PELI3 antibody - N-terminal region (ARP54532_P050) Data Sheet
Product Number ARP54532_P050 Product Name PELI3 antibody - N-terminal region (ARP54532_P050) Size 50ug Gene Symbol PELI3 Alias Symbols MGC35521 Nucleotide Accession# NM_001098510 Protein Size (# AA) 445 amino acids Molecular Weight 48kDa Product Format Lyophilized powder NCBI Gene Id 246330 Host Rabbit Clonality Polyclonal Official Gene Full Name Pellino E3 ubiquitin protein ligase family member 3 Gene Family PELI This is a rabbit polyclonal antibody against PELI3. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG Target Reference Butler,M.P., (2005) J. Biol. Chem. 280 (30), 27759-27768 Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in Description of Target the signaling cascades initiated by TLRs and IL1R.Toll-like receptors (TLRs; see MIM 603030) and IL1R (IL1R1; MIM 147810) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R (Jensen and Whitehead, 2003 [PubMed 12874243]).[supplied by OMIM]. Partner Proteins IRAK1, MAP3K14, MAP3K7, TRAF6, IRAK1, IRAK2, IRAK4, MAP3K7, TRAF6, UBC Reconstitution and Add 50 ul of distilled water. Final anti-PELI3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-PELI3 antibody is Catalog # AAP54532 (Previous Catalog # AAPP31316) Immunogen The immunogen for anti-PELI3 antibody: synthetic peptide directed towards the N terminal of human PELI3 Swissprot Id Q8N2H9-2 Protein Name E3 ubiquitin-protein ligase pellino homolog 3 Protein Accession # NP_001091980 Purification Affinity Purified Species Reactivity Human, Pig, Rabbit, Rat, Guinea pig, Mouse, Bovine, Horse Application WB Predicted Homology Based on Immunogen Pig: 100%; Human: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 92%; Horse: 85% Sequence
Human HepG2 WB Suggested Anti-PELI3 Antibody Titration: 0.2- 1 ug/ml Positive Control: HepG2 cell lysate
Image 1
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.