565 Review Article Journal of Clinical Review & Case Reports Neuroprotection in Perimenopause New Insights for Hormone Therapy Manuela Cristina Russu MD, Ph.D *Corresponding author Manuela Cristina Russu: “Dr I Cantacuzino” Clinic of Obstetrics and Gynecology; “Carol Davila” University of Medicine and Pharmacy, Bucharest, 5-7 Ion Movilă Professor of Obstetrics and Gynecology Street, District 2, zip code 020745. Romania Submitted: 18 Mar 2020; Accepted: 25 Mar 2020; Published: 03 Apr 2020 Abbreviations a demented status to progress from early stages of endocrine aging FMP: Final Menstrual Period process [1]. HPOA: Hypothalamic-Pituitary-Ovarian Axis MT: Menopausal Transition Update on the importance of Hormone Therapy in perimenopause VMS: Vasomotor Symptoms The menopausal transition (MT) or perimenopause– 4 to 6 years MHT: Menopausal Hormone Therapy duration [2]. with reproductive and dynamic critical changes in ERT: Estrogen Replacement Therapy hypothalamic-pituitary-ovarian axis (HPOA), and entire women’s PCC: Posterior Cingulate Cortex body, biology and psychology, starts with menstrual irregularities MCI: Mild Cognitive Impairment from the stage -3b/-3a in the late reproductive ages, with ethnic AD: Alzheimer ’s disease differences in symptoms, hormones and their receptors and actions PD: Parkinson’s Disease [3, 4]. Aβ: Beta Amyloid CVD: Cerebrovascular Disease CAA: Cerebral Amyloid Angiopathy HS: Hippocampal Sclerosis 17ß-E2: 17ß-Estradiol CEE: Conjugated Equine Estrogens ERs: Estrogen Receptors Pg: Progesterone PRs:
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation

    Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation

    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
  • Sex Steroids Regulate Skin Pigmentation Through Nonclassical

    Sex Steroids Regulate Skin Pigmentation Through Nonclassical

    RESEARCH ARTICLE Sex steroids regulate skin pigmentation through nonclassical membrane-bound receptors Christopher A Natale1, Elizabeth K Duperret1, Junqian Zhang1, Rochelle Sadeghi1, Ankit Dahal1, Kevin Tyler O’Brien2, Rosa Cookson2, Jeffrey D Winkler2, Todd W Ridky1* 1Department of Dermatology, Perelman School of Medicine, University of Pennsylvania, Philadelphia, United States; 2Department of Chemistry, University of Pennsylvania, Philadelphia, United States Abstract The association between pregnancy and altered cutaneous pigmentation has been documented for over two millennia, suggesting that sex hormones play a role in regulating epidermal melanocyte (MC) homeostasis. Here we show that physiologic estrogen (17b-estradiol) and progesterone reciprocally regulate melanin synthesis. This is intriguing given that we also show that normal primary human MCs lack classical estrogen or progesterone receptors (ER or PR). Utilizing both genetic and pharmacologic approaches, we establish that sex steroid effects on human pigment synthesis are mediated by the membrane-bound, steroid hormone receptors G protein-coupled estrogen receptor (GPER), and progestin and adipoQ receptor 7 (PAQR7). Activity of these receptors was activated or inhibited by synthetic estrogen or progesterone analogs that do not bind to ER or PR. As safe and effective treatment options for skin pigmentation disorders are limited, these specific GPER and PAQR7 ligands may represent a novel class of therapeutics. DOI: 10.7554/eLife.15104.001 *For correspondence: ridky@mail.
  • WO 2013/184908 A2 12 December 2013 (12.12.2013) P O P C T

    WO 2013/184908 A2 12 December 2013 (12.12.2013) P O P C T

    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization I International Bureau (10) International Publication Number (43) International Publication Date WO 2013/184908 A2 12 December 2013 (12.12.2013) P O P C T (51) International Patent Classification: Jr.; One Procter & Gamble Plaza, Cincinnati, Ohio 45202 G06F 19/00 (201 1.01) (US). HOWARD, Brian, Wilson; One Procter & Gamble Plaza, Cincinnati, Ohio 45202 (US). (21) International Application Number: PCT/US20 13/044497 (74) Agents: GUFFEY, Timothy, B. et al; c/o The Procter & Gamble Company, Global Patent Services, 299 East 6th (22) Date: International Filing Street, Sycamore Building, 4th Floor, Cincinnati, Ohio 6 June 2013 (06.06.2013) 45202 (US). (25) Filing Language: English (81) Designated States (unless otherwise indicated, for every (26) Publication Language: English kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (30) Priority Data: BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, 61/656,218 6 June 2012 (06.06.2012) US DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, (71) Applicant: THE PROCTER & GAMBLE COMPANY HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KN, KP, KR, [US/US]; One Procter & Gamble Plaza, Cincinnati, Ohio KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 45202 (US). MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, (72) Inventors: XU, Jun; One Procter & Gamble Plaza, Cincin SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, nati, Ohio 45202 (US).
  • The Interaction of Progesterone and Allopregnanolone

    The Interaction of Progesterone and Allopregnanolone

    THE INTERACTION OF PROGESTERONE AND ALLOPREGNANOLONE WITH FEAR MEMORIES A Dissertation by GILLIAN M. ACCA Submitted to the Office of Graduate and Professional Studies of Texas A&M University in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Chair of Committee, Stephen Maren Co-Chair of Committee, Naomi Nagaya Committee Members, James W. Grau Farida Sohrabji Intercollegiate Faculty Chair, Jane Welsh August 2017 Major Subject: Neuroscience Copyright 2017 Gillian M. Acca ABSTRACT Sex differences in stress and anxiety disorders are well reported in the clinical population. For instance, women are twice as likely to be diagnosed with post-traumatic stress disorder (PTSD) compared to men. This difference is most profound during the reproductive years suggesting a role for sex hormones and their metabolites in regulating fear and anxiety. Previous studies suggest sex differences also occur in rodents, which is modulated by gonadal hormones. Despite the majority of clinical cases occurring in women, most rodent studies only include male subjects. An understanding of what contributes to this disparity is necessary for sex-specific therapies and interventions. Here, we use Pavlovian fear conditioning, a learned task in which male rats display higher fear levels compared to females, to understand the neurobiological basis for sex differences in fear and anxiety. Specifically, we focus on allopregnanolone (ALLO), a metabolite of progesterone and potent allosteric modulator of GABAA receptors and its effects in the bed nucleus of the stria terminalis (BNST) in male and female rats. The BNST is a sexually dimorphic brain region and site of hormonal modulation that has been implicated in contextual fear.
  • PAQR6 (NM 198406) Human Tagged ORF Clone – RC208104

    PAQR6 (NM 198406) Human Tagged ORF Clone – RC208104

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC208104 PAQR6 (NM_198406) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: PAQR6 (NM_198406) Human Tagged ORF Clone Tag: Myc-DDK Symbol: PAQR6 Synonyms: PRdelta Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC208104 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTCAGTCTCAAGCTGCCCCAACTTCTTCAAGTCCACCAGGTCCCCCGGGTGTTCTGGGAAGATGGCA TCATGTCTGGCTACCGCCGCCCCACCAGCTCGGCTTTGGACTGTGTCCTCAGCTCCTTCCAGATGACCAA CGAGACGGTCAACATCTGGACTCACTTCCTGCCCACCTGGTACTTCCTGTGGCGGCTCCTGGCGCTGGCG GGCGGCCCCGGCTTCCGTGCGGAGCCGTACCACTGGCCGCTGCTGGTCTTCCTGCTGCCCGCCTGCCTCT ACCCCTTCGCGTCGTGCTGCGCGCACACCTTCAGCTCCATGTCGCCCCGCATGCGCCACATCTGCTACTT CCTCGACTACGGCGCGCTCAGCCTCTACAGTCTGGGCTGCGCCTTCCCCTATGCCGCCTACTCCATGCCG GCCTCCTGGCTGCACGGCCACCTGCACCAGTTCTTTGTGCCTGCCGCCGCACTCAACTCCTTCCTGTGCA CCGGCCTCTCCTGCTACTCCCGTTTCCTGGAGCTGGAAAGCCCTGGGCTCAGTAAGGTCCTCCGCACAGG AGCCTTCGCCTATCCATTCCTGTTCGACAACCTCCCACTCTTTTATCGGCTCGGGCTGTGCTGGGGCAGG GGCCACGGCTGTGGGCAGGAGGCCCTGAGCACCAGCCATGGCTACCATCTCTTCTGCGCGCTGCTCACTG GCTTCCTCTTCGCCTCCCACCTGCCTGAAAGGCTGGCACCAGGACGCTTTGATTACATCGGCCACAGCCA CCAGTTATTCCACATCTGTGCAGTGCTGGGCACCCACTTCCAGCTGGAGGCAGTGCTGGCTGATATGGGA TCACGCAGAGCCTGGCTGGCCACACAGGAACCTGCCCTGGGCCTGGCAGGCACAGTGGCCACACTGGTCT
  • Regulation Pathway of Mesenchymal Stem Cell Immune Dendritic Cell

    Regulation Pathway of Mesenchymal Stem Cell Immune Dendritic Cell

    Downloaded from http://www.jimmunol.org/ by guest on September 26, 2021 is online at: average * The Journal of Immunology , 13 of which you can access for free at: 2010; 185:5102-5110; Prepublished online 1 from submission to initial decision 4 weeks from acceptance to publication October 2010; doi: 10.4049/jimmunol.1001332 http://www.jimmunol.org/content/185/9/5102 Inhibition of Immune Synapse by Altered Dendritic Cell Actin Distribution: A New Pathway of Mesenchymal Stem Cell Immune Regulation Alessandra Aldinucci, Lisa Rizzetto, Laura Pieri, Daniele Nosi, Paolo Romagnoli, Tiziana Biagioli, Benedetta Mazzanti, Riccardo Saccardi, Luca Beltrame, Luca Massacesi, Duccio Cavalieri and Clara Ballerini J Immunol cites 38 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription http://www.jimmunol.org/content/suppl/2010/10/01/jimmunol.100133 2.DC1 This article http://www.jimmunol.org/content/185/9/5102.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2010 by The American Association of
  • PRODUCT SPECIFICATION Prest Antigen PAQR6 Product

    PRODUCT SPECIFICATION Prest Antigen PAQR6 Product

    PrEST Antigen PAQR6 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen PAQR6 Product Number APrEST90398 Gene Description progestin and adipoQ receptor family member VI Alternative Gene FLJ22672, PRdelta Names Corresponding Anti-PAQR6 (HPA073505) Antibodies Description Recombinant protein fragment of Human PAQR6 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWL IWDHAEPGWPHRNLPWAWQAQWPHWSWLQL Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 27 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.