H00000793-D01P 規格 : [ 100 Ug ] List All

Total Page:16

File Type:pdf, Size:1020Kb

Load more

CALB1 purified MaxPab rabbit polyclonal antibody (D01P) Catalog # : H00000793-D01P 規格 : [ 100 ug ] List All Specification Application Image Product Rabbit polyclonal antibody raised against a full-length human CALB1 Western Blot (Transfected lysate) Description: protein. Immunogen: CALB1 (NP_004920.1, 1 a.a. ~ 261 a.a) full-length human protein. Sequence: MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKA GLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKS CEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDL enlarge MLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELY DQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYR Immunofluorescence TDLALILCAGDN Host: Rabbit Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. enlarge Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Interspecies Mouse (98); Rat (98) Antigen Sequence: Datasheet: Download Applications Western Blot (Transfected lysate) Western Blot analysis of CALB1 expression in transfected 293T cell line by CALB1 MaxPab rabbit polyclonal antibody. Lane 1: CALB1 transfected lysate(30.00 KDa). Page 1 of 2 2021/6/18 Lane 2: Non-transfected lysate. Protocol Download Immunofluorescence enlarge this image Immunofluorescence of purified MaxPab rabbit antibody to CALB1 on HeLa cell. [antibody concentration 10 ug/ml] Gene Information Entrez GeneID: 793 GeneBank NM_004929 Accession#: Protein NP_004920.1 Accession#: Gene Name: CALB1 Gene Alias: CALB Gene calbindin 1, 28kDa Description: Omim ID: 114050 Gene Ontology: Hyperlink Gene Summary: Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted. [provided by RefSeq Other RTVL-H protein,calbindin 1,calbindin 1, (28kD) Designations: Related Disease Genetic Predisposition to Disease Parkinson Disease Parkinson disease 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2021 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2021/6/18.
Recommended publications
  • 32-4621: Recombinant Rat Calbindin-1 Description Product

    32-4621: Recombinant Rat Calbindin-1 Description Product

    ABGENEX Pvt. Ltd., E-5, Infocity, KIIT Post Office, Tel : +91-674-2720712, +91-9437550560 Email : [email protected] Bhubaneswar, Odisha - 751024, INDIA 32-4621: Recombinant Rat Calbindin-1 Alternative Name : Calbindin,Vitamin D-dependent calcium-binding protein,avian-type,Calbindin D28,D-28K,Spot 35 protein,Calb1,CaBP28K,MGC93326. Description Source : Escherichia Coli. Recombinant Rat Calbindin-1 produced in E.Coli.The Rat CALB1 is purified by proprietary chromatographic techniques. Calbindins are Ca-binding proteins belonging to the troponin C superfamily. CALB28K/Calbindin1/CALB1 (D28K/Spot35 protein or cholecalcin, rat 261 aa; mouse 261 aa; human 261-aa, chromosome 8q21.3-q22.1) was originally described as 27-kDA induced by vitamin D in the duodenum of chicken. In mammals, it is expressed in the kidney, pancreatic islets, and brain. In brain, its synthesis is independent of vitamin D. CABP28K contains 4 active and 2 inactive EF-hand Ca-binding domains. The gene for CABP28K is clustered in the same region as carbonic anhydrase. The neurons in the brains of patients with Huntington disease are CAB28K depleted. There are two types of CaBPs: the 'trigger'- and the 'buffer'-CaBPs. The conformation of 'trigger' type CaBPs changes upon Ca2+ binding and exposes regions on protein that interact with target molecules, thus altering their activity. The buffer-type CABP are thought to control the intracellular calcium concentration. Calbindin D-28K is found predominantly in subpopulations of central and peripheral nervous system neurons, and in certain epithelial cells involved in Ca2+ transport such as distal tubular cells and cortical collecting tubules of the kidney, and in enteric neuroendocrine cells.
  • Changes in Transcript and Protein Levels of Calbindin D28k, Calretinin

    Changes in Transcript and Protein Levels of Calbindin D28k, Calretinin

    Original Article doi: 10.5115/acb.2010.43.3.218 pISSN 2093-3665 eISSN 2093-3673 Changes in transcript and protein levels of calbindin D28k, calretinin and parvalbumin, and numbers of neuronal populations expressing these proteins in an ischemia model of rat retina Shin Ae Kim, Ji Hyun Jeon, Min Jeong Son, Jiook Cha, Myung-Hoon Chun, In-Beom Kim Department of Anatomy, College of Medicine, The Catholic University of Korea, Seoul, Korea Abstract: Excessive calcium is thought to be a critical step in various neurodegenerative processes including ischemia. Calbindin D28k (CB), calretinin (CR), and parvalbumin (PV), members of the EF-hand calcium-binding protein family, are thought to play a neuroprotective role in various pathologic conditions by serving as a buffer against excessive calcium. The expression of CB, PV and CR in the ischemic rat retina induced by increasing intraocular pressure was investigated at the transcript and protein levels, by means of the quantitative real-time reverse transcription-polymerase chain reaction, western blot and immunohistochemistry. The transcript and protein levels of CB, which is strongly expressed in the horizontal cells in both normal and affected retinas, were not changed significantly and the number of CB-expressing horizontal cells remained unchanged throughout the experimental period 8 weeks after ischemia/reperfusion injury. At both the transcript and protein levels, however, CR, which is strongly expressed in several types of amacrine, ganglion, and displaced amacrine cells in both normal and affected retinas, was decreased. CR-expressing ganglion cell number was particularly decreased in ischemic retinas. Similar to the CR, PV transcript and protein levels, and PV-expressing AII amacrine cell number were decreased.
  • Calbindin-D28k and Its Role in Apoptosis: Inhibition of Caspase-3 Activity and Interaction with Pro-Caspase-3 Investigated by In-Situ FRET Microscopy

    Calbindin-D28k and Its Role in Apoptosis: Inhibition of Caspase-3 Activity and Interaction with Pro-Caspase-3 Investigated by In-Situ FRET Microscopy

    Dissertation Aus dem Physiologischen Institut Lehrstuhl: Physiologie – Zelluläre Physiologie (Biomedizinisches Zentrum München) der Ludwig-Maximilians-Universität München Vorstand: Prof. Dr. Claudia Veigel Calbindin-D28k and its role in apoptosis: Inhibition of Caspase-3 activity and interaction with Pro-Caspase-3 investigated by in-situ FRET microscopy. Dissertation zum Erwerb des Doktorgrades der Medizin an der Medizinischen Fakultät der Ludwig-Maximilians-Universität zu München vorgelegt von Johannes Lohmeier aus Bong Town, Liberia 2018 Mit Genehmigung der Medizinischen Fakultät der Universität München Berichterstatter: Prof. Dr. Michael Meyer Prof. Dr. Alexander Faussner Mitberichterstatter: Prof. Dr. Nikolaus Plesnila Prof. Dr. Dr. Bernd Sutor Dekan: Prof. Dr. med. dent. Reinhard Hickel Tag der mündlichen Prüfung: 14.06.2018 Eidesstattliche Versicherung Lohmeier, Johannes Name, Vorname Ich erkläre hiermit an Eides statt, dass ich die vorliegende Dissertation mit dem Thema Calbindin-D28k and its role in apoptosis: Inhibition of Caspase-3 activity and interaction with Pro-Caspase-3 investigated by in-situ FRET microscopy. selbständig verfasst, mich außer der angegebenen keiner weiteren Hilfsmittel bedient und alle Erkenntnisse, die aus dem Schrifttum ganz oder annähernd übernommen sind, als solche kenntlich gemacht und nach ihrer Herkunft unter Bezeichnung der Fundstelle einzeln nachgewiesen habe. Ich erkläre des Weiteren, dass die hier vorgelegte Dissertation nicht in gleicher oder in ähnlicher Form bei einer anderen Stelle zur Erlangung
  • Miz1 Is Required to Maintain Autophagic Flux

    Miz1 Is Required to Maintain Autophagic Flux

    ARTICLE Received 3 Apr 2013 | Accepted 3 Sep 2013 | Published 3 Oct 2013 DOI: 10.1038/ncomms3535 Miz1 is required to maintain autophagic flux Elmar Wolf1,*, Anneli Gebhardt1,*, Daisuke Kawauchi2, Susanne Walz1, Bjo¨rn von Eyss1, Nicole Wagner3, Christoph Renninger3, Georg Krohne1, Esther Asan3, Martine F. Roussel2 & Martin Eilers1,4 Miz1 is a zinc finger protein that regulates the expression of cell cycle inhibitors as part of a complex with Myc. Cell cycle-independent functions of Miz1 are poorly understood. Here we use a Nestin-Cre transgene to delete an essential domain of Miz1 in the central nervous system (Miz1DPOZNes). Miz1DPOZNes mice display cerebellar neurodegeneration characterized by the progressive loss of Purkinje cells. Chromatin immunoprecipitation sequencing and biochemical analyses show that Miz1 activates transcription upon binding to a non-palin- dromic sequence present in core promoters. Target genes of Miz1 encode regulators of autophagy and proteins involved in vesicular transport that are required for autophagy. Miz1DPOZ neuronal progenitors and fibroblasts show reduced autophagic flux. Consistently, polyubiquitinated proteins and p62/Sqtm1 accumulate in the cerebella of Miz1DPOZNes mice, characteristic features of defective autophagy. Our data suggest that Miz1 may link cell growth and ribosome biogenesis to the transcriptional regulation of vesicular transport and autophagy. 1 Theodor Boveri Institute, Biocenter, University of Wu¨rzburg, Am Hubland, 97074 Wu¨rzburg, Germany. 2 Department of Tumor Cell Biology, MS#350, Danny Thomas Research Center, 5006C, St. Jude Children’s Research Hospital, Memphis, Tennessee 38105, USA. 3 Institute for Anatomy and Cell Biology, University of Wu¨rzburg, Koellikerstrasse 6, 97070 Wu¨rzburg, Germany. 4 Comprehensive Cancer Center Mainfranken, Josef-Schneider-Strasse 6, 97080 Wu¨rzburg, Germany.
  • CPCA-Calb Chicken Polyclonal Antibody

    CPCA-Calb Chicken Polyclonal Antibody

    Calbindin CPCA-Calb Chicken Polyclonal Antibody Ordering Information Applications Host Isotype Molecular Wt. Species Cross-Reactivity Web www.encorbio.com Email [email protected] WB, IF/ICC, IHC Chicken IgY 28kDa Human, cow, rat, mouse Phone 352-372-7022 Fax 352-372-7066 HGNC Name: CALB1 UniProt: P05937 RRID: AB_2572237 Immunogen: Full-length recombinant human protein expressed in and purified from E. coli. Format: Supplied as an aliquot of IgY preparation plus 5mM NaN3 Storage: Stable at 4°C for 1 year. Recommended dilutions: WB: 1:5,000. IF/ICC or IHC: 1:1,000-1:5,000. References: 1. Kretsinger RH, Nockolds CE. Carp Muscle Calcium-binding Protein: II. Structure determination and general description. J. Biol. Chem. 248:3313-26 (1973). 2. Andressen C, Bliimcke I, Celio MR. Calcium- binding proteins: selective markers of nerve cells. Cell Tissue Res. 271:181-208 (1993). 3. Schwaller B, Meyer M, Schiffmann S. ‘New’ functions for ‘old’ proteins: The role of the calcium binding proteins calbindin D-28k, calretinin and parvalbumin, in cerebellar physiology. Studies with knockout mice. The Cerebellum 1:241–58 (2002). 4. Celio MR. Calbindin D-28k and parvalbumin in the rat nervous system. Neurosci. 35:375-475 Western blot analysis of different tissue lysates and recombinant Immunofluorescent analysis of rat cerebellum section stained with (1990). protein solutions using chicken pAb to calbindin, CPCA-Calb, dilution chicken pAb to calbindin, CPCA-Calb, dilution 1:2,000, in green, and 5. Condé F, et al. Local circuit neurons 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] costained with rabbit pAb to MeCP2, RPCA-MeCP2, dilution 1:5,000, immunoreactive for calretinin, calbindin D‐28k pig hippocampus, [4] cow cerebellum, [5] protein standard (red).
  • Diaphragmatic Herniaeand Translocations Involving 8Q22 in Two

    Diaphragmatic Herniaeand Translocations Involving 8Q22 in Two

    J Med Genet 1994;31:735-737 735 Diaphragmatic herniae and translocations involving 8q22 in two patients J Med Genet: first published as 10.1136/jmg.31.9.735 on 1 September 1994. Downloaded from I K Temple, J C K Barber, R S James, D Burge Abstract it was shown that she had a left sided dia- Two girls with congenital diaphragmatic phragmatic hernia. No other structural ab- herniae are reported. Both were dis- normalities were shown. The pregnancy was covered to have a balanced reciprocal otherwise normal. She was born by emergency translocation involving 8q22.3. In one girl caesarian section at 37 weeks. Birth weight was the translocation was de novo, in the other 2560 g. it was maternally inherited. Uniparental Surgery to correct the posterolateral dia- disomy was excluded in both. 8q22.3 may phragmatic hernia was successful and she has be the location of a gene affecting de- since progressed normally. She sat at 8 months velopment of ihe diaphragm. and was crawling by 13 months. A de- velopmental assessment at 27 months showed (J Med Genet 1994;31:735-737) her to have mild delay. Her development was assessed at a 23 month level. On physical ex- amination her height was on the 10th centile, Congenital diaphragmatic hernia (DH), in weight on the 3rd centile, and head cir- which abdominal organs protrude into the thor- cumference on the 25th centile. She was not, acic cavity, arises because of abnormal de- dysmorphic. Feeding was still a problem but velopment of the diaphragm. The diaphragm she was generally healthy.
  • Calbindin 1 Antibody / CALB1 [Clone CALB1/2364] (V8169)

    Calbindin 1 Antibody / CALB1 [Clone CALB1/2364] (V8169)

    Calbindin 1 Antibody / CALB1 [clone CALB1/2364] (V8169) Catalog No. Formulation Size V8169-100UG 0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced) and 0.05% sodium azide 100 ug V8169-20UG 0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced) and 0.05% sodium azide 20 ug V8169SAF-100UG 1 mg/ml in 1X PBS; BSA free, sodium azide free 100 ug Bulk quote request Availability 1-3 business days Species Reactivity Human Format Purified Clonality Monoclonal (mouse origin) Isotype Mouse IgG1, kappa Clone Name CALB1/2364 Purity Protein G affinity chromatography UniProt P05937 Localization Cytoplasmic, nuclear, secreted Applications ELISA (order BSA-free format for coating) : Limitations This Calbindin 1 antibody is available for research use only. Analysis of HuProt(TM) microarray containing more than 19,000 full-length human proteins using Calbindin 1 antibody (clone CALB1/2364). These results demonstrate the foremost specificity of the CALB1/2364 mAb. Z- and S- score: The Z-score represents the strength of a signal that an antibody (in combination with a fluorescently-tagged anti-IgG secondary Ab) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If the targets on the HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-scores. The S-score therefore represents the relative target specificity of an Ab to its intended target.
  • Analysis of the Transcriptional Program Induced by Raf in Epithelial Cells

    Analysis of the Transcriptional Program Induced by Raf in Epithelial Cells

    Downloaded from genesdev.cshlp.org on September 30, 2021 - Published by Cold Spring Harbor Laboratory Press Analysis of the transcriptional program induced by Raf in epithelial cells Almut Schulze,1 Kerstin Lehmann,1 Harold B.J. Jefferies,1 Martin McMahon,2 and Julian Downward1,3 1Signal Transduction Laboratory, Imperial Cancer Research Fund, London WC2A 3PX, UK; 2Cancer Research Institute, University of California at San Francisco/Mt. Zion Cancer Center, San Francisco, California 94115-0128, USA Activation of the Raf/MAP kinase pathway is a critical event in tumorigenesis induced by RAS and other oncogenes, a major role of this signaling system being the regulation of cellular transcription factors. To address the contribution of MAP kinase mediated transcriptional changes to the transformed phenotype, we used an inducible form of Raf to analyze early changes in the transcription of some 6000 genes following activation of the kinase in a normal human breast epithelial cell line. Of the more than 120 significant changes in mRNA level detected, genes promoting cell proliferation, invasiveness, and angiogenesis featured prominently. Some of the most strongly induced genes encoded growth factors of the EGF family: Autocrine activation of the EGF receptor was shown to be responsible for the ability of Raf activation to protect these cells from apoptosis induced by detachment of cells from extracellular matrix (anoikis), which is a critical component of the transformed phenotype. [Key Words: Ras; Raf; transcription; apoptosis; matrix; microarray] Received October 15, 2000; revised version accepted February 16, 2001. Tumorigenesis is a multistep process during which cells The transformed phenotype induced by oncogenic RAS acquire a characteristic set of properties that make up is caused by both the short-term consequences of acti- the malignant phenotype.
  • Downregulation of Calbindin 1, a Calcium-Binding Protein, Reduces the Proliferation of Osteosarcoma Cells

    Downregulation of Calbindin 1, a Calcium-Binding Protein, Reduces the Proliferation of Osteosarcoma Cells

    ONCOLOGY LETTERS 13: 3727-3733, 2017 Downregulation of calbindin 1, a calcium-binding protein, reduces the proliferation of osteosarcoma cells ZHENGXIANG HUANG1*, GUOJUN FAN2* and DONGLIANG WANG1 1Department of Orthopedic Surgery, Xinhua Hospital, Shanghai Jiaotong University School of Medicine, Shanghai 200092; 2Department of Orthopedic Surgery, The First People's Hospital of Urumqi, Urumqi, Xinjiang 830000, P.R. China Received August 27, 2015; Accepted January 13, 2017 DOI: 10.3892/ol.2017.5931 Abstract. Osteosarcoma is the most common type of primary potential novel target for gene therapy to treat patients with malignant bone tumor and has a high propensity to metastasize osteosarcoma. to the lungs and bones. Calbindin 1 (CALB1) is a constituent Ca2+ binding protein, which can prevent apoptotic death in Introduction several cell types induced through various pro-apoptotic signaling pathways. To investigate whether CALB1 is impli- Osteosarcoma originates from primitive bone-forming cated in the tumor growth of human osteosarcoma, two mesenchymal cells and has been identified as an aggressive different short hairpin RNAs (shRNAs) against CALB1 were sarcoma of the bone (1,2). The incidence rate of osteosarcoma used for CALB1-knockdown in osteosarcoma U2OS cells. The is 0.42% in inhabitants in USA, and osteosarcoma occurs most U2OS cells were divided into three groups: Two groups with frequently in adolescents and young adults (3,4). Furthermore, CALB1 knockdown (CALB1-shRNA 1 and CALB1-shRNA distant metastases are common in patients with osteosarcoma, 2) and one control group (Con-shRNA). Reverse transcrip- with primary migration to the lungs and bones, and a poor tion-quantitative polymerase chain reaction and western blot prognosis following recurrence and metastasis (5,6).
  • MCA-4H7 Mouse Monoclonal Antibody

    MCA-4H7 Mouse Monoclonal Antibody

    Calbindin MCA-4H7 Mouse Monoclonal Antibody Ordering Information Applications Host Isotype Molecular Wt. Species Cross-Reactivity Web www.encorbio.com Email [email protected] WB, IF/ICC, IHC Mouse IgG1 28kDa Hu, Rt, Ms, Co, Pi Phone 352-372-7022 Fax 352-372-7066 HGNC Name: CALB1 UniProt: P05937 RRID: AB_2572238 Immunogen: Full-length recombinant human calbindin protein, EnCor product Prot-r-Calb1. expressed in and purified from E. coli. Format: Purified antibody at 1mg/mL in 50% PBS, 50% glycerol plus 5mM NaN3 Storage: Store at 4°C for short term, for longer term store at -20°C Recommended dilutions: WB: 1:1,000-1:5,000. IF/ICC or IHC: 1:1,000. References: 1. Kretsinger RH, Nockolds CE. Carp Muscle Calcium-binding Protein: II. Structure determination and general description. J. Biol. Chem. 248:3313-26 (1973). 2. Andressen C, Bliimcke I, Celio MR. Calcium- binding proteins: selective markers of nerve cells. Cell Tissue Res. 271:181-208 (1993). 3. Schwaller B, Meyer M, Schiffmann S. ‘New’ functions for ‘old’ proteins: The role of the calcium binding proteins calbindin D-28k, calretinin and parvalbumin, in cerebellar physiology. Studies with knockout mice. The Cerebellum 1:241–58 (2002). Western blot analysis of different neuronal tissue lysates using Immunofluorescent analysis of rat brain cerebellum section stained 4. Celio MR. Calbindin D-28k and parvalbumin in mouse mAb to calbindin, MCA-4H7, dilution 1:2,000: [1] protein with mouse mAb to calbindin, MCA-4H7, dilution 1:1,000, in green, the rat nervous system. Neurosci. 35:375-475 (1990). standard, [2] rat cerebellum, [3] pig hippocampus, and [4] cow and costained with rabbit pAb to calretinin, RPCA-Calretinin, dilution 5.
  • Supplementary Information For

    Supplementary Information For

    Supplementary Information for Multimodal gradients across mouse cortex Ben D. Fulcher, John D. Murray, Valerio Zerbi, and Xiao-Jing Wang Ben D. Fulcher and Xiao-Jing Wang. E-mails: [email protected] and [email protected] This PDF file includes: Supplementary text Figs. S1 to S9 Tables S1 to S2 References for SI reference citations Ben D. Fulcher, John D. Murray, Valerio Zerbi, and Xiao-Jing Wang 1 of 20 www.pnas.org/cgi/doi/10.1073/pnas.1814144116 Supporting Information Text Data Cortical parcellation. The 40 mouse cortical areas analyzed here are from the Allen Reference Atlas (ARA) (1), and labeled (where possible) according to the following grouping from Harris et al. (2): Somatomotor: ‘MOp’ (Primary motor area), ‘SSp-n’ (Primary somatosensory area, nose), ‘SSp-bfd’ (Primary somatosensory area, barrel field), ‘SSp-ll’ (Primary somatosensory area, lower limb), ‘SSp-m’ (Primary somatosensory area, mouth), ‘SSp-ul’ (Primary somatosensory area, upper limb), ‘SSp-tr’ (Primary somatosensory area, trunk), ‘SSp-un’ (Primary somatosensory area, unassigned), ‘SSs’ (Supplemental somatosensory area). Medial: ‘PTLp’ (Posterior parietal association areas), ‘VISam’ (Anteromedial visual area), ‘VISpm’ (Posteromedial visual area), ‘RSPagl’ (Retrosplenial area, lateral agranular part), ‘RSPd’ (Retrosplenial area, dorsal part), ‘RSPv’ (Retrosplenial area, ventral part). Temporal: ‘AUDd’ (Dorsal auditory area), ‘AUDp’ (Primary auditory area), ‘AUDpo’ (Posterior auditory area), ‘AUDv’ (Ventral auditory area), ‘TEa’ (Temporal association areas), ‘PERI’ (Perirhinal area), ‘ECT’ (Ectorhinal area). Visual: ‘VISal’ (Anterolateral visual area), ‘VISl’ (Lateral visual area), ‘VISp’ (Primary visual area), ‘VISpl’ (Posterolateral visual area). Anterolateral: ‘GU’ (Gustatory areas), ‘VISC’ (Visceral area), ‘AId’ (Agranular insular area, dorsal part), ‘AIp’ (Agranular insular area, posterior part), ‘AIv’ (Agranular insular area, ventral part).
  • 36-3393: Anti-Calbindin 1 (CALB1) Monoclonal Antibody(Clone: CALB1/3333)

    36-3393: Anti-Calbindin 1 (CALB1) Monoclonal Antibody(Clone: CALB1/3333)

    9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 36-3393: Anti-Calbindin 1 (CALB1) Monoclonal Antibody(Clone: CALB1/3333) Clonality : Monoclonal Clone Name : CALB1/3333 Application : ELISA, IHC Reactivity : Human Gene : CALB1 Gene ID : 793 Uniprot ID : P05937 avian-type; CAB27; CALB 1; CALB; CALB1; CALB1_HUMAN; Calbindin 1 28kDa; Calbindin; Calbindin D28; D 28K; D-28K; D28K; OTTHUMP00000166027; OTTHUMP00000225441; RTVL H Alternative Name : protein; Vitamin D dependent calcium binding protein; Vitamin D dependent calcium binding protein avian type; Vitamin D-dependent calcium-binding protein Isotype : Mouse IgG2b, kappa Immunogen Information : Recombinant fragment (around aa 7-96) of human CALB1 protein (exact sequence is proprietary) Description The family of EF-hand type Ca2+-binding proteins includes Calbindin D28K, Calbindin D9K, S-100 and , Calgranulin A (also designated MRP8), Calgranulin B (also designated MRP14), Calgranulin C and the Parvalbumin family members, including Parvalbumin and Parvalbumin (also designated oncomodulin). Calbindin D28K, also known as calbindin, CALB1, D-28K or vitamin D-dependent calcium-binding protein, is a 261-amino acid protein with 6 EF-hand domains, 4 of which are active calcium-binding domains. Expressed in brain, ovary, uterus, testis, pancreas, liver, kidney and intestine, Calbindin D28K acts as a calcium-buffering agent and alters the activity of the plasma membrane ATPase. In neuronal cells, Calbindin D28K modulates calcium channel activity, calcium transients and intrinsic neuronal firing activity. Also, Calbindin D28K has been implicated to play a role in apoptosis and microtubule function. Product Info Amount : 20 µg / 100 µg 200 µg/ml of Ab Purified from Bioreactor Concentrate by Protein A/G.