sign in sign up
<<
Home , 20th Century Boys, 7 Billion Needles, Afro Samurai, Akira Kamiya, Ariel (anime), Baki the Grappler

Spring 2010 Catalog TABLE OF CONTENTS Welcome to our Spring 2010 Catalog! I can’t begin to tell you how excited I am that spring is fi nally here! After an incredibly brutal winter, I am ready to see the green return to the world! As we enter our 23rd year, I fi nd myself refl ecting upon the changes in our industry. Just like the changes in the seasons, the market has changed, with many new titles not fi nding a dub release, titles being released in half- or full-season sets rather than single volumes, and the availability of content on non-DVD mediums, such as streaming and video on demand. And, as I’ve said in the past, there has never been a better time to be an anime fan! There is so much value—you can really stretch your buying power, with new releases costing a fraction of what they used to, great fan-friendly sets of niche releases, and bargains galore to be found on catalog titles. We’ve got some great Nozomi Entertainment titles coming this year, including new seasons of Maria-sama, , and Junjo Romantica. Plus, there’s more up my sleeve, some of which may have slipped out by the time you have this in your hands. You can always check the latest news from Nozomi on the offi cial website (www.nozomient.com). Plus, we’re launching a new YouTube channel for our properties (www..com/nozomient), where you can watch our shows online! We’re continuing to bring savings to you at our RightStuf.com store, with lower everyday pricing and new products that we haven’t carried in the past. We have new deals on great items every day, with our expanded Shawne’s Daily Deals, our weekly specials, and super sales! I want to thank all of you for your continued patronage. Our customers are our passion, and we take your satisfaction very seriously. Tell us what you think—by email ([email protected]), Twitter (@animetoday), or on Facebook (www.facebook.com/rightstuf). We’re always here to help!

Best regards,

Shawne Kleckner President/CEO

ARTICLE: FAREWELL TO ARIA 02 FAQ 04 GOT ANIME SAVINGS CLUB 06 DVD & BLU- ANIME 07 LIVE ACTION 23 BOOKS JAPANESE MANGA 28 OTHER ASIAN MANGA 54 AMERIMANGA 57 NOVELS 59 ANIME & FILM GUIDES 61 ART BOOKS 61 COOKING 62 CULTURE & HISTORY 62 DRAWING & CRAFTS 63 LEARNING MATERIALS 63 TRAVEL 63 WALL ART 64 APPAREL 65 BAGS 68 MERCHANDISE 69 PLUSH 72 COUPONS 73 ORDER FORMS 75 ARIA THE ORIGINATION ADULT ITEMS SEALED

Front cover image: ARIA The ORIGINATION © 2008 Kozue Amano / MAG Garden - ARIA Company. Back cover image: Maria Watches Over Us © OYUKI KONNO / • YAMAYURIKAI III Licensed by d-rights Inc. Catalog Design © 2010 Right Stuf. All rights reserved. Production and Design by Right Stuf. All images are copyright of their respective owners. Opinions expressed may not be those of Right Stuf. Right Stuf cannot be held responsible for typographical errors. For comments or questions about this publication, please email the company at [email protected] Visit us online at www.rightstuf.com Farewell to ARIA

They say all good things must come to an end, and with our combined release of ARIA The ORIGINATION and ARIA The OVA ~ARIETTA~ this March, so too does ARIA – going out on the highest note possible. While it’s no easy task putting together 52 episodes, OVA, four booklets, and hours upon hours of extras all the while maintaining the quality Nozomi is known for, ARIA is one of those rare gems and working on it has been a wonderful experience.

When it comes to ARIA, the superlatives come easy. The show is beautiful, from the striking landscapes, to the gorgeous music, to the bright smiles of the characters as they greet each other for another day in Neo-Venezia. Not a single aspect of the series was left to languish behind the others, and every harmonizes together to create a beautiful, relaxing experience. It’s as if we are its guests and ARIA is an Undine – guiding us down the Grand Canal and then slipping down a side waterway to point out a hidden delight. (Aika: “No sappy lines allowed!”)

But while ARIA’s art is amazing and the show’s fi delity to the actual Venice is stunning, what truly makes ARIA stand head and shoulders above the rest is its characters. Watching Akari, Aika, and Alice grow over the course of the series and learn more about their city and chosen profession, they work their way into your heart until you can’t help but laugh, smile and, sometimes, even worry with them.

The main characters, along with the rest of the rich cast, grow perhaps the most during this fi nal season. We see them interacting with others they haven’t before, and thinking, not just about training, but of the futures lying ahead of them. Changes big and small are in order, and jaws dropped more than once as we fi rst reviewed the tapes from . Neo-Venezia grows too, and we see new sides of the city, not just from Akari and her friends’ points of view, but also through the eyes of Alicia, , and Athena. Eventually, the plot threads that have been running since the very fi rst episode all come together for the grand fi nale, and it’s an incredibly satisfying ending – not to mention a real tear-jerker!

If you take the time to watch some of the many included interviews, you’ll fi nd the Japanese cast was sorry to leave the show, but they were also happy to have been able to give it such a good send off, pouring their hearts into making each scene hit just the right tone. We can only echo that sentiment here at the Nozomi offi ce. Though there were times when lining up all that on screen text drove our subtitlers crazy and there were so many extras that we had to give them a disc of their own, it was such a relaxing show, full of heart and wonder, that we didn’t mind the extra effort. Aika would scold us again for expressing the sentiment, but the place won’t be quite the same without an Italian canzone fl oating through the air.

It’s not everyday you get to work on a show this special, and we’re glad we had the opportunity. Venice now feels like an old friend, and the natural rhythm of the seasons has taken on new meaning as we try to look at the falling snow and budding fl owers with Akari’s wondering eyes. But time marches on, and there’s always another new project. Being here at Nozomi, odds are high it’ll be a good one, but there will always be a place in our hearts for Akari and her gondola, gently fl oating down the canals of .

The fi nal installment of the ARIA series ARIA The ORIGINATION DVD Collection (Also includes ARIA The OVA ~ARIETTA~) Now Available Find out more at aria.rightstuf.com

ARIA The ORIGINATION © 2008 Kozue Amano / MAG Garden - ARIA Company. ITEM LISTINGS of the screen while the actual voices What region is my player? representatives at 1-800-338-6827 in orders. Please review the specifi c Are there more shipping we will reimburse your shipping costs basis. As such, these items are only are still in Japanese. Dubbed means If you purchased your player from a or email us at [email protected] restrictions of the coupon to see if it options available? to return the item to us. listed on our online store, so if you’re Ratings System the music is (probably) intact, but the retail outlet in the U.S., it should be can be applied to your mail-in order. Additional shipping options are looking for a particular item, please How long is an item “out of stock”? To benefi t our customers, we have voices have been redone in English. Region 1 for DVD players and Region available for orders placed by phone The packaging said it would check our online store or contact implemented a rating system for In our online store, subtitled items are A for Blu-ray players. You can check With a few exceptions, item delays can I saw a special deal / daily deal on or through our online store. include (special item), but mine customer service. many of our products based on the represented by (S) and dubbed items the region coding on your player by be measured in . There are some the website. Can I put it on my doesn’t have it! manufacturer’s suggested rating for are represented by (D). You will also freak delays, but 2-4 weeks is usually Why don’t you have (title here) audio looking for the region code symbol on mail-in order? How much is shipping for box sets? Unfortunately, we have no control FAQ each title, as well as input from our see (Hyb), which means that both the the player’s packaging. a safe fi gure. However, please keep See coupon explanation above. Box sets are considered single items over what the manufacturers decide soundtrack from Japan? own staff. subtitled and dubbed versions are on in mind that some items are directly for shipping purposes. to place inside of their products. See the above question regarding DVD Region Codes: the same disc. imported from Japan and may be Why do you hold my order for 12 days Sometimes the manufacturers do imports. You also might want to check FAQ N/R 1 United States and in short supply even there. Should the when I pay by check? I’m not at home during the day. provide special extras, but we cannot our soundtracks section, since some Not yet rated. Release Dates 2 Europe, Egypt, Arabia, vendor be out of stock at the time of Even with all this cool technology, Can you ship to my offi ce? guarantee that these items will be titles are available domestically. If an item has not yet been released our re-supply order with them, it may ALL, 7+, 10+ Japan and checks can still require at least Certainly. In fact, we prefer to do this inside of the products that we receive. at the time of this catalog’s printing, be a bit longer. We keep thousands Generally acceptable for 3 Korea, , Vietnam, 12 days to clear. to ensure that you actually receive However, should the item not be I really want to learn Japanese. What you may see a release date listed. of items in stock, and our computer children. No nudity. Borneo and your order. Please provide us all the included, we suggest that you contact resources do you have? However, manufacturers can (and system automatically adjusts stock Possible mild violence. 4 and , What’s this NSF charge? information that you can, including the the manufacturer directly. Of course, We have many products to help often do) change these dates due levels based on demand. Mexico, the Caribbean, and “Non-Suffi cient Funds” means that name of the company, so your friendly we are always happy to forward your our customers learn about Japan to production delays. If you are pre- 12+, 13+, 14+ South America your check bounced. There is a $25 delivery person can get your package request on for you! and the ! Whether ordering an item and are concerned Can I use my coupons for an Parental discretion advised. 5 , Africa, Russia and charge for all returned checks. Once to you. We require that you include you’re just starting out or you’re ready whether it’s on schedule, please online order? May contain violence, brief former USSR countries you have bounced a check, all further the business’ name in the address. to move onto the next level, make feel free to check the release date nudity, mature themes, and/ 6 People’s Republic of Yes, you can. Simply use the coupon orders must be paid by either credit We are happy to work with you to sure to check out page 63 to fi nd on our online store, or feel free to GENERAL or mild language. May suggest code that is on your coupon when you card or money order. get the product to you as quickly as our Learning Materials section sexual situations, but no such contact our friendly Customer Service Blu-ray disc Region Codes: place your online order. You can only possible. You can also choose to have Why do you charge for your catalog? featuring the latest items to help you representatives. use one coupon per order and some situations are shown. A The Americas, Korea, Japan, your order shipped to you by mail In order to keep producing a printed learn the Japanese language. Many coupons can only be used one time and Southeast Asia instead. Please note: This policy applies catalog, we have to charge a small more items are also available on 15+, 16+, 17+ Mosaic per customer. PAYMENT METHODS B Europe, the Middle East, only to our domestic customers. fee for it. However, you can get your our online store, including everything Strong violence and strong The digital “mosaic” effect is sometimes Africa, Australia, and New Do you take VISA / MasterCard / For international customers, we must money back by using the $4-off from videos and textbooks to memory language. Nudity may be placed over the relevant bits during a Can I order “Shawne’s Daily Deals” Zealand Discover / American Express? ship to the billing address on your coupon on page 73! (Not to mention aids and intermediate readers. prevalent. Mild sexual particularly adult sequence prior to through the mail or over the phone? C Russia, India, China and the Yes to all. About the only plastic that credit card. the other great coupons back there.) situations may be shown. the title being exported from Japan. Sorry, but these special offers are only I saw this show that I think might rest of world we don’t take are standard ATM and When we are aware that a title has available through our online store. I chose express delivery when placing Will I get your next catalog? have been anime. Do you have it? 18+ this effect, we’ll mark it as Mosaic in gasoline cards. Will a Blu-ray disc play in my If you check in often enough, you my order, but it still took 2 weeks to If you’ve ordered something from If you can give us enough information, Extreme violence, explicit nudity, the listing. might fi nd some amazing deals! If I order using a credit card, arrive. Why? us in the last 6 months, you will someone can usually identify the and/or explicit language. May DVD player? You must have ordered a product that automatically receive the new catalog program. Please understand, though, contain sexually explicit material. OVA (OAV)? Just as CDs and DVDs require How many coupons can I use? when do you charge it? we didn’t have in stock at the time when it is shipped. If not, you may fi nd that if you ask us about something Absolutely not for anyone under This means Original Video Animation. different types of players, so do DVDs You can only use one coupon per Credit cards (by law in our state, that we received your order. If an item that you’ll stop receiving catalogs, and where “there’s a girl who’s like 18 years of age. Basically, this means it is a direct-to- and Blu-ray discs. In order to play order, and some coupons can only actually) get charged only when is out of stock when we receive your you will have to send us the current a magic user, a guy with a sword, video release. a Blu-ray disc, you must have a special be used through our online store. the product actually ships. Please note: Ratings used within order, we still ship it out by express catalog fee to reactivate. and a villain who wants to take over Blu-ray player or a Playstation 3. Please see coupon details for specifi c our system are typically provided by Anime Legends / Viridian Collection I’m an international customer. delivery the moment we receive it the universe,” there’s a problem. This restrictions. When does your catalog come out? the manufacturer. Because of the Certain DVD and Blu-ray items are Will a DVD play in my Blu-ray player? What’s with this extra data you need? from the manufacturer. Although describes about half the fi lms ever differences in ratings used by these marked as “Anime Legends,” “Viridian While some Blu-ray players will also Do I need to add sales tax? With international mail and credit card we do keep signifi cant stock of the Every spring and fall! made. Also, knowing what a series or companies, we have combined their Collection,” or “S.A.V.E. Editions.” read DVDs, not all do. We cannot fraud becoming a growing problem, items in our catalog, there are times movie is doesn’t necessarily mean that Only if you’re shipping to an Iowa Where are the Adult products? systems with the descriptions of the These are re-releases of the original guarantee that all DVDs will play in address. we feel it’s better to ask you for when there may be delays getting it’s available in the U.S. as a licensed ratings listed above. Right Stuf does discs at lower prices. However, these your Blu-ray player. additional information rather than items from the manufacturer, as Since our catalog is delivered to anime product, but it could be. not set ratings and is not responsible editions may or may not include all of If I move, should I inform you? charge everyone outside the country discussed above. fans of all ages, we’ve taken special for errors, omissions, or inaccurate the features that were found on the a lot more for their stuff. For fi rst- precautions to ensure that younger Why isn’t (title here) available in Certainly a good idea, especially if you What happens if my country will not ratings. These ratings are guidelines original release. If you are concerned CUSTOMER SERVICE want to keep getting stuff from us. time orders only, we require a copy fans are not exposed to products the U.S.? only and are subject to change. that the item you are considering may Just drop us a quick note, giving of some form of address verifi cation, allow me to have this sort of item? / that contain explicit violence, adult You might be surprised to fi nd out how not contain the features that you want, How can I contact you? us your old address and your new which shows your address, along with My order was seized by customs? situations, or sexual content (18+). much anime is available in the U.S. Length please feel free to contact Customer Our friendly Customer Service address, so we can update our a photocopy of BOTH the FRONT Please consult with the postal Products of this nature have been Of the few titles that remain unlicensed, The listing for each item contains Service or check the item’s listing Department can be reached by phone records. AND BACK side of your credit card. authorities of your country prior to placed in a special section just for some titles have their rights disputed, information detailing its approximate through our online store. from 8AM to 5PM Central Standard For security purposes, you may black placing an order for adult items. adults. Please feel free to remove some licensors want more money length. Depending on the manufacturer, Time (CST), Monday through Friday: out one set of digits. Upon request, We cannot be held responsible for this section - it really won’t hurt our than a title can possibly generate in this may or may not include extra Missing Volumes feelings. this market, and of course, some Domestic (U.S.): 1-800-338-6827 MAIL-IN ORDERS we can provide a secure website seized shipments or provide refunds bonus features, such as previews or You may notice volume gaps in our for seized products. are currently in negotiation. With the International: (515) 986-1028 location for our international customers Please be aware that this does not forwards. An N/A indicates that the printed catalog listings. This is not I went to your online store to order, to submit this information. mean that all items in the regular exception of a few TV series (which manufacturer has not provided this necessarily because the product isn’t You can also contact us day or night, but I don’t have a credit card. Help! are a different matter entirely, due to This policy only affects fi rst-time sections are intended for young information at this time. available, but merely because we 7 days a week online: Should you prefer to fl ip through the RETURNING their length), this just about covers it. international customers. However, children. To help parents, we’ve couldn’t fi t every item into the printed online store to select items, you can We do not sell bootlegged products. Edited and Uncut On the Web: www.rightstuf.com should your address or credit card MERCHANDISE taken special care to make sure that catalog. If you are looking for a certain actually use it to place an order by mail! By Email: [email protected] information change, we will re-request products are marked with age ratings. Although many fans screech in horror volume, please feel free to contact Simply select all of the items you want When I got my item, it was defective. Can I special order items that are not this information in order to protect at the very thought of altering the Customer Service or check our Please don’t email your order or credit and place them in your cart. When What do I do? What’s this “Got Anime” thing? on the online store? original Japanese version of a show, you and to update our records. This online store. card information. you proceed to checkout, make sure If your merchandise is defective due to It’s an easy way to get an additional Simply put: If it isn’t on our online for a series to make it to American TV policy is in place to help keep credit to choose the “faxed or mailed order” a fl aw in manufacturing, we are more discount on your favorite anime items. store, we can’t get it at the moment. (or even into some retail stores), it must Or, you can also contact us by card fraud to a minimum and to option. This will generate a printed than happy to replace the product. For a small yearly membership fee, often be edited. This can mean that the traditional methods: ensure that our customers have the DVD/BLU-RAY SPECIFIC form with everything already added Unopened discs can be returned for you get additional discounts, What are some good shows scenes containing nudity, excessive utmost security when ordering with By Mail: Right Stuf up for you (no more calculators!). Right Stuf store credit (or in the case newsletters, and members-only for children? violence, blood, and foul language are Can my DVD play in a Playstation / our company. This information is PO Box 680 Just print this form and mail it in with of credit cards, refunded to the issuing specials! Read more about the Although this is truly a matter of altered or even totally removed. Anime destroyed after verifi cation. Xbox / personal computer? Grimes, IA 50111-0680 your payment. Although you can use card). All returns/refunds must be Got Anime Savings Club on page 6. personal preference, we recommend purists may want the original in all its It depends on the DVD. There have the online store to generate your processed within 90 days of the date Please note that international members Yu-gi-oh, Pokémon, Teenage Mutant glory, but parents of young TV viewers By Fax: (515) 986-1129 been instances of some DVDs having order, nothing will be recorded by on your purchase invoice. If you need of the club no longer receive mailings, Turtles, Kimba, and do not. Manufacturers recognize (Please use FINE mode) SHIPPING diffi culty playing in certain players. While our system, so make sure that you to complete a return/refund, please due to postage costs, but the same for young anime fans. You might also this and sometimes release both the the vast majority of DVDs will work just Can I get a new order form? don’t lose your form, or you’ll have to How long will it take to ship my order? obtain a return authorization number newsletters are available online. consider the Sanrio titles like Hello Edited (TV) and the Uncut (original) fi ne, we cannot guarantee all DVDs re-enter everything all over again! from Customer Service, or utilize Kitty. Look for the “ALL” age rating in You can give us the information on the From the time we receive your order versions of the show. will play correctly on your Playstation, Please note that online coupons are our online return request form at: Memberships are non-transferable item listings for child-friendly titles. form or on any scrap of paper. As long and place it in our system, standard Xbox or personal computer. not valid on mail-in orders. www.rightstuf.com/requestform and will remain with the billing address DUB ONLY? SUB ONLY? as we can read it, you’re fi ne. You can processing time is 24-48 hours. of your account. If you move, please What’s the most horrible, tasteless If some of the items are on back Although DVDs and Blu-ray discs What is Region Coding? also print one from our online pdf at Do I have to pay shipping to return make sure to contact us with your adult anime you offer? I saw a coupon on the internet; can order, it can take an average of 10- allow for the possibility of multiple Region coding is a geographical www.rightstuf.com/orderform updated information so that we can I use it? 14 business days for us to receive the a product? That really depends largely on the languages, it’s not always possible to restriction for DVDs and Blu-ray discs. update your membership information. How can I check on my order? Some coupons and short-term deals, back-ordered items. Then, standard Yes, but we will pay the shipping to person you ask. Some would say Cool license a title for dual-language release. Since players are region specifi c, you Devices and , others So, you end up with manufacturers If you placed your order through such as “Shawne’s Daily Deals,” can processing time goes into effect. send the replacement back to you. Why don’t you carry many imports? need to make sure that the item you only be used through our online store We suggest using the least expensive Love Doll and Bible Black. These titles releasing discs that are Subtitled our online store (www.rightstuf.com), Limited availability of imports and purchase is coded for the same region and cannot be honored for mail-in What are your methods of shipping? shipping method available that can are certainly not for the squeamish Only (SUB ONLY) or English Dubbed you can check your order status lack of timely distribution of such as your player. All DVDs and Blu-ray orders. This is generally due to specifi c be tracked. If you have been shipped and are most defi nitely only for adults. Only (DUB ONLY). Subtitled discs when you log in. Otherwise, simply Please see our order form for details overseas items make it diffi cult to discs we sell are region coded for the date or manufacturer requirements, an item that you did not order, Look for them in the adult section. display the dialogue on the bottom call our friendly Customer Service and prices. provide quality imports on a timely United States. which cannot be imposed on mail-

4 www.rightstuf.com 800.338.6827 800.338.6827 www.rightstuf.com 5 misfi t named Misuzu, whose eccentricities have waged war for supremacy over raging on the mean streets of the Big Apple, hide a troubled home life. Misuzu offers mankind, with a legend prophesizing that a place where regular joes bounce between ANIME Yukito a place to stay, and in return, he one day the Aquarian Age will begin and backdoor booze joints and the breadline. listens to her dreams - dreams in which one group will reign supreme. Now Kyota’s But this caper ain’t about a simple gangland lives in the sky. dreams of becoming a pop idol must take brawl. It’s about hoods who can’t seem to AFRO Complete Set S.A.V.E. Edition Released 5/19/10 a backseat to his destiny - he may hold the die proper after catching a bullet or fi ve 14+ • #AR01161 • 340 mins • $14.98 power to turn the tides of war in favor of between the eyes. is the tale of a black samurai’s whichever faction can control him. Complete Series DVD & BLU-RAY hunt for Justice, who murdered his father. THE MOVIE Complete Collection 17+ • #FUN09625 • 400 mins • $37.48 Afro Samurai blends traditional Japanese Alternative retelling of the above story. 17+ • #DAQ100 • 325 mins • $26.24 culture, funky technology and hip hop to create a brutally fresh entertainment S.A.V.E. Edition Released 7/20/10 experience. Contains both Afro Samurai and 14+ • #AR01157 • 90 mins • $7.49 AQUARION TV SERIES Afro Samurai: Resurrection. TV SERIES Feeling his training to be the strongest Complete Murder Sessions Edited When the Shadow Angels invaded after fi ghter in the world is going nowhere, Baki 13+ • #FUN07993 • DUB ONLY • 200 mins • $18.73 Ikki Minami rules his school, takes on 12,000 years of slumber, humanity was held Hanma quits his program, believing that Complete Murder Sessions Uncut violent gangs single-handedly, and lives with captive by fear and sheer alien dominance. the only coach he needs is himself. Baki 17+ • #FUN07994 • DUB ONLY • 325 mins • $26.24 the Noyamanos - four sexy sisters with a Eleven years after the Great Catastrophe stumbles on his fi rst step into this new surprising secret. After a humiliating defeat decimated the world, most of those left alive world. Will he learn from his errors and AH! MY to a terrifying gang of Storm Riders, the are scavengers, dirty and starving in the achieve his potential? sisters welcome him to the world of Air streets. There is hope, however: Mechanical Ikkou is your everyday teenage boy with Box Set Viridian Collection (Seasons 1-2) (Thinpak) With your annual membership fee, you get: Trek, where motor-powered inline skates Aquarion! Through a swirling cloud 13+ • #FUN08223 • 1200 mins • $18.73 DVD & BLU-RAY DVD everyday teenage desires. Too bad he’s called “Air Treks” take extreme sports to a of love, betrayal, loss and destiny, the last • An additional 10% off our already low prices!* training to be a priest in a Buddhist temple whole new level. hope for the new century arrives and takes full of incredibly gorgeous priestesses. BAKUGAN BATTLE Complete Set Viridian Collection Released 5/26/10 fl ight! • A copy of the most recent catalog The temple is usually called on to perform BRAWLERS exorcisms, and Ikkou’s inner power is 17+ • #AR09712 • 650 mins • $37.48 Complete Series S.A.V.E. Edition and newsletters on the latest releases.** on hand for whenever things get out of 17+ • #FUN04579 • 630 mins • $22.48 What Dan and his friends initially thought • Members-only special promotions control. A little fl ash of skin from his female was just a game has become a race to colleagues is enough to supercharge him, restore peace throughout the universe! After the devastation of World War III, ARIA not available anywhere else! but the aftermath involves dealing with an When Dan and Masquerade engage in an the scattered governments of the world TV SERIES extra-turned-on priest whose loins were all-out battle, Drago is sent spiraling into the construct the perfect city. But life in Olympus • A Got Anime membership card. blazing to begin with. At the age of 15, Akari Mizunashi has left Doom Dimension, and Dan follows after in is carefully controlled and monitored by everything behind to travel to a sparkling an attempt to save him. Complete Collection Biodroids - artifi cially created half-human So, how does this all work? Simple: to order an annual planet covered in water, Aqua. More than Vol. 1 13+ • #AWDVD1019 • 650 mins • $37.46 half-robots. A dedicated band of terrorists anything, Akari wants to be an Undine - a ALL • #883929115952 • DUB ONLY • 299 mins • $14.98 membership, select which type of Got Anime membership plots to destroy the central computer to female gondolier who navigates the canals AIR restore freedom to mankind... of the Aquan city of Neo-Venezia. As she you would like (regular or renewal), and write it on TV SERIES Regular Edition begins her training with the prestigious Aria your order form just like any other product. Once we 13+ • #SFAP001 • 105 mins • $14.98 Company, will she be up to the challenges cial Yukito is a traveling performer. He survives Blu-ray Released 5/18/10 that await her on the path to achieve her with only the clothes on his back, a puppet, receive your order, we’ll send you an offi 14+ • #SFBAP001 • 105 mins • $29.98 dream? and a story from his mother: “The Girl in the Got Anime membership card! Sky.” He doesn’t know who or where she Season 1: The Animation Complete Collection is; only that he must fi nd her. On the verge AQUARIAN AGE 13+ • #RSDVD0822 • SUB ONLY • 325 mins • $37.49 Your membership is tied to your billing address. of starvation, he is befriended by a young Season 2: The Natural Collection Part 1 For centuries, fi ve supernatural factions 13+ • #RSDVD0903 • SUB ONLY • 325 mins • $37.49 Please let us know if you move, so that we Season 2: The Natural Collection Part 2 can update the records! 13+ • #RSDVD0904 • SUB ONLY • 325 mins • $37.49 Season 3: The Origination + Arietta OVA Collection SSTAFFTAFF 13+ • #RSDVD1011 • SUB ONLY • 430 mins • $37.49 Want to use your membership PPICKICK ASTRO BOY right now? It didn’t take long for pint-sized Tamaki’s If you’re ordering other products at TV SERIES lightning refl exes to catch the eye of starving 1963 TV SERIES Kendo instructor Toraji. This second-rate the same time you’re purchasing ’s original 1963-1964 Astro sensei is an embarrassment to the sport, your membership, simply add a Boy delighted children around the world and his Kendo club is running out of with its touching stories and compelling members. His only hope for redemption - Got Anime membership to your characters. In a future where science fi ction and a full belly - is to get Tamaki to sign on is reality, Dr. Boynton creates a super-robot as his star pupil. Unfortunately, this sword- order and then check the “Yes” named Astro Boy. With super strength, wielding prodigy is a serious anime addict, box on the order form where it rocket-powered fl ight, a selfl ess heart so it’ll be a challenge to get her to step and a kind demeanor, Astro Boy fi ghts a away from the television and into the dojo. asks if you’re a member. never-ending crusade against the forces of Part 1 evil! The following versions all feature fully 13+ • #FUN09840 • 325 mins • $44.98 restored footage. Part 2 Figuring out your discount? The Beginning (Eps. 1-5) 13+ • #FUN09841 • 325 mins • $44.98 1. Add up the total cost of all of ALL • #RSDVD0999 • DUB ONLY • 100 mins • $9.74 Mini Collection 1 (Eps. 1-25) ALL • #RSDVD0715 • DUB ONLY • 550 mins • $37.49 your items.* When honor means nothing and power is 2. Multiply this sum by 0.10 Mini Collection 2 (Eps. 26-52) everything, can love survive? A legendary ALL • #RSDVD0727 • DUB ONLY • 600 mins • $37.49 pair of rival ninja clans battle to end years 3. Enter this amount on your order form Ultra Box Set 1 Limited Edition (Eps. 1-52) of slaughter, as a forbidden love struggles in the Got Anime Discount box. ALL • #RSDVD2013 • DUB ONLY • 1200 mins • $97.49 to prevail. Fate will decide if the ultimate Ultra Box Set 2 Limited Edition (Eps. 53-104) declaration must be made: To the one I ALL • #RSDVD2014 • DUB ONLY • 1200 mins • $97.49 love... prepare to die. That’s it! You’re done! Viridian Collection Regular Edition Released 6/29/10 17+ • #FUN08526 • 580 mins • $29.99 Complete Series Blu-ray In Miss Yukari’s English class, every day is 17+ • #FUN08525 • 580 mins • $52.48 an adventure. First off, there’s the teacher Need to Renew Your Membership? herself. A bit of an airhead, she may have Need to Get a Membership? graduated from high school, but she sure Catalog #: gotanimerenew hasn’t left. And with the arrival of not one, BEAST KING GOLION Catalog #: gotanime1 Your Cost: $12.00 but two transfer students - one ten-year-old SEE VOLTRON Your Cost: $12.00 prodigy and one space cadet - it’s going to be an interesting year! Complete Collection 13+ • #DAZ100 • 650 mins • $37.48 This is the story of shy, angst-ridden Koyuki, a 14-year-old boy who drags his feet into BACCANO! an unforeseen destiny. After stumbling Don’t let nobody tell you there’s no future into an exciting world of underground in a life of crime because some rackets can musicians, he’s accepted into a gang of : BROTHERHOOD last forever. But we’ll get around to all that disenfranchised youths and joins them in immortality jazz later. A mafi a turf war is their quest. Their goal? Self expression *Remember, discount applies only to our everyday low price and excludes specially imported items, certifi cates, and magazine subscriptions. Prepacks, Closeouts, Website Specials or Bargain Bin products which are already heavily Fullmetal Alchemist: Brotherhood © /FA Project, MBS. discounted cannot be further discounted using your membership. If in doubt, you can check the Got Anime Store at www.gotanime.com or call customer service at 1-800-338-6827. 6 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 7 **Only mail-order U.S. members receive a printed newsletter. All internet members and members outside the US can access their newsletters by logging onto www.gotanime.com Right Stuf © Right Stuf, Inc.. BLUDGEONING ANGEL arrest rate’s gone down. After all, the only Catching the most notorious serial killer to skirmish delivering salvation by the edge truest form and blessed with an arm to slay prison a dead man needs is a hole in the of all time is their only chance of survival, of a blade... for a fee. soul-devouring demons, Allen stands ready A blood-born plague races across DOKURO-CHAN ground. It’s hard to tell if she’s from Heaven but Conan will have to be smarter than Complete Series Box Set to confront the gathering storm. Germany, giving life to mechanized or Hell, but an angel’s just come to earth. Sherlock to apprehend the Phantom of Imagine a world where the secret to immortality 17+ • #FUN07447 • 620 mins • $52.48 Season 1 Complete Collection Released 7/6/10 monsters. Known as Demoniacs, these She’s an enigma, but with her partners Sei, Baker Street! has been discovered, causing women to stop Complete Series Blu-ray 14+ • #FUN06926 • 325 mins • $52.49 creatures have the perverse ability to aging by the time they turn twelve. Sounds Amy, and Meg, she’s the best chance this 13+ • #FUN07784 • 110 mins • $14.98 17+ • #FUN07448 • 620 mins • $52.48 Season 1 Part 1 Blu-ray meld with technology and wield it as an like a problem, doesn’t it? That’s why the Big town’s got. Her name’s Jo. And there’s a extension of their uncontrollable cyber new sheriff in town. 14+ • #FUN06922 • 286 mins • $44.98 Man Upstairs sends Dokuro-chan, one of DVD & BLU-RAY rage. Standing in their way is civilization’s his angelic assassins, into the past to “deal” Blu-ray Set (TV Series + OVA) CASTLE IN THE SKY : LELOUCH Season 2 Part 1 last hope. Joseph Jobson, the mysterious with the sicko who messed with nature! But 14+ • #FUN07737 • 625 mins • $59.98 14+ • #FUN06920 • 286 mins • $44.98 blue rider, fuses with the unreal technology Pazu, an engineer’s apprentice, fi nds a OF THE REBELLION Dokuro-chan decides instead to move in with young girl, Sheeta, fl oating down from the Season 2 Part 2 of his battle-tested motorcycle to defend Lelouch, an exiled Imperial Prince of her target and keep him too occupied to fi nd sky wearing a glowing pendant. Together, 14+ • #FUN06921 • 286 mins • $44.98 man against machine. But the same tainted Britannia posing as a student, fi nds eternal life... they discover both are searching for the blood that carries his strength threatens to himself in the heart of the ongoing confl ict legendary fl oating castle Laputa and vow to devour his soul. Special Edition Released 5/18/10 for the island nation formerly known as unravel the mystery of the luminous crystal 16+ • #AWDVD1020 • 180 mins • $22.49 Japan. Through a chance meeting with a DAIRUGGER Complete Series Part 1 around Sheeta’s neck. Their quest won’t be mysterious girl named C.C., Lelouch gains SEE VOLTRON 17+ • #FUN09850 • 288 mins • $44.98 easy, however. There are greedy air pirates, his Geass, the power of the king. Now Complete Series Part 2 BLUE DROP secret government agents, and astounding endowed with absolute dominance over 17+ • #FUN09851 • 288 mins • $44.98 Five years ago, something happened to Mari obstacles to keep them from the truth - and any person, Lelouch may fi nally realize his Wakatake. Something that took the lives of from each other. DAPHNE IN THE goal of bringing down Britannia from within! every other human on Kamioki Island, then 2-Disc Set Season 1 Part 1 BRILLIANT BLUE wiped her mind clean of memories. But 13+ • #786936791617 • 90 mins • $26.99

DVD & BLU-RAY DVD TV SERIES if Mari’s past is an unknown nightmare, 13+ • #AV80328 • 225 mins • $29.98 Maia’s life-long dream to join the elite Marine Environment Agency withers and dies when, Fifteen-year-old Ichigo Kurosaki never asked her future may soon become even more SSTAFFTAFF Season 2: R2 Part 1 for the ability to see ghosts - he was born terrifying. While Mari was the sole human PPICKICK 13+ • #AV80331 • 175 mins • $29.98 despite everyone’s high expectations, she fails the entrance exams. Then, she with the gift. When his family is attacked by survivor, something else lived through the The year is 1928. Jazz is hot, bootleg Season 2: R2 Part 2 gets evicted! Penniless, homeless, and a Hollow - a malevolent lost soul - Ichigo same night, and now, wearing a female liquor is king, and the idle rich of a 13+ • #AV80332 • 150 mins • $29.98 skin, its path is about to cross Mari’s again unemployed, Maia fi nds herself in the middle encounters a soul reaper and absorbs her TV SERIES nation have discovered a horrifying new Season 2: R2 Part 3 powers. Now, he’s dedicating his life to at the exclusive Kaihou Academy. pastime: summoning demons! To combat of a shoot-out between fugitive convicts and Jimmy Kudo is a cocky teenage detective, 13+ • #AV80333 • 150 mins • $29.98 the Nereides - sexy agents who only take protecting the innocent and helping tortured Complete Collection this growing threat, a new order of Holy known far and wide for his crime-solving Season 2: R2 Part 4 the most high-paying and dangerous jobs. souls fi nd peace. 14+ • #SFBD100 • SUB ONLY • 325 mins • $29.98 skills. While working a particularly gruesome Warriors has arisen. Sister Rosette is an elite Exorcist in the Order of Magdalene, 13+ • #AV80336 • 150 mins • $29.98 Desperate, Maia agrees to a job in the next Season 1 Box Set (Eps. 1-20) case, Kudo is attacked in the darkness Nereides operation - as bait! 13+ • #DBHBS001 • 500 mins • $37.46 by two strange men and force-fed an and her soul has been bound by alchemy More volumes also available! to that of the devil Chrono. Armed with Collection 1 Season 2 Box Set (Eps. 21-41) experimental drug. The strong poison Everyone knows about Boogiepop: meet sacred ammo, Rosette and Chrono form 13+ • #SFDBB100 • 325 mins • $29.98 13+ • #DBHBS2 • 500 mins • $52.48 renders him unconscious, and when he her one dark night, and you’ll disappear. awakens, he is horrifi ed to fi nd that he is an unstoppable team, ready to wage war Collection 2 Season 3 Box Set (Eps. 42-63) People tell each other the stories and laugh, trapped in his boyhood form! at a moment’s notice. TV SERIES 13+ • #SFDBB200 • 325 mins • $29.98 13+ • #DBHBS3 • 500 mins • $52.48 but no one truly believes that she exists Season 1 Box Set Viridian Collection Complete Collection REVOLUTION Season 4 Box Set 1 (Eps. 64-79) in this day and age... The glass shatters. 13+ • #FUN07785 • 635 mins • $22.48 14+ • #DCHC100 • 650 mins • $44.98 Kazuki and Mizuki are college students 13+ • #782009239635 • 425 mins • $37.46 Time stands still. Five years ago, a string of Season 2 Box Set Viridian Collection immersing themselves in the otaku Season 4 Box Set 2 (Eps. 80-91) grisly murders shook the city to its core... 13+ • #FUN07786 • 600 mins • $22.48 subculture. Kazuki has grown more 13+ • #782009240792 • 350 mins • $37.46 And now, in the present, psychic echoes confi dent in his abilities as a Season 3 Box Set Viridian Collection CLAMP DOUBLE FEATURE Vol. 23 reverberate... This collection includes the (amateur comic) artist, but will all of the girls 13+ • #FUN07787 • 635 mins • $22.48 SEE TSUBASA 13+ • #782009240549 • 100 mins • $18.69 entire TV series and live-action Boogiepop distract him or help him succeed? And what and Others movie. Season 4 Box Set Viridian Collection Vol. 24 of Taishi’s plans for world domination? 13+ • #FUN07788 • 600 mins • $22.48 13+ • #782009240556 • 100 mins • $18.69 Anime Value Collection Complete Series 15+ • #RSDVD0925 • 470 mins • $29.99 Season 5 Box Set Viridian Collection Vol. 25 CLANNAD 14+ • #AR06930 • 317 mins • $37.48 13+ • #FUN07789 • 615 mins • $22.48 13+ • #782009240563 • 100 mins • $18.69 TV SERIES BUBBLEGUM CRISIS ORIGINAL SERIES Vol. 26 BOYS BE... MOVIES ORIGINAL SERIES 13+ • #782009240570 • 125 mins • $18.69 Just another love story? No way! After THE LAST WIZARD OF THE CENTURY Alienated from his abusive father, Tomoya TV SERIES SSTAFFTAFF Vol. 27 Released 4/20/10 ages of hearing about what girls have to has been spiraling into delinquency since cranked up to ten and to make an impact on future, but only about fi ve minutes into it. A phantom thief is on the loose, and his Jet and Spike are intergalactic bounty- PPICKICK 13+ • #782009240587 • 100 mins • $18.69 say about relationships, Boys Be... steps the death of his mother. Nagisa’s curse the world around them that could care less. When a dirty politician puts a price on his explosive capers are knocking out lights all hunters just trying to make a living in a forward to reveal the fl ip side of love: what’s is her health, which has forced her head, the sweeper jumps at the chance over town! His target is a priceless Russian rough future. They’re used to chasing down A new, deadly breed of covert agent Complete Series S.A.V.E. Edition Released 6/1/10 MOVIES really going on from a guy’s point of view! to repeat a year of high school. But when to earn a quick buck. But as he’s working heirloom that people are literally dying to dangerous criminals and generally getting walks the streets. Known as Contractors, 17+ • #FUN06791 • 625 mins • $22.49 THE DIAMOND DUST REBELLION Meet Kyoichi, Makoto and Yoshihiko - three Tomoya impulsively agrees to help Nagisa to secure the target, his vision reveals an get their hands on. The good guys seem in over their heads. Of course, their line of these assassins and spies wield bizarre normal high school guys with just one thing restart the school’s disbanded Drama Club, assassination that will cost him the job. When a caravan transporting the King’s bad and the bad guys seem good, and not work defi nitely has its peculiarities here and supernatural powers. They thrive in the on their minds: girls. a new mechanism for change is created, BIG WINDUP! OOFURI Seal is attacked, Toshiro Hitsugaya and even the boy detective knows who to trust. there: chasing after dog-nappers, fi ghting underworld, between rumor and reality, their Viridian Collection Released 7/13/10 Squad 10 are on the ready. As they Box Set (Thinpak) acting like a magnet for other girls with Most guys can’t wait for baseball to start, Worse yet, a rogue sniper is making sure off ecologically-crazed terrorists, and loyalties always in question. One of these 13+ • #FUN05899 • 575 mins • $29.98 prepare to protect the treasure that holds 13+ • #RSDVD0807 • 325 mins • $33.74 equally tragic stories. but not Mihashi. For this kid, the crack of the anyone in the way catches a bullet dead in of all… having to deal with the oddest group operatives is more mysterious than the rest: immeasurable power, Hitsugaya suddenly bat is the sound of failure. Every summer he the eye. Collection 1 of people from all over the galaxy. BK201, the Black Reaper. His path weaves abandons the scene alongside the thieves gets caught in a pickle between wanting to BUBBLEGUM CRISIS 13+ • #SFCL100 • SUB ONLY • 300 mins • $29.98 through the shadows and alleys of , and becomes one of the accused. 13+ • #FUN07804 • 105 mins • $14.98 Remix Collection stay on the mound and watching his pitches TV SERIES TV SERIES Collection 2 13+ • #AV20047 • 650 mins • $37.48 and blood is spilled on both sides of the law. get blasted out of the park. But each spring 13+ • #782009239741 • 90 mins • $22.44 CAPTURED IN HER EYES 13+ • #SFCL200 • SUB ONLY • 300 mins • $29.98 Rokuro Okajima is on a business trip to TOKYO 2040 Complete First Season brings a fresh start, and this year, Mihashi’s Half-pint detective Conan Edogawa has South East Asia, but things quickly go from CLANNAD AFTER STORY 17+ • #FUN07457 • 625 mins • $52.48 at a new school with teammates that don’t pleasure cruise to festival of pain when BLOOD: THE LAST In the aftermath of the great earthquake, solved plenty of crimes, but this time it’s CRAYON SHINCHAN know how bad he used to be. modern-day pirates board the ship and one ruthless corporation stands ready to personal! There’s a killer on the loose, Picking up where Clannad left off, After VAMPIRE take over the devastated city of Tokyo with SEE SHINCHAN DARKSIDE BLUES Season 1 Part 1 take him hostage! Revy, Dutch, and Benny and the targets are none other than the Story follows Tomiya and Negisa over the an army of synthetic monsters. Only a single 14+ • #FUN09960 • 315 mins • $44.98 are merciless, maniacal, and mean - and MOVIE boys in blue. No cop will be safe until the next ten years of their time living together In the future, the Persona Century band of female mercenaries stands ready to boy wonder cracks the case. But there’s as a family. Corporation rules 99% of the world. They Season 1 Part 2 together, they make up the crew of the At the Yokota Base in Japan, a nervous take on the monolithic power of Genom - just one problem. Only Rachel has seen thought they wielded absolute power. They 14+ • #FUN09961 • 315 mins • $44.98 Black Lagoon. They’ve been hired to steal American military is on the brink of the Collection 1 D.GRAY-MAN but in this case, four women are all it takes! were wrong. A dark mystic has appeared in a data disc Rokuro was carrying and with Vietnam War. But a greater threat exists within the fi end in action, and the shock of a 13+ • #SFCL300 • SUB ONLY • 300 mins • $29.98 Armed with the most incredible combat Darkness is moving in, and young exorcist the lawless free-zone known as Darkside. it, classifi ed information that threatens the the walls of the heavily-guarded compound: witnessing a murder up close and personal Collection 2 BLACK BLOOD suits ever designed, the Knight Sabers is humanity’s greatest hope But the Corporation is aware of the threat peace and security of the entire world! vampires. A team of top-secret undercover made her forget everything she ever knew 13+ • #SFCL400 • SUB ONLY • 325 mins • $29.98 wage a desperate war in the shadows! against the wicked forces conspiring to he poses, and has the resources of an entire BROTHERS agents learns of these blood-sucking fi ends and everyone she ever loved. Complete Set (Seasons 1-2) bring civilization to its knees. Akuma - cruel world to throw against him. Can one mystic 16+ • #GN08318 • 660 mins • $52.48 and dispatches the mysterious Saya to hunt Complete Collection 13+ • #FUN07805 • 105 mins • $14.98 spirits born of tragedy and lost souls - lurk Jiro is traveling with his younger brother 14+ • #DBG200 • 650 mins • $37.48 and a small band of freedom fi ghters stand Kotaro to the Special Zone, a place where down and destroy them... in every shadow, willing and eager to do the COUNTDOWN TO HEAVEN against a tyrannical, global dictatorship? vampires live freely in peace alongside Blu-ray bidding of their leader, the dread Millennium humans. But the brothers fi nd themselves 15+ • #N3124 • 48 mins • $14.98 BURN UP! As the grand opening of a pair of towers Earl. With an eye cursed to see evil in its 14+ • #DDSB001 • 83 mins • $11.24 in the midst of a battle between human Manji was a samurai bound in service to ORIGINAL OVA nears, death and mayhem mars the fresh soldiers, vampiric refugees, and the re- an evil master. When he chose humanity TV SERIES start to the architectural marvels. Conan, Maki, Reimi and Yuka may not look like ace emergence of the Kowloon Children. over duty and butchered his , he was BLOOD+ suspecting that the mysterious Black crime fi ghters, which is why they’re stuck Assisted by Mimiko, a negotiator between forced to kill 100 honest men who made the Organization that poisoned and left him for Saya Otonashi, a seemingly normal high on traffi c patrol, but all that changes when their species, Jiro will try to make sense opposite choice. At this point, when he had dead is involved, goes to investigate. But he school student, suffers from amnesia, and Yuka gets herself kidnapped. Then Maki and of the chaos which surrounds them before no future but death, he was granted eternal soon fi nds himself in harm’s way, trapped, she can’t remember the past year of her life. Reimi must don skin-tight battle armor and they are caught up in it and destroyed. life by an old mystic. He spends his time as the buildings are set to blow. taking care of his sister, who was the wife One day, a man gives her a katana sword, teach the kidnapper that when you play with Complete Set Viridian Collection Released 8/31/10 of one of the 100 men. But tragedy strikes and she soon fi nds herself fi ghting the latest fi re, you’re going to get burned! 13+ • #FUN07783 • 100 mins • $14.98 17+ • #FUN05908 • 288 mins • $29.98 threat to humanity: Chiropteran monsters. SSTAFFTAFF Manji yet again, and he is driven to end his 14+ • #SFBU001 • 45 mins • $11.24 THE PHANTOM OF BAKER STREET PPICKICK Don’t see what you want? curse... and seek the gift of death. They feed off blood and hide themselves within the human world. An organization Conan’s latest case fi nds him trapped in a Find more DVDs and Blu-ray Vol. 1: Life is Not Precious known as the Red Shield has been waging virtual recreation of 19th century London A brutal scourge stalks the land: Yoma, on RightStuf.com! Sven is your run-of-the-mill sweeper 16+ • #AWDVD0935 • 125 mins • $18.74 a private war to wipe them out. and pitted against none other than Jack A new law’s been passed. Ordinary folks are monsters driven by a hunger satisfi ed by (aka bounty hunter) - down on his luck, Vol. 2: The Tears I’ve Cried the Ripper! To save his friends, Conan Part 1 now allowed to carry fi rearms; shoot, they’re only one quarry: Humanity. The dark breed haunted by the perpetual grumbling of 16+ • #AWDVD0963 • 100 mins • $18.74 must follow in the footsteps of his hero - N/R • #SON22653DD • 600 mins • $107.96 even legally allowed to use ’em. You might knows but a singular foe: Claymore. Human- his stomach and looking to make enough Vol. 3: No Virtue in Forgiveness Sherlock Holmes - and crack a case that’s Part 2 think that crime would increase, but the Yoma hybrids of extraordinary strength and cash to get by. Oh, and he can see the gone unsolved for over a hundred years. 16+ • #AWDVD0992 • 100 mins • $18.74 N/R • #43396298002 • 620 mins • $107.96 cunning, the Claymores roam from skirmish

Bubblegum Crisis © TOSHIBA-EMI Limited.

8 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 9 KAI a dragon becomes a reality, her life changes Season 1 Part 1 Regular Edition Released 5/18/10 forever. Drawn into a strange vortex with the “I love doing business with your company. You are 13+ • #FUN08780 • 325 mins • $37.48 swordsman, Van, Hitomi is thrust into the strange world of Gaea. Van must learn to Season 1 Part 1 Blu-ray Released 5/18/10 always professional, affordable, and attentive to any master the suit of armor, Escafl owne, before 13+ • #FUN08781 • 325 mins • $41.26 concerns.” - LaTanya C. he and Hitomi are crushed by the ambitions of the Empire of Zaibach! DRAGONAUT: travel has become a reality. One of the Super Legends Complete Collection DVD & BLU-RAY fi rst outposts in the far reaches of space THE RESONANCE 13+ • #AV20015 • 625 mins • $29.98 TV SERIES is Watcher’s Nest, which has recently With a deadly asteroid hurtling towards MOVIE Light Yagami is an ace student with great come under attack by a mysterious force Earth, sexy human Dragonauts in tight A re-telling of the Escafl owne TV series! prospects - and he’s bored out of his mind. known as GHOUL. The young female uniforms and their curvaceous dragon All that changes when he fi nds the Death cadets assigned to the portal are thrown companions come together to create a Blu-ray Note, a notebook dropped by a rogue into deep trouble as they struggle to formidable fi ghting force with all the right 13+ • #AV80468 • 120 mins • $29.99 shinigami. Any human whose name is fi nalize their training to become elite pilots. moves. Caught in the middle of this race written in the notebook dies, and now Light Contains both the original series and the against time are Jin, a heartbroken young has vowed to use its power to rid the world Misaki Chronicles. fl yboy, and Toa, a voluptuous lady-dragon MOVIE of evil. But when criminals begin dropping Seraphim Collection with an amazing set of intergalactic battle dead, the authorities send the legendary 14+ • #DDVE100 • 650 mins • $37.48 skills. If these star-crossed space cadets GOOD NIGHT, SLEEP TIGHT, YOUNG LOVERS detective L to track down the killer. With L can unlock the secrets of their mysterious Humankind is on the brink of destruction. hot on his heels, will Light lose sight of his DOJIN WORK connection, there may yet be hope for A select few are evacuated to colonization noble goal? planet Earth! spaceships and the government is about to DVD & BLU-RAY DVD Box Set 1 (Eps. 1-20) Doujin Work follows of a young girl Part 1 fi re their doomsday device. In the middle of 15+ • #DDNBS01 • 500 mins • $52.48 named Najimi Osana and her exposure into 14+ • #FUN09860 • 315 mins • $37.48 this war are Renton and Eureka; childhood the doujin world. Najimi loves to draw, but Box Set 2 (Eps. 21-37) Part 2 friends who were separated when Eureka soon learns, contrary to what she expected, 15+ • #DDNBS02 • 400 mins • $52.48 14+ • #FUN09861 • 315 mins • $37.48 was kidnapped by government forces. that breaking into the doujin world is Renton is now a soldier, piloting the Nirvash, SPECIALS anything but easy. aboard the GEKKO led by Holland Novak. EL CAZADOR RELIGHT Complete Collection Released 4/20/10 Fate will test the young lovers as they fi ght the EIZO, government forces, and even See through the eyes of a shinigami... Light 13+ • #AWDVD1023 • SUB ONLY • 300 mins • $37.46 DE LA BRUJA Holland. and L have battled to the bitter end over the Ellis is an amnesiac with a bounty on her Death Note - but what does the story look DOKKOIDA?! head, and Nadie’s trigger fi nger is the only Regular Edition like from Ryuk’s point of view? 13+ • #AV26315 • 117 mins • $18.74 The Galaxy Federation Police desperately thing keeping her friend from falling into the Blu-ray Vol. 1: Visions of a God wants to cover up its personnel shortage wrong hands. They’re looking for pieces of 13+ • #AV26316 • 117 mins • $29.99 15+ • #DDNRL01 • 130 mins • $18.69 with new mechanized power-suits. Suzuo Ellis’s past, and every mile of open highway brings the girls closer together - but their Vol. 2: L’s Successors desperately needs a job, and conveniently, special bond is bound to be tested. 15+ • #782009239789 • 130 mins • $18.69 Tampopo needs an earthling to fi t the EVANGELION, NEON prototype of her company’s suit. Strong Season 1 Part 1 GENESIS competitors and the wacky A-class 17+ • #FUN09870 • 312 mins • $37.48 criminals fi ght against our hero in diapers, Season 1 Part 2 Enter a decimated world deep within the but they must not recognize each other 17+ • #FUN09871 • 360 mins • $37.48 desert, where a less-than-noble hero fi ghts out of costume or the test results will be a for less-than-noble causes and chases a failure! Still, it’s OK if they all live in the same voluptuous love interest for less-than-decent apartment building to save money, right? reasons. A world where war is a way of life, Complete Collection Imprisoned under tight military security, sarcasm is a mode of communication, and 13+ • #SFDK100 • 300 mins • $22.48 Lucy, a genetically altered human known the unexpected is always on the menu. as a Diclonius, escapes her confi nes in a Complete Set Viridian Collection Released 7/13/10 wave of bloody violence and brutality. Now 17+ • #FUN06917 • 650 mins • $29.98 lost, alone, and stricken with amnesia, she wanders into a kindly family that takes her Complete Collection Blu-ray Released 7/27/10 TV SERIES UNCUT SSTAFFTAFF under their care, oblivious to the latent 17+ • #FUN06918 • 650 mins • $33.74 Goku may be small, but this fearless warrior PPICKICK destructive power that this innocent-looking packs a punch as powerful as any on the girl harbors! DESTINY OF THE planet. Left alone after his grandfather’s death, this unusual boy is happy to spend Complete Collection MOVIES SHRINE MAIDEN his days eating and hunting and eating 17+ • #DELF100 • 325 mins • $29.98 YOU ARE (NOT) ALONE Shy, timid Himeko happily attends school some more. But everything changes on the Tokyo-3 still stands after most of civilization with both the popular and beautiful Chikane day he meets Bulma - a bossy, blue-haired : was decimated in the Second Impact. Now and her childhood friend, Souma, blissfully beauty with boys on the brain. Together, A VICTORIAN ROMANCE the city endures the ceaseless onslaught unaware of what’s in store for her. However, they set out to track down the seven magic of the deadly Angels, bizarre creatures the destiny of these three changes on Dragon Balls and make the wish that will In 19th-century London, class lines are bent on eradicating the human race. To Himeko’s 16th birthday when the mark of change their lives forever. sharply drawn, and the social standing to combat this strange and ruthless enemy, the sun appears on her chest. What does Season 1 Box Set (Eps. 1-31) which one is born dictates the path his or the government agency NERV constructs a this solar mark represent? At the same 14+ • #FUN05190 • 745 mins • $37.48 her life will likely follow. But when Emma, fl eet of towering humanoid machines - the time, why has a black aura of agony burst Season 2 Box Set (Eps. 32-61) an honest and hardworking young maid, Evas - and Shinji Ikari is called into action, forth from Souma? Who is the enemy? The 14+ • #FUN05191 • 720 mins • $37.48 and William, an earnest member of the reluctantly taking his place at the controls legend of the eight-headed beast returns gentry, fall for each other, can love truly of Eva Unit 01. Season 3 Box Set (Eps. 32-92) to Japan! conquer all? 14+ • #FUN05192 • 745 mins • $37.48 Regular Edition Season 1 Collection 13+ • #FUN09881 • 98 mins • $22.48 Complete Collection Season 4 Box Set (Eps. 93-122) Released 5/4/10 13+ • #RSDVD0805 • SUB ONLY • 300 mins • $37.49 13+ • #SFDSM100 • 300 mins • $29.98 14+ • #FUN05194 • N/A mins • $37.48 Special Edition Season 2 Collection 13+ • #FUN09882 • 110 mins • $22.48 Season 5 Box Set Released 7/2710 13+ • #RSDVD0806 • SUB ONLY • 325 mins • $37.49 14+ • #FUN05195 • N/A mins • $37.48 Blu-ray DETECTIVE CONAN 13+ • #FUN09880 • 110 mins • $26.24 SEE CASE CLOSED MOVIES MOVIE 1: CURSE OF THE BLOOD RUBIES TV SERIES The domed city of Romdo is an impenetrable In the year 2015, half of the human race Released 7/27/10 would-be utopia where humans and robots N/R • #FUN05197 • N/A mins • $11.24 is dead and the survivors face a terrifying DIGIMON coexist, and everything is under complete last judgment from giant biotechnology government control - or so it appears. Follow the adventures of Marcus, a cool experiments called Angels. A handful of While working on a mysterious murder case, teenagers are trained to pilot the colossal junior high school student, and his favorite Re-l Mayer, a female detective, receives Digimon Agumon as they investigate their TV SERIES UNCUT super-entities known as Evangelions and a foreboding message that something battle the Angels on their own terms... way through the Digital World battling Digital DRAGON BOX Z is going to “awaken.” That night, she’s Monsters in exciting and different situations. whatever the cost to their minds and souls. DBZ explodes in vivid detail like never attacked by a deformed super-being. What Marcus’s best friends Thomas and Yoshino This digitally remastered edition includes 5.1 before! This archival version features was the unidentifi ed that attacked and their Digimon partners Gaomon and audio for both audio tracks, the original 26 episodes remastered and restored frame by her, and who was the fi gure that came in Lalamon join in the adventures and help broadcast episodes, plus the director’s cut frame by the original Japanese production between them? challenge and battle strong opponents versions of episodes 21-26. studio, rendering the legendary action in along the way. Complete Series Platinum Complete Collection (Thinpak) pristine clarity. 16+ • #GN08662 • 600 mins • $37.48 Season 5 Collection 1 14+ • #DNGEBX2 • 650 mins • $67.48 Set 1 (Eps. 1-41) 7+ • #WD1072 • DUB ONLY • 390 mins • $26.24 13+ • #FUN02240 • 1000 mins • $44.98 Season 5 Collection 2 Released 5/25/10 ESCAFLOWNE, Set 2 (Eps. 42-84) 7+ • #WGU01086D • DUB ONLY • 285 mins • $22.49 VISION OF 13+ • #FUN02241 • 1000 mins • $44.98 Sena’s incredible skills at not getting caught Set 3 (Eps. 85-126) Released 5/4/10 TV SERIES by bullies have been spotted by the devilish DIVERGENCE EVE 13+ • #FUN02266 • 720 mins • $44.98 Hitomi Kanzaki is a typical high school girl, (possibly actually demonic) of the school’s football team, and he gets thrust In the 24th century, intergalactic space but when a vision of a young man battling

10 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 11 MOVIE KUJIBIKI UNBALANCE + OVA GANKUTSUOU: THE TV SERIES real - and a brutal compulsion to be the last killer standing. THE CONQUEROR OF SHAMBALA Hapless Chihiro Enomoto’s luck changes When terrorist groups, evil criminals COUNT OF MONTE CRISTO 00 Taking place two years after the last episode for the better (or worse, depending on how and hostile aliens become too powerful The year is 2307 A.D. Humanity has 17+ • #FUN08195 • 48 mins • $11.24 you look at it) when he is randomly chosen Born into an aristocratic family in Paris, of the original series, the Elric Brothers must for earth’s armed forces, the virtually Albert sets out on a journey with his best obtained a nearly infi nite source of solar reunite to prevent ultimate catastrophe as as a candidate for the next student council indestructible robot Gigantor is built to power based on three huge orbital GUYVER president. Unfortunately, that means he friend, Franz, to escape his privileged, yet the worlds of reality and alchemy collide. combat them. Commanded by Jimmy dull, life. They travel to Luna, on the surface elevators. However, the benefi ts of this must undergo a year-long apprenticeship Sparks through a control, Gigantor system are available only to a handful of While investigating a mysterious explosion Blu-ray with the current ruling body, accomplishing of the moon, and meet a very wealthy near his school, Sho Fukamachi happens DVD & BLU-RAY 13+ • #FUN08151 • 104 mins • $18.74 must battle to save the world from a never- man named the Count of Monte Cristo. powers and their allies: the Union, one impossible, punishing task after ending assault by ruthless villains. the Human Reform League and the AEU. upon the Chronos Corporation’s greatest another. Includes the Kujibiki Unbalance TV Becoming completely fascinated with the weapon: a techno organic suit of bio OVAS Collection 1 Count’s mysterious charm, Albert welcomes In this world of unceasing confl ict, a private series plus the spin-off OVA. armed organization steps forward, declaring armor known as the “Guyver.” Sho soon The Fullmetal Alchemist universe expands ALL • #KOCDV6575 • DUB ONLY • 650 mins • $29.98 him into Paris’ high society. But soon, fi nds himself relentlessly pursued by Litebox Set their intention to eliminate war through with new stories that reunite the original Collection 2 Albert will discover the Count’s true motive: an army of horrifi c bio-monsters. With 16+ • #AWDVD0968 • 385 mins • $22.49 martial force. U.S. cast in four eye-opening tales. ALL • #E1EDV6657 • DUB ONLY • 650 mins • $29.98 revenge. nowhere to run, Sho is forced to call Season 1 Part 1 Premium Collection Complete Set S.A.V.E. Edition Released 7/20/10 upon the fearsome power of the Guyver 13+ • #AV80427 • 225 mins • $29.98 13+ • #FUN08131 • 30 mins • $11.24 17+ • #FUN01131 • 580 mins • $22.49 and rip his opponents limb from limb in a When he was three, Taro Komori and his Season 1 Part 2 desperate struggle for survival. sister were kidnapped, but the kidnapper GRAVE OF THE FIREFLIES 13+ • #AV80428 • 200 mins • $29.98 Complete Set Regular Edition was killed before the ransom could be Season 1 Part 2 Special Edition 17+ • #AR09752 • 625 mins • $37.48 Mikan and Hotaru are best friends! ...Well, delivered. The police eventually found Taro, When their mother is killed in the 13+ • #AV80447 • 200 mins • $33.74 according to Mikan, anyway. Hotaru Complete Collection Blu-ray Released 6/22/10 but not before his sister had died. Eleven fi rebombing of Tokyo near the end of World Season 1 Part 3 doesn’t seem to care. But one day, Hotaru 17+ • #AR09753 • 625 mins • $41.24 years later, Taro still has nightmares and is War II, teenage Seita and his little sister 13+ • #AV80429 • 200 mins • $29.98

DVD & BLU-RAY DVD is escorted away in a fancy black car, Setsuko are left on their own. With their haunted by a tall, featureless specter. Now Season 1 Part 3 Special Edition apparently scouted by a school in Tokyo Taro searches for answers together with father away, serving in the Imperial Navy, the : LEGENDS called “Alice Academy.” Crushed at the loss 13+ • #AV80448 • 200 mins • $33.74 two unlikely companions: a brash transfer two children initially stay with an aunt, but This sweeping science-fi ction saga delves of her favorite pal, Mikan scurries after her, Season 2 Part 1 student from Tokyo who is himself haunted she has little affection for them and resents into the rich Halo universe with seven determined to enroll too! But can Mikan 13+ • #AV80431 • 175 mins • $29.98 by a fellow student who committed suicide the time and money they require. The two exciting stories (told in eight parts) focused tough it out in a school where explosions, and the son of a man who committed SSTAFFTAFF children set up housekeeping in a cave by Season 2 Part 1 Special Edition on ’s mysterious origins, the superpowers, giant baby chicks and axe- suicide after being accused of being PPICKICK a stream, but their meager resources are 13+ • #AV80421 • 175 mins • $33.74 Spartans’ advanced combat capabilities, wielding teddy bears are the norm? involved in the kidnapping. quickly exhausted, and Seita is reduced to and the tense rivalry between Spartans and stealing to feed his sister. Collection Collection 1 Orbital Drop Shock Troopers (ODSTs). 13+ • #RSDVD0902 • SUB ONLY • 650 mins • $37.49 TV SERIES 14+ • #SFGH100 • SUB ONLY • 275 mins • $44.98 13+ • #DGFF001 • 89 mins • $14.98 Regular Edition Life isn’t easy in feudal Japan... especially TV SERIES Collection 2 N/R • #883929099245 • 90 mins • $14.99 since the aliens landed and conquered Offi cially, the Social Welfare Agency is 14+ • #SFGH200 • SUB ONLY • 275 mins • $44.98 everything! Oh sure, the new health care GRAVITATION supposed to be in the business of saving Blu-ray Ito Keita has one thing in his favor: luck! And is great, but the public ban on the use of TV SERIES lives. In reality, it gives terminal patients the N/R • #883929099023 • 90 mins • $26.24 luck has just landed him a special invitation swords has left a lot of defeated samurai All Shuichi ever dreamed about was ability to survive… but there’s a price. The to attend the Bell Liberty Academy for Boys, with a diffi cult career choice! Gintoki survivors must become the government’s an exclusive high school only for the most MOVIE following in the footsteps of his pop idol. Sakata’s opted for the freelance route, but He’s even managed to land a contract secret assassination force. When Henrietta HARUHI privileged, the most talented, and the most ORIGINAL MOVIE in a brave new world fi lled with stray bug- barely survives the brutal slaughter of her SEE MELANCHOLY OF beautiful. But when a strange accident on with a major recording label! Unfortunately, Major Motoko Kusanagi is an elite offi cer in eyed montsters, upwardly mobile , deadlines are looming, and Shuichi still family, she awakens to her new life at the move-in day attracts the attention of Niwa the Section 9 security force: a cybernetic and overly ambitious E.T. entrepreneurs, Agency with no memory of her past. She’s Tetsuya, the student body president, and doesn’t have his songs fi nished. Walking agent so heavily modifi ed that little more freelance jobs usually don’t pay as well through the park, his latest lyrics fl utter been a second chance at life… but Saiyonji Kaoru, the class secretary, Ito fi nds than her “Ghost” remains. Along with fellow as they should for the pain, suffering, and at what cost? himself the center of attention. away and land at the feet of the stunningly cyborg Bateau and the mostly human indignities endured! cool Eiri Yuki, who completely crushes Season 1 Collection Regular Edition HAYATE THE onto the fi eld as a running back! But to the special powers of “The Whispered,” and Complete Collection (Litebox) Togusa, Kusanagi is set on the trail of a Collection 1 Released 4/27/10 Shuichi by telling him he has “zero talent.” 14+ • #FUN08209 • 325 mins • $29.99 COMBAT BUTLER keep the identity of their new “star” player they’re out to kidnap her. computer-criminal known as the Puppet 13+ • #AWDVD0967 • SUB ONLY • 400 mins • $14.99 14+ • #SFGN001 • SUB ONLY • 325 mins • $29.98 Now, Shuichi’s so annoyed that he’ll fi nish Season 1 Collection Blu-ray an absolute secret, Yoichi makes Sena wear Master, a data thief skilled enough to hack Hayate’s always had to work part-time jobs Complete Collection his song just so he can confront Eiri Yuki 14+ • #FUN08197 • 320 mins • $37.48 an opaque visor on his helmet and gives 14+ • #DFMBX3 • 600 mins • $67.49 into the very minds of his victims. to support himself and his lazy, unemployed GAO-GAI-GAR GIRL’S HIGH once again. But is he motivated by anger, Season 2: IL Teatrino Regular Edition him the alias of “Eyeshield 21.” 2.0 Regular Edition parents, who gamble and fritter away all his or has he really fallen in love? Complete Series Collection 1 Released 5/18/10 SEASON 3: THE SECOND RAID Mamoru was an ordinary grade school 17+ • #ZM5088 • 83 mins • $18.73 Eriko and her friends fi nally make it to an hard-earned money. Now they’ve taken out student until the day when his class was Collection (Thinpak) 14+ • #FUN08199 • 320 mins • $44.98 a 156,804,000 yen loan and abandoned 13+ • #SFESH001 • SUB ONLY • 325 mins • $37.48 A new threat has arisen: Amalgam. As 2.0 Blu-ray exclusive high school, and they’re ready to caught up in a ferocious attack by the 13+ • #RSDVD2015 • 325 mins • $44.99 Season 2: IL Teatrino Collection Blu-ray Hayate to pay it off. On a fateful night, Hayate dissension spreads throughout the ranks 17+ • #N3095 • 83 mins • $22.48 make the most of it! For these girls, having of Mithril, Sousuke faces his own internal mechanoid alien Zonders. Gai Shishio is fun is priority number one. Right from the OVA: LYRICS OF LOVE 14+ • #FUN08198 • 320 mins • $37.48 meets Nagi Sanzenin, the sole heir to the vast FAMILIAR OF ZERO sent by the UN alien defense force “3G” Sanzenin fortune, and through a bizarre turn struggle. Spread thin between schoolwork TV SERIES start, they’re causing trouble, meeting boys, Shuichi is a total wreck. The pressure is on In a magical land where two moons shine to defend the planet, and Mamoru also OVA: IL TEATRINO of events, Hayate is hired as Nagi’s butler. and war, the powers that be have decided STAND ALONE COMPLEX forging friendships, and making enemies - for the band’s new , but the normally in the night sky, one young student in joins. When their backs are up against the Triela pursues her targets with a ferocious Hayate quickly learns that the truly rich don’t to lighten his load... beginning with Kaname! you know, typical teenage girl behavior. energetic Shuichi has become listless and the magic school, Louise, has acquired wall, Gai Fuses with Galeon and 3G’s Gao Female cyborg Major Motoko Kusanagi enthusiasm - unwilling to settle for less live the same way as normal people. Complete Series Remastered Regular Edition and her fellow police offi cers of Section 9 Complete Series (Litebox) fallen into a writing slump. It’s all because the nickname of “Zero.” Why? Her “zero” Machines to form the indomitable King of all than total annihilation. Her mirror in this Part 1 14+ • #FUN08542 • 450 mins • $44.98 hunt down a host of criminals in both the 13+ • #AWDVD1002 • SUB ONLY • 300 mins • $14.99 Yuki has suddenly become cold and distant. talent! With a near-perfect failure rate robots: GaoGaiGar! bloody stalemate is Pinocchio, a shell of a 13+ • #AV80435 • SUB ONLY • 175 mins • $29.98 real and online worlds. In the course of Depressed, all Shuichi wants is to know for her spells, the shock that Louise’s Complete Series Blu-ray Season 1 Collection (Litebox) boy raised as an assassin by the FRF - a their work, Kusanagi and Section 9 must how to get Yuki to talk to him! But if the Part 2 summoning spell works equals the surprise 14+ • #FUN08541 • 320 mins • $52.48 7+ • #AWDVD1003 • 625 mins • $22.49 terrorist faction at war with the SWA. Cold do everything from resolving hostage crises band doesn’t manage to break him out of and cruelly effi cient, he wields sharpened 13+ • #AV80436 • SUB ONLY • 175 mins • $29.98 of her new familiar, a human boy from Oppressed by one corrupt ruling class after Season 2 Collection (Litebox) Released 4/27/10 to hunting down runaway state-of-the-art his slump soon, it could mean the end of steel as though it were his own hand. Part 3 Japan! When the boy begins exhibiting FULLMETAL ALCHEMIST another, the People’s Army rises up to begin 7+ • #AWDVD1017 • N/A mins • $22.49 killing machines. Bad Luck! Once human, these shattered souls have 13+ • #AV80437 • SUB ONLY • 175 mins • $29.98 some unexpected abilities, why do the their march toward freedom led by the become murderous machines with only Part 4 teachers get so nervous? Season 1 Anime Legends Box Set heroic Michel Volban. In the stars he looks 16+ • #RSDVD8044 • 60 mins • $22.49 GENSHIKEN vague recollections of what it meant to be 13+ • #AV80438 • SUB ONLY • 175 mins • $29.98 Complete Series 1 13+ • #ME25268 • 780 mins • $37.48 for hope in the visage of a sleek battleship 13+ • #GN08695 • 300 mins • $29.99 TV SERIES Season 2: 2nd Gig Anime Legends Box Set bearing the crest of the fallen royal family! GREEN GREEN SERIES 1 13+ • #ME25269 • 660 mins • $37.48 Piloted by the enigmatic Cleo and his rogue crew of pirates, can this truly be the “hero” TV SERIES It’s Sasahara’s fi rst day of college, and a GHOST STORIES for who all have waited? In ages past, a man and a woman tasted fateful choice awaits him. Which college forbidden love. Even though they could not TV SERIES Box Set clubs will he choose to join? But Sasahara When nearby construction disturbs a spiritual be together, they made a vow that would LEGENDS OF THE DARK KINGS 13+ • #FUN07907 • 600 mins • $44.98 is no ordinary young man; a dark secret resting place, its disgruntled denizens do transcend time. In modern day, Yuusuke, a Spin-off of the original series. In the lurks within his soul. For one thing, he what any supernatural being would do after student at the Kanenone all-boys academy, wastelands following the great nuclear SSTAFFTAFF knows what “” is, and he’d like to a rude awakening: they terrorize the local is one of the reincarnated lovers. When an war, a legend grew of a man: “Hokuto No know more. He’s heard of doujinshi, and PPICKICK school. And that means it’s up to a scruffy TV SERIES all-girls class is transferred to the school for Ken,” the Fist of the North Star, master of he... needs to know more. Enter Genshiken, band of young ghostbusters to expel their a summer session, could one of them be his a legendary fi ghting technique. A man of the barely legitimized Society for the Study satanic schoolmates before everyone gets 2005 SERIES past romance? impossible strength and endurance. Yet TV SERIES of Modern Visual Culture, home to all sent to permanent detention! Thirteen-year-old Maya Kitajima seems before Ken claimed the title of the Fist, subspecies of otaku! Litebox Set BROTHERHOOD Complete Collection destined to spend the rest of her life toiling 16+ • #AWDVD0951 • 300 mins • $14.99 there was another master, trained in the art Economy Set in a crowded restaurant when her incredible of Hokuto Shinken, the King of the Fist, the A re-telling of the manga storyline. Edward 14+ • #DGHSBX1 • 550 mins • $37.48 and Alphonse Elric’s disregard for alchemy’s 13+ • #AWDVD0707 • 350 mins • $29.96 acting talent is discovered by the legendary Divine Fist of Heaven. Raoh: the ultimate diva Chigusa Tsukikage. Ayumi Himekawa’s , MOBILE SUIT assassin, the ultimate warrior. fundamental laws destroyed part of Ed’s SERIES 2 GIANT ROBO body and left Al’s soul clinging to a suit success has always been assured, yet she MOVIE TRILOGY Collection longs to be recognized for her own talents of armor. To restore wh-at was lost, the The Society for the Study of Modern Visual The BF Group is a secret brotherhood Universal Century 0079. Amuro Ray fi nds 17+ • #SFLDK100 • SUB ONLY • 325 mins • $29.98 and skills, not her family connections. For brothers search for the fabled Philosopher’s Culture, otherwise known as Genshiken, is whose only goal is to drive the world himself caught up in the war between the both girls, the ultimate prize is the role of Stone. The Elrics are not alone in their now under the charge of a more-confi dent towards chaos. Protecting the peace Earth Federation and the Principality of The Crimson Goddess, a part created by FULL METAL PANIC! search; the corrupt State Military is also Sasahara. Things have changed in between are the Experts of Justice, a team of Zeon. He unwillingly becomes the pilot of Chigusa and now portrayed by Ayumi’s eager to harness the artifact’s power. As the semesters, and the otaku club now has a operatives assembled from around the a prototype Mobile Suit called the Gundam. TV SERIES mother. But for one to win, the other Elrics fi nd their course altered by enemies new otaku-hating member named Ogiue. globe to stop the ultimate disaster of the Now he and the crew of the White Base will must fail! SEASON 1 and allies, their purpose remains unchanged Sasahara’s initial goal of starting a dojin Eternal Night. The key to everything is the have to fi ght for their very lives as the enemy On the surface, Kaname Chidori appears to - and their bond unbreakable. circle and selling those fan-made magazines bravery of their newest member, a boy Collection 1 attempts to destroy this new weapon at all at the next Comic Festival becomes a named Daisaku Kusama, and the mighty be a normal, popular high school student. Part 1 Regular Edition Released 5/25/10 13+ • #SFGM100 • SUB ONLY • 650 mins • $37.48 costs. Contains all three original movies. reality, but reality is a cruel master. machine he commands. The problem is, she doesn’t realize just 14+ • #FUN08262 • 320 mins • $37.48 Anime Legends Edition Released 5/18/10 how popular she is. Unbeknownst ito her, Premium Collection Part 1 Blu-ray Released 5/25/10 Litebox Set 13+ • #AV20017 • SUB ONLY • 441 mins • $29.98 a group of terrorists believe she possesses 13+ • #AWDVD1018 • 300 mins • $44.99 14+ • #FUN08380 • 320 mins • $41.26 13+ • #AWDVD0965 • 420 mins • $14.99

Tears to Tiara © AQUAPLUS / T3WORKS. Pheonix © /NHK/WNET/NEP.

12 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 13 Vol. 5 Released 5/4/10 HIGURASHI IKKI-TOUSEN KANNAGI: CRAZY friends to stick up for him. The guy needs 13+ • #AV80439 • SUB ONLY • 150 mins • $29.98 SEE WHEN THEY CRY motivation if he hopes to graduate in one TV SERIES SHRINE MAIDENS piece. Well, Miu’s the perfect motivation. DRAGON DESTINY Nagi is a deity spirit of the town of Kannagi, She’s hot, she accepts him, and she just so Once again blood fl ows in the streets of and she was able to take a physical form happens to live at a dojo with six martial arts Teenage millionaire Yoshikata lives on his HINOTORI Kanto. The eternal fate that has been handed when Jin Mikuriya carved a wooden statue masters. You could say fate has led Kenichi own in a magnifi cent mansion, and, having SEE PHOENIX down for over 1800 years is now being of her. Nagi’s mission is to cleanse the to their door, or you could say he was just fi red the original maids, needs help keeping following the hottie. Either way, he’s about fought by ancient warriors who have been impurities that plague the land, but since DVD & BLU-RAY up the place. Enter Izumi and , two reincarnated into the students of the seven her sacred tree has been cut down, she can to get whipped into serious shape. girls of Yoshikata’s age, who accept his offer top schools. Hakufu Sonsaku arrives on the only do this with Jin’s help. The only way for Season 1 Complete Set Released 5/25/10 to fi ll in as live-in maids. Along with Anna, HIS AND HER scene and is rumored to be the legendary Nagi to regain her power is to gather her 13+ • #FUN08254 • 600 mins • $44.98 another maid, the three girls live with the CIRCUMSTANCES warrior Shou-Haou. But can this blonde own followers and gain popularity. eccentric Yoshitaka in this goofball comedy. Season 2 Part 1 Like a drug, Yukino Miyazawa was addicted airhead with the overly-endowed assets Complete Collection 13+ • #FUN08252 • 325 mins • $37.48 Complete Collection to admiration and praise from those around actually be the legendary Shou-Haou? 13+ • #AV26313 • SUB ONLY • 350 mins • $44.98 Season 2 Part 2 Released 5/25/10 14+ • #SFHMM100 • SUB ONLY • 300 mins • $29.98 her. She worked hard to become the perfect Vol. 1 13+ • #FUN08253 • 280 mins • $37.48 student - the perfect girl. But that was 16+ • #AWDVD0857 • 100 mins • $22.49 GUY J before... him. Souichirou Arima. The instant she met him, she hated him. Without even Vol. 2 KIBA Android J was secretly built by the 16+ • #AWDVD0985 • 100 mins • $22.49 SEE DESTINY OF THE trying, he snatched the very glory from her In a dystopian future, two friends dream government as a special agent to combat Vol. 3 Released 6/29/10 hands. To take back what is rightfully hers, SHRINE MAIDEN of freedom… and gain more than they crime in the oceanic city-nation of Judoh. 16+ • #AWDVD0996 • 100 mins • $22.49 Yukino is putting all her efforts into plotting bargain for! Hothead Zed is on the run from While J initially appears to be human, the her revenge - but was love part of the plan? illusion quickly disappears in clouds of the authorities, while his brainy pal, Noah, DVD & BLU-RAY DVD scorching steam when he fi ghts. Together Anime Value Collection INDIAN SUMMER KANOKON: THE GIRL struggles with his own battered body. Both with his partner, Daisuke Aurora, the most 13+ • #RSDVD0924 • 780 mins • $29.99 “She’s the perfect girl, and you can do WHO CRIED WOLF fi nd a magical world that seems to offer dangerous criminals will soon fi nd themselves ANYTHING you want with her!” That’s escape and power undreamed of - but at on the run - from the underground legend HONEY AND what the company Maid Works promises, Kouta, a country boy who lives with his what price? known as the Heat Guy! and boy, do they deliver! Unfortunately grandfather, is moving to the city to attend Complete Collection high school. Changes come with his new Complete Series for android maid Yui, her new owner isn’t 14+ • #DKB300 • 1275 mins • $44.98 home and new school, but nothing could 14+ • #FUN08340 • 650 mins • $37.48 exactly normal; he’s one of those anime fans who’s slipped way past the boundaries of have prepared the gentle young man for KIKI’S DELIVERY SERVICE normal fandom and into the realm of fanatic. girls, specifi cally a bombshell fox spirit named HELL GIRL That means Yui is forced to parade about Chizuru! As if her aggressive advances Kiki is an enterprising young girl who must According to rumor, a mysterious message in an ever-changing variety of anime and weren’t enough, he also catches the attention follow tradition to become a full-fl edged board exists, accessible only at midnight. maid costumes, while Takaya indulges in his of a frosty wolf spirit named Nozomu. witch. Venturing out with only her chatty Those who fi nd the site have the ability to deranged ! Vol. 1: Sexy Like a Fox Released 5/25/10 black cat, Jiji, Kiki fl ies off for the adventure of a lifetime. Landing in a far-off city, she sets post a grudge they harbor against someone, Complete Collection 16+ • #AWDVD1024 • 100 mins • $22.49 up a high-fl ying delivery service and begins and the Jigoku Shojo (Hell Girl) will carry out 17+ • #SFIS100 • SUB ONLY • 75 mins • $22.48 SSTAFFTAFF a wonderful experience of independence the revenge and then transport that person’s soul to hell. Of course, vengeance comes PPICKICK and responsibility as she fi nds her place in with a hefty price. Those who seek revenge INU Yuichi Aizawa used to visit his cousin Nayuki the world. must accept the fact that when they die, Yuta Takemoto has no idea what’s in store TV SERIES all the time when he was younger, but now 2-Disc Set their souls will also be taken to hell... for his life when he enrolls at a Tokyo art he can hardly remember a thing about those ALL • #786936791655 • 102 mins • $26.99 When Kagome fell down the well at the visits. And upon his return to fi nish his senior Season 1 S.A.V.E. Edition Released 6/15/10 college, but he fi nds out right away it’ll Higurashi shrine, she was transported year in high school while living with his Aunt 17+ • #FUN08609 • 635 mins • $22.48 never be dull! Love triangles form as fast as into ancient Japan, fi lled with demons, KIMBA, THE WHITE LION KNIGHT HUNTERS Part 2 Blu-ray (Eps. 5-8) Released 5/4/10 LEGENDS OF THE Akiko and his cousin, the blank spots in 13+ • #AV80484 • DUB ONLY • 100 mins • $18.74 Season 2: Two Mirrors Collection 1 Released 5/25/10 friendships when both Takemoto and senior spirits, and magical creatures! As if that DARK KINGS classmate Shinobu Morita fall hard for shy his memory have become more and more 1965 TV SERIES 14+ • #SFHG201 • SUB ONLY • 325 mins • $37.48 weren’t enough, she also woke , a worrisome. After a seven-year absence, SEE FIST OF THE artistic prodigy Hagumi Hanamoto. And handsome (but stubborn) dog-demon. Now Kimba’s enchanting adventures of KYO KARA MAOH! while architecture student Takumi Mayama Yuichi makes a valiant effort to adjust to his friendship, jungle survival and harmony NORTH STAR HEROIC AGE the two are unwilling travel companions as vaguely familiar surroundings. secretly pines for an older woman, dazzling they search for the Shikon Jewel, a stone return! Join Kimba along with his pals, Pauly TV SERIES Among the ruins of a forgotten planet ceramicist Ayu Yamada pines for him! fi lled with mystical power. Complete Set S.A.V.E. Edition the Parrot, Daniel Baboon, and a charming When Shibuya decides to take a stand 13+ • #AR09732 • 580 mins • $22.48 assortment of other lovable characters, as against some local bullies, they decide to lies the salvation of the Tribe of Iron, also Box Set 1 (Eps. 1-12) Season 1 Box Set (Eps. 1-27) he follows in the footsteps of his late father, dunk him in a toilet, and he fi nds himself known as humankind. This lost warrior will 16+ • #782009239727 • 300 mins • $44.92 13+ • #DIYBS01 • 675 mins • $37.46 the great lion king, making the jungle a safer, sucked into another world where he’s told Kouichi dreams of being a hero, but in stand against the tyranny of the Tribe of Box Set 2 (Eps. 13-24) Season 7 Box Set (Eps. 147-167) better place for everyone to live. First aired he’s the new “Maoh” (Demon King)! While reality he’s a punching bag for every bully Silver, who proclaimed themselves the new 16+ • #782009239772 • 300 mins • $44.92 SEE dominant race after the departure of the 13+ • #DIYBS07 • 500 mins • $37.46 in 1965, Kimba is known worldwide as one Yuri’s convinced that they must have got it on the block. His life fl atlines when the Box Set 3 HIS AND HER advanced Tribe of Gold. Humanity’s last More volumes also available! of Osamu Tezuka’s greatest masterpieces. SSTAFFTAFF wrong, he’s also managed to get himself mysteriously naked Emi crash lands on 16+ • #782009240815 • 270 mins • $44.92 hope is a wild and unruly hero, “Age,” and CIRCUMSTANCES Each episode is masterfully restored and PPICKICK into big trouble - part of his staff wants to his pitiful existence, thrusting Kouichi into an ancient prophecy. presented in order according to Osamu date him, part of them hate him, the ex- the middle of an intergalactic showdown. Tezuka’s original storyline. queen just plain wants him, and, thanks to Through his death-bed partnership with Complete Series Regular Edition Released 6/22/10 HUNTER HUNTER IRRESPONSIBLE When the moon rises, the four young men local customs, Yuri has even managed to the Linebarrel , Kouichi gains the 13+ • #FUN08683 • 635 mins • $44.98 Hunters are a special breed, dedicated to KARIN Mini Collection 1 (Eps. 1-25) of Weiss become the most vicious assassins CAPTAIN TYLOR ALL • #RSDVD0716 • DUB ONLY • 550 mins • $37.49 get himself engaged to another guy! strength to crush the alien invasion force Complete Series Blu-ray tracking down treasure, magical beasts, Karin Maaka leads an ordinary life in spite the world has seen. During the day, they that’s determined to conquer Earth. But all SEE TYLOR, Ultra Box Set Limited Edition (Eps. 1-52) Season 1 Box Set 13+ • #FUN08682 • 635 mins • $44.98 and even humans. But such pursuits of the fact that she is from a family of remain disguised as elegant fl orists with an this newfound power and special attention IRRESPONSIBLE CAPTAIN ALL • #RSDVD2012 • DUB ONLY • 1345 mins • $97.49 13+ • #GN08665 • 975 mins • $37.49 require a license, and less than one in a vampires. Unlike the rest of her family, she eye for beauty. Led by the somber Aya, the from nearly naked babes is turning Kouichi hundred thousand can pass the grueling has no problem with bright lights, sleeps in team consists of Ken, a former athlete, Omi, Season 2 Box Set into a jerk! qualifi cation exam. Despite his aunt’s a bed instead of a coffi n, and loves to eat a computer specialist, and Yoji, a suave 13+ • #GN08664 • 975 mins • $37.49 JING, KING OF BANDITS Part 1 TV SERIES protest, decides to follow in his father’s garlic. She is such an abnormal vampire that ladies man. When a rival assassin group JUNJO ROMANTICA OVA 17+ • #FUN09910 • 300 mins • $37.48 For years, Yuno’s dreamed of attending footsteps and become a legendary Hunter. she doesn’t even suck blood - she makes it! replaces a young woman’s love with one of LE CHEVALIER D’EON Yamabuki Arts High School, but now that The journey begins on the long, arduous Everything begins to unravel when she gets SEVENTH HEAVEN their own, the boys of Weiss come forth to she’s been accepted, it means the scary road to the Exam Hall, where he meets uncontrollable urges every time she gets They call it Seventh Heaven: an asylum of hunt the evil men and women of this world. Paris, 1742. A coffi n fl oats in the shimmering LIVING FOR THE DAY Seine. On the lid, a word written in blood: prospect of moving away from her home Leorio and Kurapika, two applicants with near her classmate, Kenta Usui. a prison roasting on the lowest ring of Hell. Complete Set (Seasons 1-2) (Litebox) Psalms. Inside, the body of a beautiful AFTER TOMORROW and family for the fi rst time! Fortunately, Yuno the same determination. Run by a psychotic warden and his army 13+ • #AWDVD0947 • 975 mins • $44.99 Complete Series Viridian Collection woman: Lia de Beaumont. Now her brother, quickly learns that if her new neighbors at Set 1 (Eps. 1-15) of hockey-masked guards, it’s a festering pit A magic wishing stone inexplicably grants 13+ • #GN08741 • 580 mins • $37.48 D’Eon, seeks the reason for her mysterious the eclectic Hidamari (Sunshine) Apartments 16+ • #DHXH01 • 300 mins • $37.46 fi lled with thousands of hardened criminals... Karada’s wish to be older - and does it by murder and uncovers an evil that shadows stealing the years from Shoko! Now Shoko, aren’t technically family, at least the majority Set 4 (Eps. 47-62) plus one very unfortunate Bandit King and KUJIBIKI UNBALANCE share the bond of being fellow art students. his loyal, feathered sidekick! And as if that both the palaces of kings and the dark who’s already graduated and studied 16+ • #782009239895 • 350 mins • $37.46 SEE GENSHIKEN alleys of Europe. overseas, is Karada’s age, just about to Season 1 Collection Kazuma is a descendent of an ancient clan didn’t suck enough for our heroes, toss in More volumes also available! Complete Collection enter junior high school. Meanwhile Karada 13+ • #SFHS100 • SUB ONLY • 350 mins • $29.98 skilled in the magical fi re arts. Unfortunately a magician who uses stolen dreams to trap SSTAFFTAFF for him, the gift seems to have skipped a his victims in bizarre worlds of illusion, who 14+ • #AR09698 • 600 mins • $37.48 must suddenly face the real facts about Season 2: x 365 Complete Collection PPICKICK generation. Defeated by his younger, female then sets his beady eyes on Jing and Kir! what being grown up entails. And just 13+ • #SFHS200 • SUB ONLY • 400 mins • $29.98 KUROKAMI: cousin, Ayano, in a battle to become the to make a bizarre situation even more 13+ • #AR06795 • 90 mins • $7.48 THE ANIMATION LE PORTRAIT DE PETITE awkward, there’s the issue of how to handle Three very different couples caught up in a clan’s successor, Kazuma is exiled with only the smoldering burn of failure to keep him Keita is a high school student living on COSSETTE their existing romantic interests! storm of pure romance! Romantica: Misaki KINO’S JOURNEY is struggling to prepare for his college company. But now he’s back, risen from his own who lost his mother in his youth. Eiri Kurahashi is shocked when he sees the Complete Collection entrance exams, so his brother arranges for the ashes and armed with a powerful new Kino is a traveler with a heavy past. Going One night at a ramen stand, he meets a living image of Cossette d’Auvergne in a 13+ • #SFANH100 • SUB ONLY • 300 mins • $29.98 a private tutor. But Misaki’s nightmare is just mojo that’s sure to fan the fl ames of the from country to country, Kino explores what mysterious girl named Kuro. Keita is told the glass in his uncle’s antique shop. Infatuated, beginning when his tutor, Usami, comes on family rivalry. each has to offer; however, the world is story of how if a person runs into another he becomes possessed and mysteriously to him! Egoist: Just when Kamijou’s life is at Season 1 Part 1 not well suited to travelers. Each country that looks just like them, they will die. From makes contact with the beautiful young Millie Nocturne has one goal in life: to be Got Anime members its lowest, he has a chance meeting with a 14+ • #FUN08350 • 288 mins • $44.98 has its own customs, some of which can Kuro, Keita learns of the Doppeliner System aristocrat only to learn that she was the best in the universe - at everything! man who never lets anything hold him back: be unusual, some amusing... and some and the Coexistence Equilibrium and how murdered 250 years earlier. Now, her soul save an extra 10% OFF Season 1 Part 2 But when she tries her hand at being the Nowaki. Terrorist: Miyagi always seems to even horrifying. Kino’s only companion is his life would never be that same afterward... trapped inside the goblet, she can only be 14+ • #FUN08351 • 360 mins • $44.98 “best detective,” she ends up an unwilling our everyday prices, shrug off the cares of the world with a joke a motorcycle named Hermes who seems Part 1 Regular Edition (Eps. 1-6) set free if someone is willing to pay for the partner to two people who will change and a smile, but even he has problems. to be alive. What awaits them out in the 13+ • #AV80478 • 150 mins • $22.48 sins of her murderer, the artist Marcelo... studio sales & more! her life forever: Kain Blueriver, the psi- Foremost is Shinobu, who’s adamant that KENICHI: THE mysterious, beautiful, and dangerous world? who may very well have been reincarnated Part 1 Blu-ray (Eps. 1-4) blade-wielding master of the starship they’re destined to be together. as Eiri! MIGHTIEST DISCIPLE Complete Collection 13+ • #AV80483 • DUB ONLY • 100 mins • $18.74 Swordbreaker, and Canal, the smart- Season 1 Collection Released 5/4/10 Kenichi’s a total wimp. He’s always getting 13+ • #DKJ100 • 325 mins • $29.98 Part 2 Regular Edition (Eps. 7-12) Released 5/4/10 Released 4/20/10 mouthed ship’s computer. Join them as 17+ • #RSDVD1018 • SUB ONLY • 300 mins • $37.49 picked on and doesn’t have a lot of 13+ • #AV80479 • 150 mins • $22.48 14+ • #SFLPC001 • 120 mins • $14.98 they hurtle through space facing off against

One Piece © 1999 , Co., Ltd., Japan.

14 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 15 tries to collect the seeds for a far more Season 3: OVA Complete Collection dangerous purpose! 13+ • #RSDVD0901 • SUB ONLY • 255 mins • $29.99 Complete Set Season 4 Complete Collection Released 6/1/10 13+ • #GN08697 • 320 mins • $29.98 13+ • #RSDVD1022 • SUB ONLY • 325 mins • $37.49 MAGIC KNIGHT MARTIAN SUCCESSOR

RAYEARTH DVD & BLU-RAY NADESICO TV SERIES SEE NADESICO When three girls hear a voice asking them to save a world called Cephiro, their adventure is only beginning. The voice belongs to Princess Emeraude, who has been MD GEIST imprisoned, and monsters are beginning to Classifi ed as too unstable, the genetically invade the land. With her last bit of strength, engineered soldier, Geist-02, was the princess summons forth these three imprisoned aboard an orbital . girls destined to become the Magic Knights When the men that created him unleash a in the hopes of saving her world! doomsday device that will destroy all life, Season 1 Remastered Released 4/27/10 Geist-02 must return to save the world that 13+ • #AWDVD0926 • 500 mins • $29.99 tried to destroy him! 14+ • #DMDG001 • 91 mins • $11.24

DVD & BLU-RAY DVD MAGICAL SHOPPING ARCADE ABENOBASHI MELANCHOLY OF “Bein’ human, havin’ your health... that’s HARUHI SUZUMIYA the most important thing.” Try telling that “I thought that when I entered high school, to 12-year-old Sasshi Imamiya. He’s lost my days of believing in aliens, time travelers his home, he’s lost the toy collection that and ESPers were going to be over. That was defi ned his very geekdom, and he’s about to until she introduced herself. Claiming to be lose his best friend, Arumi. Reality is closing interested in only aliens, time travelers, and in on him. That is, until reality decides to ESPers, Haruhi Suzumiya was the strangest take a vacation. An extended vacation. girl I’d met in a long time…” Complete Collection Complete Collection 17+ • #DMSS100 • 325 mins • $37.48 13+ • #AV20846 • 350 mins • $44.98 MEZZO Haruo Yoshikawa was your run-of-the-mill Meet the Danger Service Agency (DSA), a middle school student: great attendance high-risk trio that pays the bills by putting record and three adorable, loving sisters. their lives on the line. Ducking bullets and Normal, right? Wrong. Haruo and his sisters dodging punches, the trio fi nd themselves are, by blood, magic-users. However, Haruo working for a friendly ghost and a foxy is seemingly unaware of his powers. So his weathergirl, helping old friends and hunting three witch sisters - Maika, Chiaki, and down an extraterrestrial. Whether you’re Fuyono - keep him in the dark in the hopes looking to run recon on a cheating spouse that he’ll live a normal life. And they’ve or smuggle a deadly virus, if the job reeks of succeeded... until now! danger, there’s only one team to call. Complete Set S.A.V.E. Edition Released 7/13/10 Complete Collection (Thinpak) 14+ • #AR08616 • 325 mins • $14.98 17+ • #DMFBX3 • 325 mins • $29.98 intergalactic crime lords, rogue starships, the unexplored in questioning the ordinary! : and hijackers dressed as chickens... and Anime Legends Complete Collection that’s just the tip of the asteroid! AUTOMATIC MAIDEN 13+ • #AV80307 • 600 mins • $37.48 SEE GUNDAM Box Set (Thinpak) Troubles you can only dream of... Suguru’s 13+ • #RSDVD0722 • 650 mins • $37.49 OVA horrible cleaning skills have his friends calling Kagami and Tsukasa join Konata and Ms. his home the “haunted house,” and being Kuroi in the virtual world of an online role an orphan, he needs help! Enter Mahoro, MONSTER playing game, and we get to witness, a beautiful 19-year old who catches bullets What would you do if a child you saved Attempting to fulfi ll a promise to his childhood fi rsthand, the newbie experience in an in her fi ngers, claims to be an android, and grew up to be a monster? Tenma, a brilliant sweetheart, Keitaro Urashima is determined MMORPG. Am I dreaming or is that really wants to be his maid! neurosurgeon, risks his career to save the to enter Tokyo University. After being rejected Kagami cosplaying as Miku Hatsune?! Full Metal Maid Collection (Seasons 1-2) life of a critically wounded young boy named twice, he decides to leave home and stay If that and the surreal frog scene are just 17+ • #SFMH300 • 700 mins • $37.48 Johan. When the boy reappears years at his grandmother’s apartment complex to too weird for you, the girls also do some later in the midst of a string of unusual study. But when he arrives, his grandmother common everyday stuff, like play volleyball serial murders, Tenma must go on the run is gone, and he fi nds himself under attack by MARIA-HOLIC and go camping. from the police to fi nd Johan and stop the the all-female residents. 13+ • #AV80308 • SUB ONLY • 43 mins • $11.24 It’s not easy to fi nd the perfect girl, even monster he set loose upon the world. Complete Set Viridian Collection Released 7/27/10 when you’re the same sex! Kanako thought Box Set 1 16+ • #FUN09586 • 600 mins • $29.98 attending an all-girls school would be the 17+ • #782009239802 • 325 mins • $44.92 LUPIN THE 3RD perfect way to meet the girl of her dreams, SPECIALS but after her hot new roommate turns out to EPISODE 0: FIRST CONTACT be a guy in drag and catching the eye of the MORIBITO: GUARDIAN Ritsuka’s innocent childhood days came to most popular girl in school only brings down OF THE SPIRIT a bloody end when he lost the one person Lupin is after mafi a boss Galvez’s single the wrath of all the other similarly obsessed who understood him. His brother Seimei most precious treasure: a treasure within girls, she’s not so sure! Prince Chagum has the power to stave was always his guiding star, and without a treasure! Jigen is Galvez’s hired gun off the drought and bring new life to his Complete Collection him, Ritsuka was lost. The enigmatic Sobi who fails to kill cat-burglar Lupin in his fi rst empire. However, this is a suspicious time, 14+ • #SFMHC100 • SUB ONLY • 300 mins • $29.98 appears to change all that. Sobi was once attempt on the treasure and seeks revenge. and he is accused of possession by an evil partners with Seimei, a sacrifi ce who gave Fujiko is the girlfriend of Lupin’s rival, Brad. spirit. Court advisors only see one solution: his energy so Sobi could fi ght. Now Sobi Zenigata travels from Japan to America to MARIA WATCHES Chagum must be put to death by his own has come looking for a new partner, will fi nd and arrest Fujiko. Goemon seeks the OVER US father’s hand. Balsa is a spear woman and Ritsuka fi nd happiness chained to Sobi? almighty sword that cuts steel, Zantetsuken. mercenary. Her skills are legendary, and she Complete Collection After a series of twists and turns, these When Yumi Fukuzawa entered the Lillian is held by a mysterious vow to save eight 13+ • #AWDVD0962 • 300 mins • $14.99 complete strangers become acquainted in Girls’ Academy, a prestigious all-girls souls. Can she fend off an entire empire and their “First Contact”! Catholic school in Tokyo, she never make Chagum her eighth soul? imagined she would catch the eye of N/R • #ES011 • SUB ONLY • 92 mins • $18.71 Premium Box Released 6/1/10 beautiful and demure Sachiko Ogasawara, 13+ • #AWDVD1034 • 650 mins • $97.49 TV SERIES one of the school’s most popular students. LYRICAL NANOHA Now Sachiko has offered to be Yumi’s soeur Meet Konata, an athletic and intelligent girl - her “sister” - and guide for all her years too dedicated to her favorite primetime TV SERIES at the academy. The whole idea has Yumi anime shows to excel in anything but otaku Twenty-year-old Sorata is an art instructor ORIGINAL SERIES completely fl ustered - after all, they hardly culture; , the cute & bespectacled at Yamanoue School. Usually he’s a mousy, The Jewel Seeds, artifacts from an ancient know each other! living example of moe; Kagami, the tough nerdy teacher, but Sorata has a secret: magical civilization, have been spread but shy straight-man; and her younger Season 1 Complete Collection he’s also the internationally infamous thief across the galaxy. Nanoha Takamachi fraternal twin sister, Tsukasa, a kind but 13+ • #RSDVD0815 • SUB ONLY • 325 mins • $37.49 Mouse, and he’s a shameless fl irt to boot! becomes Lyrical Girl Nanoha to seal the air-headed klutz. Witness this study in the Jewel Seeds and protect the Earth, but Season 2: Printemps Complete Collection Complete Collection (Litebox) human condition as our heroines explore another girl appears, who desperately 13+ • #RSDVD0816 • SUB ONLY • 325 mins • $37.49 16+ • #AWDVD0948 • 180 mins • $14.99

Skull Man © 2007 / THE SKULLMAN PROJECT.

16 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 17 MUSHI-SHI power dwells within apathetic Miharu, a fact prankster will do what it takes to achieve his NIGHTHEAD GENESIS academy as Mizuho’s mother. The catch is soar. Now an introverted teenager, Miu has the guy really couldn’t care less about - until life-long goal to become the next Hokage! it’s an all-girls school. With the help of friend become too shy to express her feelings Between this world and the next, there Due to their paranormal abilities, two young the clashing rival clans bring their battle to Season 1 Box Set 1 (Eps. 1-25) Mariya, however, he gets a makeover good - even through her music. When Miu is a point where it becomes impossible brothers, Naoto and Naoya, are cast out by him. Now Miharu struggles to understand 16+ • #782009240242 • 650 mins • $29.98 enough to fool everyone at the academy. develops a crush on a classmate, her piano to distinguish between plant and animal, their parents and given into the custody of the mystery buried in his soul and must Complete Collection teacher, the moody Mr. Shirakawa, notices between life and death. This is where you Season 1 Box Set 2 (Eps. 26-52) a research center. They escape fi fteen years choose a side if he hopes to survive. 16+ • #AWDVD0961 • SUB ONLY • 325 mins • $22.49 a sudden and remarkable change in Miu’s will fi nd the mushi. Neither good nor evil, 16+ • #782009241003 • 650 mins • $29.98 later, and soon learn that they will play a Complete Series Part 1 playing. Can he help her rediscover the joy they are life in its purest form. An unseen Season 2 Box Set 1 (Eps. 53-78) pivotal role in the coming “Upheaval.” of the piano and fi nd the courage to share 14+ • #FUN09980 • 325 mins • $44.98 DVD & BLU-RAY river reshaping the path of man, through 16+ • #782009241263 • 650 mins • $29.98 Complete Collection (Litebox) OTOGI ZOSHI her heart and music once more? their very presence we are changed. Vulgar Complete Series Part 2 Season 2 Box Set 2 (Eps. 79-106) Released 4/27/10 13+ • #AWDVD0990 • SUB ONLY • 600 mins • $29.99 At the peak of the Heian Era, famine and Bundle (Vols. 1-3) and strange, they have inspired fear in 14+ • #FUN09981 • 325 mins • $44.98 16+ • #782009241270 • 650 mins • $29.98 disease tear the country apart, deadly 7+ • #RSDVD1010 • 240 mins • $14.99 humans since the dawn of time and have assassins fi ll the court, and wild bandits come to be known as “mushi.” NADESICO, More volumes also available! NINJA NONSENSE infest the countryside. The legendary PLACE PROMISED IN Complete Set Viridian Collection Released 7/9/10 MARTIAN SUCCESSOR SHIPPUDEN samurai Minamoto is sent on a quest for 14+ • #FUN05112 • 625 mins • $29.98 After two and a half years of training on the an artifact that can restore the world, but OUR EARLY DAYS The aliens have destroyed our base on his skill cannot save him from illness and Mars, wiped out our space fl eets, and now road, is back in the Village Hidden in In 1996, an enormous tower is constructed MY BRIDE IS A MERMAID the Leaves and he’s ready to show off his his young sister is forced to take his place. on the southern shore of Hokkaido, its only one ship stands between Earth and Hikaru Minamoto and her companions Season 1 Part 1 Released 7/20/10 new skills. He and Sakura team up to take purpose unknown. Curious, three school total annihilation! But due to the shortage embark on a quest to fi nd the Magatama. 14+ • #FUN09970 • 300 mins • $37.48 of trained soldiers, they’ve had to assemble on their old master , who’s pretty children make a vow to discover the the most unorthodox crew to ever launch impressed with their progress. They’ll have Collection of Ages (Eps. 1-26) Released 4/20/10 mysterious tower’s secrets. Will this promise MY-HIME into orbit. The crew must win their fi rst plenty of opportunity to put it into action 13+ • #AWDVD0865 • 650 mins • $29.99 have to be left unfulfi lled when one of the victory against their own species as they when news arrives from the Sand Village three falls into a coma? DVD & BLU-RAY DVD TV SERIES fi ght off a ruthless attempt by Earth’s military that , Naruto’s former rival and now OURAN HIGH SCHOOL Kazekage of the Sand, has been kidnapped! SSTAFFTAFF 13+ • #DTPP001 • 90 mins • $22.48 MY-OTOME to seize the Nadesico! PPICKICK HOST CLUB Spin off of MY-HiME! For Arika Yumemiya, Perfect Collection (Thinpak) Box Set 1 (Vol. 1-3) POKEMON the dream of becoming a Meister Otome 14+ • #DNDBX1 • 650 mins • $37.48 16+ • #782009239956 • 325 mins • $37.46 The Host Club is now open! After accidently has brought her through the desert to the Box Set 1 (Vol. 1-3) Special Edition Take one totally cute (and naive) ninja- breaking an expensive vase, Haruhi TV SERIES Windbloom Kingdom, where she hopes 16+ • #782009241027 • 325 mins • $52.48 girl trainee, add a ninja horde under the suddenly becomes indebted to the school’s DIAMOND AND PEARL: BATTLE DIMENSION weirdest headmaster ever - a strange, elite Host Club. The only way to pay for the to train at the prestigious Garderobe Box Set 2 (Vol. 4-6) Released 4/20/10 Ash, Dawn, and Brock continue their Two girls with the same name leave their yellow, spherical, pudgy... creature... named damage? She’ll have to work as a host! The Academy. However, gaining admittance 16+ • #782009240006 • N/A mins • $37.46 journey through the Sinnoh region, with Ash old lives behind and come to Tokyo to start Onsokumaru - and you get the craziest, only problem? Haruhi is a she, and the Host to the academy won’t be as easy as she Box Set 2 (Vol. 4-6) Special Edition Released 4/20/10 working on his next two Gym badges and fresh. Nana Osaki wants nothing more than most hilarious anime show ever invented! Club is composed of all boys! thinks it is. 16+ • #782009241034 • N/A mins • $52.48 Dawn striving to break her recent string of to make it big as the singer of a rock ‘n’ roll Anime Legends Complete Collection Collection (Thinpak) Released 6/1/10 Complete Set Regular Edition defeats. Some new Pokémon have joined band, while Nana Komatsu wants to put her Vol. 7 13+ • #AV20757 • 650 mins • $37.48 15+ • #RSDVD1025 • 320 mins • $37.49 14+ • #FUN09532 • 625 mins • $52.48 the team - including Paul’s traumatized life in motion and get her new relationship 16+ • #782009239970 • 100 mins • $18.69 Complete Set Blu-ray Chimchar - challenging the depths of our off to a good start. When the two Nanas Vol. 8 14+ • #FUN09533 • 625 mins • $52.48 heroes’ Pokémon knowledge. fall in love with the same apartment, they 16+ • #782009239994 • N/A mins • $18.69 NOW AND THEN, become roommates and then best friends, HERE AND THERE Box 1 (Vol. 1-2) SEE TOTORO and the party has just begun! MOVIES ALL • #DPMDPBDBS01 • DUB ONLY • 340 mins • $18.69 NARUTO: SHIPPUDEN THE MOVIE Dragged through a time warp by a strange Box Set 1 (Eps. 1-11.5) machine, Shu is thrust into a hellish future Momo Adachi, a high school teen, is best Box 2 (Vol. 3-4) 17+ • #DNNBS01 • 268 mins • $44.92 A powerful spirit that once threatened to as it explodes into war! Surrounded by known for her tan skin and bleached hair. ALL • #782009240846 • DUB ONLY • 340 mins • $18.69 Box Set 2 (Eps. 12-22) destroy the world is back! Naruto’s mission fi erce warriors, enslaved innocents, and Misjudged by her classmates as a wild party Box 3 (Vol. 5-6) 17+ • #782009239765 • 268 mins • $44.92 is to protect a priestess named Shion, who enigmatic wanderers, Shu faces the ultimate girl, Momo is a modest, lonely girl, whose ALL • #782009240853 • DUB ONLY • 340 mins • $18.69 is the only one with the power to seal away challenge of survival in a world gone mad! skin and hair are a direct result of her long Box Set 3 (Eps. 23-34) the monster. She also has the uncanny hours on the swim team. Struggling to fi t ELEMENTS 17+ • #782009239826 • 270 mins • $44.92 Complete Collection ability to predict someone’s fate. Her latest into her new school, Momo fi nds herself Following the Pokémon All Star series, 14+ • #DNTH100 • 325 mins • $22.48 Box Set 4 (Eps. 35-47) prediction: Naruto will soon die. Naruto’s befriended by a backstabber, pursued by a Pokémon Elements consists of the most 17+ • #782009239918 • 270 mins • $44.92 only hope is to abandon Shion, but that’s playboy, and seemingly unable to catch the important episodes commemorating the not Naruto’s style. He decides to face her ONE PIECE eye of the guy she’s crushed on for years. different types of Pokémon. Each disc NARUTO fatal prediction head-on - and die! TV SERIES UNCUT Complete Set S.A.V.E. Edition Released 7/20/10 showcases a Pokémon element with three classic episodes. TV SERIES UNCUT 16+ • #782009239840 • 94 mins • $18.69 As the Pirate King Gold Roger was executed, 13+ • #FUN05211 • 550 mins • $22.49 Vol. 1: Grass ORIGINAL SERIES he revealed that his treasure, known as sorcerer, forces her to return to her home life of the mansion’s resident, who turns out “One Piece,” was hidden somewhere on SHOP OF HORRORS ALL • #DPMEL01 • DUB ONLY • 60 mins • $7.48 SSTAFFTAFF Deep within the Hidden Leaf Village, sharp NEGIMA in the sea. But Ponyo’s desire to be human to be a princess of the monster kingdom - the Grand Line. Monkey D. Luffy dreams Vol. 2: Fire and cunning ninja possess amazing talents Welcome to the most magnifi cent pet shop in upsets the delicate balance of nature and and his new master. PPICKICK TV SERIES of fi nding the legendary treasure and ALL • #DPMEL02 • DUB ONLY • 60 mins • $7.48 and powers, and Naruto carries an Chinatown! Operated by the shadowy Count triggers a gigantic storm. Only Ponyo’s NEGIMA! becoming the Pirate King, and after eating Collection 1 amazing secret. Twelve years ago, the fourth D, the shop specializes in rare and hard-to- Vol. 3: Water mother, a beautiful sea goddess, can In the shadows of this modern world, the devil’s fruit, he gains the power to do so. 13+ • #SFPR100 • SUB ONLY • 325 mins • $29.98 Hokage sacrifi ced himself to save the village Vampires, robots, sorcery - and that’s all come-by pets... but with each sale comes ALL • #782009240174 • DUB ONLY • 60 mins • $7.48 restore nature’s balance and make Ponyo’s fi ght for control of an ancient technique But fi rst, he must fi nd a crew. Collection 2 by sealing the Nine-Tailed Fox Spirit inside before gym class! Wizard-in-training Negi a contract. If that contract is broken, watch Vol. 4: Electric dreams come true. which holds untold strength. This coveted 13+ • #SFPR200 • SUB ONLY • 325 mins • $29.98 this orphaned newborn. Now this plucky Springfi eld is only ten years old, but he also Season 1 Part 1 (Eps. 1-13) out! Detective Orcott has linked many odd ALL • #782009240181 • DUB ONLY • 60 mins • $7.48 happens to be the newest English teacher 2-Disc Set Regular Edition 14+ • #FUN09581 • 312 mins • $37.48 and unexplainable deaths to Count D’s shop. Vol. 5: Ice at the all-girl Mahora Academy. Too bad a ALL • #786936791754 • 90 mins • $26.99 Season 2 Part 2 (Eps. 67-78) Will he solve the mystery or fall prey to it? ALL • #782009240198 • DUB ONLY • 60 mins • $7.48 PRINCESS TUTU bachelor’s degree and an enchanted staff Blu-ray 14+ • #FUN09575 • 320 mins • $37.48 can’t prepare a lad for the chaos of being Complete Collection Vol. 6: Dark ALL • #786936791761 • 90 mins • $35.99 A girl named Duck falls in love with a prince. surrounded by dozens of junior high girls! Season 2 Part 3 (Eps. 79-91) 14+ • #SFPH100 • 100 mins • $18.74 ALL • #782009240204 • DUB ONLY • 60 mins • $7.48 One day, a bizarre old man emerges and 14+ • #FUN09576 • 320 mins • $37.48 gives her a magical pendant that transforms Complete Series Viridian Collection Vol. 7: Psychic Season 2 Part 4 (Eps. 92-103) PETITE PRINCESS YUCIE ALL • #782009240211 • DUB ONLY • 60 mins • $7.48 her into the waltzing Princess Tutu. Now she 13+ • #FUN07776 • 630 mins • $29.98 Take one mysterious interdimensional- must choose - for those who accept their 14+ • #FUN09577 • 320 mins • $37.48 Vol. 8: Dragon Meet Yucie, a girl under a spell. Yucie traveling house and three very odd sisters fate fi nd happiness, those who defy it, glory. NEGIMA!? Season 2 Part 5 (Eps. 104-116) wants to be a Platinum Princess, and ALL • #782009240228 • DUB ONLY • 60 mins • $7.48 and you’ve got one very fan-service loaded Complete Collection This alternative telling of the Negima story 14+ • #FUN09578 • 320 mins • $37.48 the only way to do that is to attend the Vol. 9: Ghost comedy in the making! With no parents, 14+ • #DPTT200 • 650 mins • $33.74 follows the original Negima manga series Season 2 Part 6 (Eps. 117-130) Princess Academy. But that’s not as easy ALL • #782009240969 • DUB ONLY • 60 mins • $7.48 the eldest sister, Ai, must take care of her more closely. 14+ • #FUN09573 • 320 mins • $37.48 as it sounds. Under the guidance of Queen Vol. 10: Rock siblings - especially the youngest, Mii, who Complete Set Season 2 Part 7 Released 5/11/10 Ercell and with the unwitting help of a ALL • #782009240976 • DUB ONLY • 60 mins • $7.48 has a strange obsession with anything soft 17+ • #FUN07763 • 680 mins • $52.48 14+ • #FUN09460 • N/A mins • $37.48 schoolmate named Glenda, Yucie fi nds or squishy! In the aftermath of the Great War, Lt. Alice herself embarking on an epic quest to Season 3 Part 1 Released 7/6/10 Complete Collection Malvin takes command of the Imperial obtain the fabled Tiara of Eternity! POLYPHONICA 14+ • #FUN09461 • N/A mins • $37.48 15+ • #SFPOP100 • 300 mins • $22.48 Army’s Intelligence Section Three, an elite NEO ANGELIQUE ABYSS He’s a dashing musician who rides a More volumes also available! Complete Collection team where even the newest member Arcadia is a land under siege. Against the 13+ • #DYC102 • 650 mins • $37.48 combination motorcycle/organ. She’s an hunts down tanks with a handgun. Their horrifying creatures known as Thanatos, elder spirit who resembles a young girl, but PRINCESS PRINCESS code name: Pumpkin Scissors. Her mission: there is only one known defense: Purifi ers, ORPHEN is also known as “the Crimson Annihilator” Tooru Kouno left a sad family life to live to sharpen IS3 into a deadly instrument of rare humans gifted with the ability to PHOENIX and “the Bloody Duchess.” Together, they When the most prestigious university of at a prestigious all-boys boarding school. justice and to expose the corrupt powermad exterminate the life-draining monsters. When serve the Tsuge Divine Music Players magic in the land loses Orphen, their Throughout time, mankind has chased after From his very fi rst day, he feels like he’s nobility who prey on the weak. the mysterious Nyx discovers 16-year-old Offi ce, following the song of the open most talented student, they’ll do anything the dream of immortality. The Phoenix is fallen into another world and the boys in his Angelique, he becomes doubly committed road, orchestrating rescues and generally Complete Series S.A.V.E Edition to get him back. Unfortunately for them, said to hold the key to eternal life. Wars are class seem to be strangely interested in his to recruiting her for the team of Purifi ers he’s fi xing whatever’s baroque! They’re not 14+ • #AR09634 • 600 mins • $22.48 Orphen has bigger plans than majoring fought in attempts to possess it, and, as a pretty-boy looks. A graceful blond named organizing. Not only is Angelique a Purifi er, just musical partners, they’re professional in spell casting - namely tracking down a result, civilizations rise and fall. Phoenix is a Shihoudani fi nally reveals the school’s she’s the fi rst female Purifi er in history. troubleshooters who provide their own mysterious dragon, Bloody August. collection of stories from the past, present secret. To inspire the student body, campus QUEEN’S BLADE: Season 1 Collection and future. theme music! pretty boys are asked to dress up as girls... Complete Collection (Seasons 1-2) WANDERING WARRIOR 13+ • #SFNA100 • SUB ONLY • 325 mins • $29.98 Complete Collection (Litebox) Complete Collection and Tooru is on the list! 13+ • #SFOP100 • 1175 mins • $37.48 In a land where a queen is chosen every 13+ • #AWDVD1014 • 325 mins • $14.99 14+ • #SFPY100 • SUB ONLY • 300 mins • $29.98 Season 2: Second Age Collection Complete Collection (Litebox) few years solely by winning a tournament, 13+ • #SFNA200 • SUB ONLY • 325 mins • $29.98 13+ • #AWDVD0966 • SUB ONLY • 300 mins • $14.99 there can be no short supply of formidable OTOBOKU: MAIDENS PIANO: THE MELODY OF PONYO ARE FALLING FOR ME opponents. For one woman warrior A YOUNG GIRL’S HEART A young boy named Sosuke rescues a however, an early defeat clearly shows her NEON GENESIS that she is lacking in experience, though Mizuho can’t believe his ears when goldfi sh named Ponyo, and they embark Hiro Hiyorimi is an orphan who goes to live CLAYMORE EVANGELION Grandpa’s will is read out. Grandpa’s fi nal Miu Nomura once loved to play the piano. on a fantastic journey of friendship and she may be bountiful in body. Fortunately, As a little girl, the music made her heart with his sister Sawawa, the caretaker of a her life is saved by a powerful stranger. But SEE EVANGELION wish is for Mizuho to attend the same discovery before Ponyo’s father, a powerful creepy old mansion. He ends up saving the

Claymore © Norihiro Yagi / Shueisha © DNDP, VAP, avex entertainment, . Hayate the Combat Butler © Kenjiro Hata/, Hayate project, TV Tokyo 2007.

18 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 19 unfortunately for this savior, less-than-pure they soon fi nd that staying in business is war, and the human race puts aside their robot armor suits, but only young ladies ever since, her only goal has been to beat SUPER GALS motives and shrewd family members mean the least of their worries. differences to rebuild the spacecraft, with the proper combination of virtue and him at something - anything! Now he’s the “If I need anything anime related this will be the first Meet Ran Kotobuki, a 16-year-old “Gal” with her reward is a prison cell. Collection 1 redubbed the SDF-1. Eventually, the alien spirit can pilot the robots successfully. Enter top student at their exclusive high school a taste for the most fashionable clothing Vol. 1: A Single Step Released 5/18/10 13+ • #RSDVD0919 • SUB ONLY • 525 mins • $37.49 Zentraedi invade Earth, forcing the SDF- young Sakura, who has the qualifi cations to place I look from now on. THANK YOU!” - Bryan R. and she’s still number two and plotting. To and accessories. No part of Shibuya is safe 17+ • #AWDVD0993 • 100 mins • $22.49 1’s inexperienced crew to launch the battle be a fi ne robot pilot, but she’s surprised to complicate matters further, even as Hikari Collection 2 cruiser into war that will span generations, learn that this secret Defense Force has a dedicates her life to somehow one-upping as she hunts relentlessly for those items 13+ • #RSDVD1009 • SUB ONLY • 400 mins • $37.49 essential to a Gal’s existence: nails, stretch across the farthest reaches of the cover story as a musical theatre troupe - Keroro was abandoned. Now, this once- Kei, she’s oblivious to the fact that he’s in RAHXEPHON universe and turn ordinary soldiers into and they take their cover jobs very seriously! SKULL MAN love with her! Hawaiian jewelry, and karaoke. She should proud soldier spends more time wielding a be studying, but who can study when there DVD & BLU-RAY 2015 AD. Ayato Kamina is caught up in RIN: DAUGHTERS OF extraordinary heroes. Contains all three Complete Collection Otomo City: where freedom and justice have Collection 1 vacuum than he does the weapons of war. are things to buy, people to see, places to a devastating attack on Tokyo. Emerging Robotech series in a deluxe 21 disk set. 13+ • #SFSW100 • 625 mins • $22.48 atrophied to the bone; where conspiracy 13+ • #SFSPA100 • SUB ONLY • 300 mins • $29.98 MNEMOSYNE But though the invasion may have slowed go, and food to eat? from the rubble, he meets a mysterious girl, Protoculture Collection MegaSet to a hop, Sergeant Frog still occasionally rules the day and death stalks the night... Collection 2 Season 2 Box Set Reika Mishima, who guides him to a hidden 13+ • #DRTBX100 • DUB ONLY • 2575 mins • $97.48 yearns to overcome his karaoke addiction Death in the form of the Skull Man, a literal 13+ • #SFSPA200 • SUB ONLY • 300 mins • $29.98 where an enormous humanoid and reassemble his troops. Grim Reaper whose skeletal grin presages 13+ • #RSDVD2018 • SUB ONLY • 650 mins • $37.49 weapon, RahXephon, emerges from a black Mugen’s a buck-wild warrior - violent, grisly mayhem and murder. To investigate a Season 1 Part 1 egg. For some mysterious reason, Ayato is ROMEO X JULIET thoughtless and womanizing. Jin is a bizarre slaying, journalist Minagami Hayato SPICE AND WOLF 13+ • #AR09990 • 300 mins • $29.98 the only person who can pilot Rahxephon For most of her young life, Juliet was forced vagrant ronin - mysterious, traditional, and photographer Kiriko Mamiya must stalk Lawrence, a traveling merchant searching Season 1 Part 2 On his way to start at a new high school, and protect the city! to live a tortuous lie. Disguised as a boy, well-mannered and very strong. These two this ultimate predator, and unearth a secret for profi t, fi nds a naked girl with the ears 13+ • #AR09991 • 300 mins • $29.98 Yamato sees a beautiful girl practicing the Complete Collection she lurked in the shadows of Neo Verona. fi ercely independent warriors couldn’t be so shocking that an entire city has been and tail of a wolf asleep in his cart. Her high on the track fi eld. He is instantly 14+ • #DRX100 • 770 mins • $44.98 She escapes from the monotony of a life in more different, yet their paths cross when Season 2 Part 1 turned into a tomb to contain it! name is Holo - a harvest goddess with an smitten, but fears he will never see her hiding disguised as the Crimson Whirlwind - Fuu, a ditzy waitress, saves them from 13+ • #AR09992 • 300 mins • $29.98 untamed beast lurking inside who longs Complete Collection again - until he realizes that she lives next a masked crusader determined to right the being executed. Fuu convinces them to help Season 2 Part 2 to return to her beloved northern home. RAMEN FIGHTER MIKI 14+ • #SFSKM100 • SUB ONLY • 325 mins • $29.98 door. Her name is Suzuka, and when her SSTAFFTAFF wrongs of a heinous regime. But now, as her fi nd a mysterious samurai “who smells 13+ • #AR09993 • 300 mins • $29.98 Armed with his street smarts and her animal track skills are failing, Yamato is right there DVD & BLU-RAY DVD Miki Onimaru works at her parent’s ramen PPICKICK her people’s suffering reaches unspeakable of sunfl owers.” And their journey begins. instincts, they begin a journey through the to help her. shop, making deliveries, waiting tables, and levels, Juliet prepares to raise her sword Complete Series Box Set Regular Edition wild countryside. Along their path, the riches attracting customers with her cute, girlish and lead a rebellion against the villainous 16+ • #GN08654 • 625 mins • $52.48 TV SERIES of happiness shall be reaped, even as the Complete Set S.A.V.E. Edition Released 6/22/10 Rin Asogi is an immortal private detective tyrant whose hands are stained by the charm. But, somehow, Miki can’t complete TV SERIES It is a world of , where magic rules bankruptcy that dwells in the human heart 13+ • #FUN05219 • 625 mins • $14.98 with a thirst for vodka and a talent for blood of her ancestors. Complete Series Blu-ray even one of these simple tasks without attracting things that go bump in the 16+ • #GN08655 • 625 mins • $59.99 The kingdom of Kuruda has known many and monsters lurk around every corner. A is exposed. the full employment of her extensive bone- night. In a series of nightmarish vignettes Complete Series Released 7/13/10 warriors, but none greater than the Sevalle, world of dragons, knights, and wizards. A Complete Season 1 TAYUTAMA: crunching, skull-splitting martial arts moves! spanning sixty-fi ve years, Rin’s lush body is 13+ • #FUN01167 • 580 mins • $44.98 SAMURAI an elite breed whose mastery of martial arts world populated with heroes and villains. A 14+ • #FUN01180 • 312 mins • $44.98 KISS ON MY DEITY Complete Collection (Litebox) sadistically pierced, blown up, and mulched has made them legendary. But for the 59th world where the fate of the world rests in 13+ • #AWDVD1001 • SUB ONLY • 300 mins • $14.99 to a bloody pulp. While Rin struggles to After years perfecting the art of fi ghting, Sevalle, Elle Ragu, a.k.a. Shadow Skill, being Lina’s hands... (and now we know we’re in STORY OF SAIUNKOKU Yuuri Mito is a typical teenager. He goes unravel the secrets of her endless agony, 17-year-old Yoichi Karasuma is sent down a legend is shaping up to be something of a trouble!) to school, works on people’s motorcycles Apos lurks in the shadows, eager to tear One young boy who couldn’t get along from the remote mountains thinking he’s drag. After all, adventure alone doesn’t pay Saiunkoku is a country with eight powerful and performs exorcisms. Okay, that last RENTAL MAGICA with his classmates. One exquisite doll who Seasons 1-3 Collection into her ripe body and devour the memories going to study new martial arts techniques, the rent, and living check to check takes its 13+ • #FUN05973 • 1725 mins • $52.48 houses governed by one emperor. However, part’s a bit little unusual, but his family lives Destroying supernatural monsters and of her countless lives. wished to become a normal human girl. but what he’s really going to learn about are toll on even the fi ercest warrior. the new leader, Ryuki Shi, doesn’t care for in a shrine and they do that sort of thing. dispelling dark magic is all in a day’s work These are their adventures as they strive to slightly more practical things, like electrical Season 4: Slayers Revolution Set his new role and is rumored to spend his Still, you would think he’d know enough Complete Series Regular Edition Complete Collection for the of Astral! However, after the help each other overcome their fears and appliances, modern clothing and, most 13+ • #FUN05975 • 300 mins • $44.98 days chasing after noblemen. Enter Shurei to be careful with an ancient relic he fi nds, 17+ • #FUN09640 • 300 mins • $44.98 13+ • #DSSK100 • 650 mins • $33.74 mysterious disappearance of the company the very real dangers of the Alice Game. especially, how not to make girls to want Season 5: Evolution-R Set Released 6/1/10 Hong, a princess whose family has fallen especially when a mysterious goddess president, they’re left in a lurch. His son, Complete Series Blu-ray Released 7/20/10 However, they must fi rst overcome their to kill you! Unfortunately, that last lesson is 13+ • #FUN05976 • 312 mins • $44.98 upon hard times. Her dreams of becoming appears and tells him to leave it alone. Itsuki Iba, begrudgingly fi lls in, but Itsuki’s 17+ • #FUN09641 • 300 mins • $44.98 distrust of each other. one Yoichi may not survive, as the Ikaruga SHINCHAN a government offi cial are unattainable Unfortunately, the seal gets broken anyway unfamiliarity with magic could spell bad Complete Set (Seasons 1-2) Released 5/4/10 sisters don’t really seem to understand how He’s rude, he’s crude, and adults tremble SOLTY REI since she is a woman, but if she agrees and a number of dangerous “tayuti” that it news for Astral - especially with their rival ROBOTECH 16+ • #GN08744 • N/A mins • $37.48 “proper” girls are “supposed” to behave! whenever he’s around. His inappropriate to become the emperor’s consort and turn held in stasis get loose. Roy Revant is living the hard life of a bounty Goetia vying for the very same contracts. comments and obsession with body parts him into a respectable ruler, she will be A massive alien battle cruiser crashes Complete Collection Released 5/11/10 hunter in a broken city where thousands Complete Collection As the jobs grow ever more dangerous, and bodily functions make life stressful for greatly rewarded... on Earth in the midst of a bloody global 14+ • #SFANY100 • SUB ONLY • 300 mins • $37.48 have died in a mysterious event called the 14+ • #SFTYT100 • 300 mins • $29.98 his struggling parents. No one is safe from Blast Fall. Countless Resembles walk the Complete Season 1 TV SERIES Shinchan’s verbal outbursts... and now, streets, people whose mangled bodies 13+ • #GN08693 • 936 mins • $52.48 TEARS TO TIARA One silent, misty night, Karou sets out in neither are you! SAMURAI X have been rebuilt with high-tech prosthetic search of the murderer that’s tarnishing In a strange dark age based on Celtic Season 1 Complete Set Released 5/11/10 devices. Roy needs a miracle to escape his STRIKE the name of her fencing school. Instead, SEE RUROUNI KENSHIN myths, the Divine Empire’s path of conquest 17+ • #FUN04225 • DUB ONLY • 625 mins • $37.48 rut... and one night she falls from the sky. she fi nds Kenshin - an enigmatic wanderer TV SERIES seems unstoppable... until a savage priest Season 2 Complete Set Released 5/11/10 Like countless others, Solty is a Resemble, carrying a strange reverse-blade sword. And makes a critical mistake while attempting 17+ • #FUN04226 • DUB ONLY • 625 mins • $37.48 but one unlike the world has ever known. The year is 1944 and the world lives in fear with that, the curtain rises on this feudal tale SANDS OF of unidentifi ed fl ying objects called Neuroi. to resurrect a Demon Lord! Now the Complete Set S.A.V.E. Edition Released 7/6/10 of swords, honor, and redemption for a DESTRUCTION With the old-boy old guard unable to thwart scales of fate tip in the other direction as regretful past. SHINGU: SECRET OF 14+ • #FUN08257 • 615 mins • $22.49 this deadly menace, humanity turns its the resurrected Lord Arawn joins instead Complete Series (Seasons 1-3) Released 4/27/10 Morte is a lonely beauty with an axe to THE STELLAR WARS desperate eyes to an aerial attack force with with the priest’s intended sacrifi ce, the 13+ • #AWDVD0928 • 2375 mins • $119.99 grind and a grudge against the world. much nicer legs. Meet the girls of the 501st Priestess Riannon and her brother Arthur, to Life is rather quiet for Hajime Murata, but Her brother died in the war between Joint Fighter Wing, better known as the assemble the force that will bring the Divine when Kyoichi Moriguchi challenges a OVA men and beasts, and now she’s out to . Where the average fl yboy Empire its knees! mysterious new transfer student to a fi ght, SAMURAI X make everyone pay for her loss. That’s falters, these dolls blast aliens to bits in the Collection 1 where Kyrie comes in. This wandering Hajime arrives just in time to see a simple Rurouni Kenshin was the premier assassin of bat of an eyelash. 13+ • #SFTT100 • SUB ONLY • 325 mins • $29.98 cook may hold the key to unlocking the brawl turn into a display of psychic powers! the Ishin Shishi during the Meiji Restoration. Complete Series Collection 2 Destruct Code: a mysterious orb capable Hajime is determined to fi gure out the truth Now discover the driving forces behind 17+ • #FUN01190 • 300 mins • $44.98 13+ • #SFTT200 • SUB ONLY • 325 mins • $29.98 of eradicating everything in existence. The about the world he thought he knew. This the life of the man known as the Hitokiri fate of the world hangs in the balance, but is his story; a tale of aliens and humans, Battosai, the Man-Slayer. Contains both the these heroes are up to no good. starships and spies, and friends who are SUGAR, A LITTLE TEKKAMAN BLADE Director’s Cut and the original version of often more than they appear to be. Trust & Betrayal and Refl ection. Complete Series SNOW FAIRY TV SERIES 14+ • #FUN01210 • 290 mins • $37.48 Collection (Thinpak) Complete Collection 7+ • #RSDVD0710 • 650 mins • $44.99 SSTAFFTAFF Sugar, an apprentice Snow Fairy, and ORIGINAL SERIES 15+ • #DSX300 • 510 mins • $74.98 PPICKICK her friends, Salt and Pepper, need to fi nd The original Japanese version! The evil SHONEN ONMYOUJI the magical “Twinkles” before they can alien Radam has besieged Earth, gaining SASAMI become full-fl edged Season Fairies. The control of the enormous Orbital Ring that Maka is a Meister and Soul is her Weapon. SEE TENCHI MUYO Masahiro Abeno is the grandson of the only problem is that none of them have surrounds the planet and raining down S.A As students at the Grim Reaper’s Death great sorcerer Seimei Abeno. Unfortunately, any idea what a Twinkle is! Along with their mysterious spores that fi ll Earth with alien SEE SPECIAL A Weapon Meister Academy, their study Masahiro has lost his sixth sense and the lone human friend, Saga, these fairy friends plants. Pilots Aki and Noal fi nd one of the habits couldn’t be more different. But in ability to see spirits. One day, a demon search for Twinkles and try to perfect alien lieutenants who crashed on Earth. The battle against the supernatural forces of drops from the sky and proclaims that their magic. stranger claims to have no memory, and evil, they’re a lethal team. Soul transforms Tenma has fallen for her oblivious Masahiro must continue his grandfather’s is determined to fi ght to protect humanity! - literally - into a razor-sharp scythe, and Collection 1 classmate, but hasn’t worked up the work or perish in fl ames! His name is D-Boy, and he appears to be a every defeated wicked soul he sucks down 13+ • #SFLSF100 • 325 mins • $29.98 TV SERIES courage to tell him. Instead, she continually normal human - until he transforms into the Complete Series makes him more deadly. Maka unleashes Collection 2 ORIGINAL SERIES tries unorthodox ploys to confess with a 13+ • #GN08694 • 625 mins • $52.48 13+ • #SFLSF200 • 325 mins • $29.98 bio-mechanical warrior, Tekkaman Blade! frustrating lack of success. Meanwhile, the the merciless slayer within, wielding her Enter the world of Saiyuki: a unique universe Complete Set Released 5/4/10 class delinquent has fallen for Tenma and partner and dropping monsters. They and of beauty and betrayal, where sacred scrolls 7+ • #AWDVD1022 • SUB ONLY • 1250 mins • $44.99 is making similar attempts. This unlikely trio SHUFFLE! their fellow classmates are the world’s last SUKISHO battle enchanted weaponry and where line of defense against evil. dragons can transform into jeeps. It’s a land winds its way through the pitfalls of love and Meet Rin, a normal high school guy who is Sora fell from the roof of his high school TEKNOMAN of magic and menace, where four reluctant high school life! the envy of every other man in town. You Part 1 (Eps. 1-13) and was knocked unconscious. When he 14+ • #FUN01170 • 315 mins • $44.98 As seen on American TV! An endless heroes are just as concerned about having Most Awesomest Collection (Seasons 1-2 + OVA) see, he’s lucky enough to live with and be fi nally awoke, he found a kind-hearted boy swarm of biomechanical beings known a good time, a stiff drink, and a beautiful 17+ • #FUN08413 • 1310 mins • $74.98 pampered by the sweet, beautiful Kaede. Part 2 (Eps. 14-26) named Sunao waiting over him. Sunao as the Venomoids descend from space. woman as they are about saving the world. It’s just a day like any other when two new 14+ • #FUN01171 • 320 mins • $44.98 claims to be his best friend, but the fall Earth’s Space Knights are no match for the Complete Collection SGT. FROG transfer students show up in class: Sia, Part 3 (Eps. 27-39) Released 6/1/10 some of Sora’s memory. He doesn’t Venemoid champions, the Teknomen. When 14+ • #DSY100 • 1250 mins • $37.48 Princess of the Gods, and Nerine, Princess 14+ • #FUN01172 • 320 mins • $44.98 remember Sunao at all, and the wide-eyed the young pilots Ringo Richards and Star of the Demons. Now Rin’s luck is about to TV SERIES Part 4 (Eps. 40-52) Released 7/27/10 young man acts like much more than just Summers fi nd a wounded stranger named change, for he has been chosen to take one Keroro is Sgt. Frog - the leader of a 14+ • #FUN01173 • 320 mins • $44.98 a friend. From that day on, Sora begins Blade, humanity gains one last hope. Blade platoon of warriors sent to conquer planet of their hands in marriage! Talk about envy! to experience fl ashbacks in which he is is able to transform into a Teknoman and TV SERIES Earth. But when the amphibious invaders Complete Set Viridian Collection Released 7/20/10 not himself, but a mysterious alternate fi ghts to protect Earth. SPECIAL A personality with hidden powers. Alternate universe storyline. It is the 1920s, discovered how much humans enjoy 17+ • #FUN01508 • 600 mins • $37.48 Complete Collection (Litebox) POPOTAN and Japan is under attack by demonic dissecting their comrades, the troops were When she was six, Hikari Hanazono lost Complete Collection (Litebox) 7+ • #AWDVD0969 • DUB ONLY • 1100 mins • $14.99 invaders. The government has designed scattered, the mission was aborted, and a wrestling match with Kei Takishima and, 13+ • #AWDVD0970 • SUB ONLY • 325 mins • $14.99

Popotan © Petitferret/POPOYA.

20 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 21 TENCHI MUYO an incredible journey. MOVIES If anything, they may be even wilder and Movie 2: The Last Hope less cautious than before! N/R • #896911001218 • SUB ONLY • 140 mins • $18.69 TV SERIES 2-Disc Set From the sweeping universe of CLAMP, Women are monsters! For generations, the ALL • #786936791716 • 88 mins • $26.99 two journeys run parallel yet intersect. men of the planet Tarak have waged a valiant Collection 1 SASAMI As two souls seek the mystery of truth, war of survival against their fi erce enemies 13+ • #SFYUA301 • SUB ONLY • 300 mins • $29.98 AKIBALLION: Spin off from the original Tenchi Muyo worlds collide where the Dimensional Witch of the planet Mejale - women! Hibiki fi nds Collection 2 Released 5/4/10 BATTLEMAIDS OF series! Sasami has an amazing secret: waits. There is no coincidence, only the himself completely out of his depth, fi rst as 13+ • #SFYUA302 • SUB ONLY • 300 mins • $29.98 magic courses through her veins! But the inevitable... This two-disc double feature a stowaway on a space battleship, then as AKIHABARA spunky fi fth-grader is not alone, for all over contains both the Tsubasa movie and the the prisoner of the women who hijack it! When Akihabara, the geek nexus of Tokyo, DVD & BLU-RAY the world girls and boys are awakening xxxHolic movie! Ultimate Collection (Seasons 1-2 + OVAs) is threatened by alien Cyber Fairies, it will to their powers. Under the guise of the In a town where humans and demons co- CLAMP Double Feature Blu-ray Released 5/4/10 Released 5/4/10 take more than just an average superhero Cooking Club and with the guidance of Miss exist, it takes more than normal police to 13+ • #FUN03891 • 100 mins • $22.48 14+ • #FUN01151 • 766 mins • $37.48 to defend the world’s single largest Washu, Sasami and her friends will learn to maintain the peace. Enter the Hiizumi Life concentration of anime fans, model kits harness their newfound abilities and come Counseling Offi ce, a fantastic foursome of and maid cafes. Enter Akiballion: maid to depend upon one another through thick TWEENY WITCHES VEXILLE unique teenagers! The fi rst three quarters cafe hostesses who don super-powered and thin. TV SERIES 2077. For ten years, Japan has sealed itself of the team aren’t exactly human: Ao, a electro-brain battlesuits to combat the cat-eared telepath; Kotoha, a half-human Season 1 Box Set Young Arusu suddenly one day fi nds herself away from the rest of the world. Disturbing ultra-grotesque monsters sent forth by the conjuror; and Hime, descended from a 13+ • #FUN09595 • 213 mins • $14.98 SSTAFFTAFF dropped into the middle of a magical world, information is now emitting from within villainous Fairie Queen! dragon. Rounding out the group is the Season 2 Box Set PPICKICK where she meets two young witches named the country’s borders. An elite group of token human male, Akina. They may not Complete Collection 13+ • #FUN09596 • 213 mins • $14.98 Sheila and Eva. One wild broomstick ride American agents are assigned to infi ltrate look impressive, but come hell hounds or N/R • #SWB0145 • SUB ONLY • 187 mins • $14.98 later, all three are blamed for the release of the magnetic shield shrouding Japan to TV SERIES high water they’ll defend their city! : THE GIRL the witches’ source of magic: fairies. After shed light on the illegal biotechnology ART OF THE DEVIL 3 In the future, mankind has created a an unusual punishment is delivered, they research running rampant within. Complete Collection DVD & BLU-RAY DVD WITH THE BLUE EYE seemingly utopian society strictly controlled are given the task of recapturing the fairies Special Edition Viridian Collection Blu-ray 14+ • #SFYQ100 • SUB ONLY • 300 mins • $29.98 Panor, a seductive rural teacher, longs to by the government, where anything that In the post-apocalyptic world, humans - a diffi cult thing to do when Arusu keeps 13+ • #FUN09609 • 109 mins • $18.74 live a normal, peaceful life like everyone else threatens to disrupt the status quo is have settled along the desert frontier: freeing them! YU YU HAKUSHO in her village. But her beauty becomes her ruthlessly suppressed. When 14-year- battling giant, man-eating insects and Core Collection Released 5/18/10 biggest curse as she becomes the object old Jomy begins to question the way the TV SERIES living under the watchful eye of The Third, 13+ • #AWDVD1031 • 459 mins • $29.99 of desire for every man that enters her life. society is run, he suddenly becomes a VISION OF ESCAFLOWNE an organization that polices the use of From cutting classes to brawling in the Male colleagues and students alike resort to target for both the government and the technology. In this world, mercenaries SEE ESCAFLOWNE streets, Yusuke Urameshi is not your typical a variety of black arts and love potions in Mu, an outcast race with extra-sensory TYLOR, like Honoka and her powerful AI tank, role model. In fact, this kid’s nothing more an attempt to win her favor. To counter their abilities who have been fi ghting against the Bogie, will take on any job no matter how IRRESPONSIBLE CAPTAIN than a fourteen-year-old delinquent with endless menace, Panor herself must turn government for generations. Now each is dangerous. But when Honoka rescues a VOLTRON a talent for trouble. But in a single selfl ess to witchcraft to combat her supernaturally determined to hunt him down - one to kill TV SERIES mysterious young man from certain death, act, Yusuke dies while saving another. For charged suitors. him and the other to save him. Justy Ueki Tylor had his life all planned out: TV SERIES BAIAN THE ASSASSIN such a noble sacrifi ce, he is given a second she suddenly becomes the target of 17+ • #TSDVD0910 • SUB ONLY • 100 mins • $14.96 The Third’s watchful eyes. Anime Legends Complete Collection join the military, get a cushy desk job, and LION FORCE chance at life, but it’s to be a life far different 13+ • #AV80346 • 600 mins • $37.48 retire with a fat pension check. The perfect than the one left behind. Complete Collection Keith, Lance, Hunk, Pidge, and Sven are an plan... until he somehow managed to save “friends” are involved, and what are their ATTACK GIRLS SWIM 15+ • #RSDVD0911 • 600 mins • $59.99 MOVIE elite team of space explorers sent to fi nd XXXHOLIC Season 1 Box Set (Eps. 1-28) an admiral! Now Tylor - a man who wouldn’t the last princess of planet Arus, Allura, and plans for him?! 13+ • #FUN05993 • 600 mins • $26.24 TEAM VS THE UNDEAD know what discipline was if it bit him on Watanuki has been haunted by spirits his A retelling of ’s To Terra the keys to Voltron. Together they discover Complete Set the backside - has been made Captain of entire life, but when a group of demons dog Season 2 Box Set (Eps. 29-56) No sooner has beautiful young Aki stepped graphic novel series! the fi ve lions that make up the legendary 16+ • #GN08743 • 650 mins • $37.48 the space cruiser Soyokaze. The crew of him to the ornate door of the Dimensional 13+ • #FUN05996 • 600 mins • $26.24 on campus than she’s pressed into service Strongman Junpei, Hollywood actress Airi, Remastered Edition robot buried in the smoking ruins of planet this run-down ship is the craziest rag-tag Witch Yuko, he meets a mystical woman of Season 3 Box Set (Eps. 57-84) on the swim team. Next a psycho scientist teenage Ritsuko, and their T-74 tank have 13+ • #RSDVD0824 • SUB ONLY • 128 mins • $14.99 Arus. However, the evil warlord King Zarkon team of misfi ts you’re ever see, but they’d WITCHBLADE insight, quick to help those in a bind - for 13+ • #FUN05997 • 620 mins • $26.24 sent in to inoculate the luscious young landed in a world of elves, and the spell to appears and rains down destruction across better learn to work together because a fee. To be free of his visions, Watanuki Season 4 Box Set (Eps. 85-112) student bodies makes a little error in send them home has run amuck and split the universe. When things seem darkest, Sought by the greed of Men since the dawn TOWER OF DRUAGA they’re about to go head to head with the agrees to work in her shop. Watanuki 13+ • #FUN05998 • 700 mins • $26.24 judgment, resulting in a fl esh-eating zombie into fi ve pieces that appear as tattoos on our heroes form Voltron and begin a new of Humankind, but only bestowed upon Raalgon Empire! quickly learns that those looking to fulfi ll problem. Now, with most of the school the bodies of fi ve young female elves. So Scaling the sixty treacherous fl oors of the struggle against his cruel empire. the woman whose fate it forever scars: their desires should be wary, for the price running amuck eating each other, having they set out on a quest to strip every elf Tower of Druaga is no game. Very few Remastered Complete Collection the Witchblade. Is it the Righteous Sword ZETTAI MUTEKI Vol. 1 Released 5/4/10 may be higher than they ever wanted rabid sex, and juggling, it’s up to Aki and they can lay their hands on until they fi nd survive its twisting corridors and lethal 15+ • #RSDVD0906 • 650 mins • $37.49 of God, or the Hand of the Devil Himself? 7+ • #AWDVD0933 • DUB ONLY • 900 mins • $37.46 to pay... RAIJIN-OH her new-found allies on the girls swim team the missing spell pieces! traps, and those who reach the top must Now a new bearer has been chosen and to send these monsters to the shower! face Druaga, the demon protecting the OVA SERIES Vol. 2 Released 5/4/10 Complete Collection Viridian Collection When the legendary Guardian Eldoran Complete Collection she must discover the answers for herself. mysterious, treasured Blue Crystal Rod. Six long months have passed. The Raalgon 7+ • #AWDVD0934 • DUB ONLY • 900 mins • $37.46 13+ • #FUN04548 • 600 mins • $37.48 is badly wounded by the invaders of the 17+ • #SWB1801 • SUB ONLY • 80 mins • $22.48 13+ • #SFTW100 • 600 mins • $29.98 As she stands on the brink of destiny, she is It is a grueling campaign undertaken by Empire has developed a horrible new type BEAST KING GOLION forced to seek the balance between ecstasy Jaku Empire, he has no choice but to only the bravest swordsmen and wisest of weapon, and Tylor has been charged with and ruin... leave the Earth’s only salvation - the mighty BAIAN THE ASSASSIN the duty of intercepting it. But when all that From days of long ago, from uncharted sorcerers - and Jil. A young guardian with Complete Set Viridian Collection Released 6/15/10 XXXHOLIC MOVIE robot Raijin-Oh - in the hands of the fi rst could go wrong does go wrong, the crew regions of the universe, comes a legend - His name is Baian, professional Rito Yuki had no idea the planet Develuke little experience, Jil raises his shield to play 17+ • #FUN08732 • 600 mins • $37.48 people he can fi nd... which happens to be members of the Soyokaze fi nd themselves the legend of Golion, the original Japanese SEE TSUBASA acupuncturist and assassin! A needle deftly even existed when their Princess Lala the role of hero. a classroom of 5th graders. Can the Earth at the mercy of their enemies. As the hours show that started it all in the world of Complete Series Blu-ray inserted into the human body can bring relief teleported naked into his bathtub, let alone Part 1: The Aegis of URUK Defense Class successfully learn to work as tick down toward their execution, the crew Voltron. The fi ve pilots may look the same, 17+ • #FUN08730 • 600 mins • $59.98 and healing. For the defense of justice and that touching a girl’s breasts is how they 14+ • #FUN01200 • 280 mins • $44.98 a team, overcome their stigmas, and defeat wonders: has their irresponsible captain but their names and the events that occur honor - and the right price - it can also bring propose marriage! Given that he was in YOU’RE UNDER ARREST the forces of evil while (futilely) attempting to Part 2: The Sword of URUK misled them? Or is this all a part of some are galaxies apart from the series you think WORLD OF NARUE teach Jin how to perform decimal division? instant death! This TV series authentically the tub when she appeared, and slippery 14+ • #FUN01201 • 260 mins • $44.98 you know. Were people evacuated safely? details the street life during the greater strategy? Vol. 1 soap suds being what they are, Rito’s now Do robots die? Narue is an adorable schoolgirl with a these stories are street level and often take engaged to a beautiful girl with a pointed Remastered Complete Collection secret: she’s really a superpowered alien! 13+ • #AM001 • 130 mins • $17.99 Complete Collection place in the bars and brothels of Edo. tail. Worse, various aliens are showing up 13+ • #RSDVD0908 • 450 mins • $29.99 But growing up is never easy, and our 16+ • #AWDVD1021 • 1275 mins • $52.46 on missions of varying hostile intent and the Abel Nightroad, a touring priest for the spunky heroine faces androids, alien Collection (Vols. 1-4) (Litebox) 17+ • #TSDVD0947 • SUB ONLY • 351 mins • $14.99 girl that Rito really loves is still completely Vatican, walks calmly where others fear UFO DAIRUGGER, ARMORED FLEET invaders, and the most terrifying challenge unaware of his feelings. to tread. A member of the formidable AX, ever... her fi rst date with the boy next door! tasked with the protection of the fragile ULTRAMAIDEN VALKYRIE The original Japanese show that was edited BATTLE GIRL: Collection 1 to create Voltron: Defender of the Universe! Complete Collection LIVE ACTION 14+ • #SFTLR100 • SUB ONLY • 325 mins • $29.98 equilibrium. Neither human nor vampire, TV SERIES 13+ • #DWN100 • 325 mins • $22.48 with an awkward yet optimistic nature, this In the past, pioneers bet their youth on the THE LIVING DEAD Collection 2 Despite his parents’ protests, Kazuto Father is a force wholly his own. When the sea. Now, in the year 2200 AD, mankind IN TOKYO BAY 14+ • #SFTLR200 • SUB ONLY • 325 mins • $29.98 Tokino has taken it upon himself to run his SSTAFFTAFF greater threat emerges, the enemy of my searches for intelligent life in the sea of X late grandfather’s bathhouse. But when stars. Aki, Walter, and Keats lead the three PPICKICK 14 AMAZONS A fallen meteor unleashes a deadly virus enemy is my friend... and Abel Nightroad the alien Princess Valkyrie destroys the TV SERIES and now the dead are coming back to life TOKYO MAJIN Rugger Teams from their base on the Long before feminism made it to Hong seeks a safe path for all. bathhouse and mortally wounds Kazuto, as fl esh-eating zombies! K-ko is asked to military fl agship Rugger Guard. When they From CLAMP and Madhouse! Two groups Kong, women proved themselves more Tokyo. A wave of mysterious deaths ripples Complete Series Blu-ray dark clouds seem poised to rain on his TV SERIES help fi nd survivors and is given a bulletproof into the territory of the brutal of supernaturally powered warriors begin than equal to men in this martial arts throughout the city. Corpses of the un- 17+ • #FUN08470 • 528 mins • $52.48 parade of optimism. With a magical kiss, leather-and-blade “Battle Suit” to help her Galbeston Empire, they’re forced to defend a prophetic battle to shape the future - a ORIGINAL SERIES classic, a forerunner to Crouching Tiger, dead, controlled by monstrous creatures, she saves his life, but in the process, she’s on her rescue mission. Punching, blasting themselves by merging their machines into clash that will rock the foundations of the From drunken karaoke binges to baseball- Hidden Dragon. Set in ancient China, a scour the urban underworld at the bidding transformed into an eight year old! Now and decapitating the zombie hordes with TSUBASA, RESERVOIR the powerful Dairugger XV! planet! One young man holds the key to themed vigilantes, the Bokuto Police Station matriarchal clan proves as adept with of their dark master, seeking a power that Kazuto must defend the bathhouse, not her armor and weapons, she discovers Collection 1 Earth’s destiny - but to choose the side of is a magnet for the weird and unusual! sword, fi st, and gravity-defying leaps as could bring about the fi nal apocalypse. CHRONICLE only from hordes of alien invaders, but also something even more evil: a sadistic military 13+ • #AWDVD0919 • SUB ONLY • 450 mins • $26.24 good, he may spell doom for all creation. Fortunately, car-crazy Miyuki, insanely anything conjured up by the Crouching With the police helpless in the face of these from Valkyrie herself! general who wants to use the zombies in his TV SERIES Complete Series Released 6/15/10 strong Natsumi and the rest of the station’s Tiger ladies thirty years later. unnameable horrors, the fate of the world Collection 2 Released 5/25/10 own plan for world domination! The fates shine upon young archeologist Seasons 1-2 Collection 14+ • #FUN06797 • 625 mins • $37.48 hangs on fi ve unlikely saviors - the students 13+ • #AWDVD1028 • SUB ONLY • 450 mins • $26.24 enforcers of justice are always ready to face N/R • #FUN01220 • 118 mins • $14.98 Syaoran and his life-long love, the Princess 17+ • #DUPV100 • 670 mins • $44.98 17+ • #SFD0096 • SUB ONLY • 74 mins • $18.74 of Tokyo Majin! the challenge! Sakura. As the moon hovers silently above XENOSAGA Season 2 Collection 1 Complete Series the kingdom, a beautiful and otherworldly 13+ • #SFYUA201 • SUB ONLY • 325 mins • $29.98 17+ • #AR09835 • 650 mins • $52.48 WEISS KREUZ Four-thousand years after abandoning the BLIND MENACE sound fi lls the air, drawing the princess to In 1969, Kenji and his friends write Everything about him is shrouded in mystery. SEE KNIGHT HUNTERS Earth, humanity is in peril. Under attack by Season 2 Collection 2 Before he portrayed the legendary blind the ancient ruins. Her latent powers stir, “The Book of Prophecy.” In their book, they The mask he can’t remove. The past he a merciless enemy from another dimension, 13+ • #SFYUA202 • SUB ONLY • 325 mins • $29.98 swordsman Zatoichi, Shintaro Katsu played TOTORO, MY NEIGHBOR awakening an ability to cross dimensions. write about a future where they fi ght against can’t unravel. But what Hakuoro does know the crew of the spaceship Woglinde is Suganoichi, a blind court masseur with a But the process is interrupted as unseen FULL THROTTLE an evil organization trying to take over the Follow the adventures of Satsuki and her is this: he was gravely injured and left for fi ghting to defend a mysterious monolith dark side. An outcast since birth, he learned forces conspire to claim this magic as WHEN THEY CRY world. Years later, in 1997, a mysterious four-year-old sister Mei when they move dead. He was welcomed into a barren with unknown powers. Enter KOS-MOS. The ladies of Bokuto Police Station are at young age that the only way to get their own. cult led by a man only known as “Friend” into a new home in the countryside. To land where strange creatures roam, an When Keiichi joins an after-school club Designed to protect humankind, she may back, but there have been some big ahead is to take advantage of others. Now their delight, they discover that their new Collected Memories (Seasons 1-2 + Movie) angry god seeks vengeance, an oppressive changes! Miyuki’s been in the U.S., has emerged and gained strong infl uence Regular Edition and befriends four cute girls, life doesn’t be the downfall of her creators - or she may an expert con-artist with a heart of coal, neighbor is a mysterious forest spirit called government slaughters the innocent, and a studying American police techniques, while over society. A series of catastrophic events 13+ • #FUN02299 • 1280 mins • $74.98 seem too bad. That is, until he learns about be their only hope. Suganoichi is on a vile quest for power, and Totoro, who can be seen only through the bloody war looms on the horizon. Natsumi’s been serving in the military! So begin to occur, mirroring the prophecies demonic cults and the grisly murders that Complete Set Viridian Collection Released 5/11/10 everyone else will suffer along the way! eyes of a child. Totoro introduces them to Collected Memories (Seasons 1-2 + Movie) have these experiences had any effect on made up by the young Kenji. Complete Series Viridian Collection have occurred every year on the day of 14+ • #AR09742 • 282 mins • $18.74 Released 6/15/10 extraordinary characters - including a cat Blu-ray Released 5/4/10 how everyone’s favorite girls carry out their Movie 1: Beginning of the End 14+ • #AR09762 • 625 mins • $22.49 the town festival. How many of his club 17+ • #ANMDV1439 • SUB ONLY • N/A mins • $18.74 that doubles as a bus! - and takes them on 13+ • #FUN02301 • 1280 mins • $74.98 duties protecting the Japanese public? N/R • #896911001201 • SUB ONLY • 142 mins • $18.69

Baian the Assassin © Kokusai Hoei.

22 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 23 BLOOD: THE LAST BUSHIDO: THE CRUEL until they receive word that Ryo’s father GOD’S LEFT HAND, played then with his best friend’s younger has accidentally unleashed a horde of sister. When he is sent to assassinate VAMPIRE CODE OF THE SAMURAI demons while conducting experiments in DEVIL’S RIGHT HAND the members of a rival gang, childhood Demons have infested Earth, and only For 350 years, seven generations of the Antarctica. These demons spread like an memories lead him to permit one of the one warrior stands between the dark and Iikura family have honored Bushido, the infection throughout the world, possessing men to live. Rather than being grateful, the the light: Saya, a half-human, half-vampire stern code of the samurai, above all other ordinary people. When Akira is possessed, survivor of the killings plots his revenge. samurai who preys on those who feast he becomes , a powerful demonic considerations. Susumu, a modern-day 16+ • #EPODV2054 • SUB ONLY • 102 mins • $18.74 on human blood. Joining forces with the entity who somehow retains his human Japanese professional and member of the DVD & BLU-RAY shadowy society known as the Council, seventh generation of the family, chronicles conscience. It is up to Devilman to do battle Saya is dispatched to an American military the shocking stories of his forefathers as he with the heartless demons, including Ryo. HEROIC ONES base, where an intense series of swordfi ghts decides whether to break free from the bonds Special Edition Cinematic kung fu master Cheh Chang leads her to the deadliest vampire of all. of an ancient code of honor or take up the 17+ • #TSDVD0946 • 115 mins • $18.74 directs this epic tale of a Tang Dynasty After 400 years, Saya’s greatest hunt is role that tradition has ordained for him. family. Led by patriarch Li Ke Yung, a about to begin. 17+ • #ANMDV1419 • SUB ONLY • 123 mins • $18.74 DISCIPLES OF SHAOLIN SSTAFFTAFF powerful warrior in his own right, the family’s Regular Edition PPICKICK 13 sons are charged with freeing the capitol 17+ • #43396309425 • 88 mins • $22.46 Impetuous young martial arts master Kuan city from a rebel leader. Two of the brothers, Blu-ray BUYUSENKI BATTLE takes a job at a textile factory where another Shih Ching Szu and Li Tsun Hsaio, take 17+ • #43396309418 • 88 mins • $31.46 CHRONICLE disciple of the revered Shaolin discipline A boy with the supernatural ability to dream the lead, battling enemy forces with their warns him about the rival Manchu clan, who about and predict the evil intentions of formidable kung fu skills, even as in-fi ghting motorcycles, drugs and yakuza under run another nearby mill. Combat breaks men sees one particular individual reading threatens to tear the clan apart. BOOGIEPOP AND OTHERS pressure and the result is bosozoku, the out between the two warring camps, with a picture book to his bedridden daughter. Blu-ray The cold dead of night is a dangerous time brutal motorized street gangs that terrorize Kuan becoming his boss’ right-hand man The dream would have been nothing Japan armed with swords and baseball N/R • #WGU01111B • 120 mins • $14.98 DVD & BLU-RAY DVD to be near the Shinyo Academy. Girls have but becoming distracted by the promise of extraordinary except for the fact that the begun to mysteriously disappear without a bats. Kyosuke Jinnai was the leader of the wealth. Soon his skills are put to the test by self-made book was about murdered girls trace, and the school is alive with rumors. “Buyusenki,” the largest group of its kind his opponents, who practice expert boxing and the nightmare causes blood to pour HISASHI TENMYOUYA: Some say the girls are just runaways, but in the Kanto region, but planned to give it and the deadly Iron-Finger Lock, which can from his neck. Slowly dying, it’s up to his SAMURAI NOUVEAU with each new disappearance, a lingering all up to make a family with his pregnant kill a man in his tracks. sister to track down the man from her fear grows ever stronger - fear that a girlfriend. Instead, all of that was stolen from brother’s dream and solve the mystery. Hisashi Tenmyouya: Samurai Nouveau him in a moment of savage betrayal, and N/R • #ID4592XFDVD • 103 mins • $17.98 presents a look into the artist Hisashi shinigami - the very spirit of death - is N/R • #TSDVD0924 • SUB ONLY • 95 mins • $22.49 prowling through the streets of the city. They the man who dreamed of peace has instead Tenmyouya and his Neo-Traditional say you never see it coming. A lone whistle been transformed into an angel of death! DORORO Japanese Painting style. Throughout this fi lm he uses gold foils and fi ne brushes to splits the dark silence, and it suddenly N/R • #SWB0156 • SUB ONLY • 112 mins • $14.98 In an age of epic samurai battles, one GOTH appears behind you to steal your soul... prepare for various exhibitions while people warrior must hunt down and destroy In the faceless suburbs of Tokyo, a serial killer surrounding the artist share their thoughts. 13+ • #RSL9015 • SUB ONLY • 158 mins • $22.46 DAIDO MORIYAMA: powerful demonic forces to reclaim his has been murdering young women, severing Watch Tenmyouya as he reveals his soul STRAY DOG OF TOKYO humanity and uncover the secret of his their left hands and leaving their bodies through the melding of modern urban father’s betrayal. Based on the classic story artistically posed. His antics catch the eye of subjects with traditional painting methods. Follow the charismatic photographer Daido by legendary Japanese manga pioneer two high school students, the beautiful loner Moriyama as he takes his fi rst digital photos, Osamu Tezuka. Morino and the popular Kamiyama, both of N/R • #896911001249 • SUB ONLY • 80 mins • $18.69 and observe his style of quick snapshots N/R • #25195041164 • SUB ONLY • 139 mins • $25.18 whom harbour a disturbing fascination with without looking in the fi nder. His stark death, murder and cruelty. After Morino fi nds HONG KONG GODFATHER and contrasting black and white images what they believe to be the killer’s notebook, symbolize his fervent lifestyle. EXTE: HAIR EXTENSIONS the two attempt to track him down. A violent new gang is hacking away at crime boss Szetu Han’s power. When the old N/R • #896911001232 • SUB ONLY • 84 mins • $18.69 Customs agents discover a huge amount Released 5/11/10 man and his family are viciously murdered, of human hair along with the bald corpse N/R • #WGU01123D • SUB ONLY • 95 mins • $14.98 Han’s three most trusted men - retired killer DAYTIME DRINKING of a young girl. This arouses the curiosity Mad Wei, hitman Playboy Lung, and city of Yamazaki, particularly since the girl’s hair GUN-KYU ~ WAR PIGEON cop Sergeant Wen - undertake a brutal After breaking up with his girlfriend, Hyuk- continues to grow. Now a mad hair-peddler campaign of street justice. SSTAFFTAFF jin hits a bar with his friends. Totally drunk, with an endless stock of locks, Yamazaki Ever since that fatal incident in college, Released 4/27/10 they decide to take a trip. However, when hocks his wares to salons to be used for Kanako has sensed them. A sound behind PPICKICK N/R • #FUN01223 • 94 mins • $14.98 Hyuk-Jin gets off the bus the next afternoon hair extensions. It’s not long before death her... an object moving at the corner of her he fi nds out he’s the only one there. Worse, surrounds an up-and-coming stylist and her vision. Birds. Cooing, taunting birds... But Jandi is a brave high school girl who fi ghts the festival they were headed to was weeks extension-wearing clientele. are they real, or just in her head? As Kanako I WAS A TEENAGE NINJA for the rights of others no matter the cost. struggles to perform her duties teaching ago. No shops, no tourists, and the beach is N/R • #TSDVD0966 • 108 mins • $14.99 When she defends a friend against the elite marine biology, the images of pigeons As Japan is torn apart by warring factions, cold. Over the next few days, Hyuk- it falls upon the master assassins to carry Boys of F4 (Flower 4), they target Jandi as jin fi nds himself in a series of increasingly slowly begin to drive her to the edge of their next victim. But nothing stops Jandi. EYE FOR AN EYE insanity, until even drugs and alcohol no out the tasks at which even great armies bizarre situations, most aided by the fact have failed. Unfortunately, there just aren’t She fi ghts back and wins the admiration of that he can’t refuse a drink. Capt. Baek Seong-chan was about to turn longer offer her protection. the extravagantly wealthy boys! enough ninja to go around, so when a N/R • #FUN09565 • SUB ONLY • 116 mins • $14.98 in his badge and run a grocery store when 17+ • #SWB0122 • SUB ONLY • 77 mins • $14.98 plot to eliminate a rising shaman becomes Box Set 1 (Eps. 1-12) a criminal commits a robbery and uses his known, the jobs falls to the raw and 13+ • #880604000916 • SUB ONLY • 720 mins • $67.49 DEADLY DUO identity to stage a daring getaway. As Capt. HARD REVENGE MILLY untested Sora. But don’t worry! Sora may Box Set 2 (Eps. 13-25) Baek delves ever deeper into the case, not know which end of a ninjaken to stick 13+ • #880604000947 • SUB ONLY • 780 mins • $52.49 It’s the Sung Dynasty versus the Chin he begins to suspect that a man seeking In post-apocalyptic Japan, Yokohama City her sheath on, but she’s young, willing, and invaders as the “Iron Triangle” of director vengeance against a powerful mobster has become an epicenter of violence ruled her skills at seduction are just fi ne! and stars David Chiang and businessman has purposefully drawn him by a vicious gang. The worst of the new BRILLIANT LEGACY 17+ • #SWB1878 • SUB ONLY • 75 mins • $14.98 truly hit their stride with this kung into an elaborate revenge plot in order to breed of criminals are “The Jack Brothers.” Eun-sung is a kind, hardworking young fu epic. When a handsome prince is taken settle a lingering grudge. When The Jack Brothers viciously murder woman from an affl uent family, but she captive and guarded by a martial arts Released 5/4/10 Milly’s husband and daughter leaving, she ICHI goes from riches to rags when her vows revenge. She learns the art of sword master, it’s up to two powerful patriots to N/R • #EPODV2252 • SUB ONLY • 101 mins • $18.74 Beautiful Ichi wanders blindly from village father suddenly dies and her duplicitous combat from a master swordsman named fi ght overwhelming odds. to village, searching for the sightless stepmother devises an evil plan. Hwan, the Jubei, and eventually sets off to confront Blu-ray Released 5/11/10 swordsman who long ago taught her to kill. arrogant heir to a large food company, has FISTFUL OF FUKU The Jack Brothers and fulfi ll her destiny. N/R • #TSDVD0965 • 78 mins • $18.74 Her technique is exquisite and explosive, no interest in working and takes everyone Her mom’s in prison, her dad’s a mystery Hyper Violence Collection (Movies 1-2) her defenses as impenetrable as the for granted, so Hwan’s grandmother and all she’s got to her name is a fuku skirt 17+ • #WGU01087D • 130 mins • $14.98 darkness in which she moves. Many along decides to groom Eun-sung to be the DELIGHTFUL FOREST and a pocket full of stale breath mints. In her solitary path are touched - some by the company’s successor instead! Sparks When a revered group of kung fu masters is fact, the only thing has going for her sound of her delicate music, others by the begin to fl y as Eun-sung and Hwan go HEARTBREAK YAKUZA slaughtered, their young student, Kuo, and is that she’s fast... as in her fi sts, not as in edge of her lethal blade. head-to-head over their inheritance. his sister seek revenge on the murderer. Cheh “easy” (although she’s that too). So when Shuji is one of the up-and-coming assassins Regular Edition Box Set (Eps. 1-28) Chang returns to helm this Shaw Brothers someone runs off with the prize money from for the Daito mob of the yakuza. Despite 17+ • #FUN09896 • 120 mins • $18.74 N/R • #880604000954 • SUB ONLY • 1680 mins • $74.99 production also featuring Tien Hsiang Lung. her last fi ght, a destitute Saki fi nds herself his pretense of toughness, he frequently in the odd position of defending a south-of- has overwhelming longings to return to Blu-ray Blu-ray the-border noodle joint from the evil forces his childhood and the innocent games he 17+ • #FUN09897 • 120 mins • $26.24 BROTHERS FIVE N/R • #WGU01112B • 101 mins • $14.98 of Servicio Occupodo and his goon squad The beautiful swordswoman Yen Lai must of Japanese wrestlers! DEPARTURES track down the fi ve Kao brothers and 15+ • #SWB0106 • SUB ONLY • 127 mins • $11.24 convince them to band together to face the When his orchestra disbands, Daigo dangerous thugs who have taken control Kobayashi moves back to his hometown FIVE ELEMENT NINJAS of Teng Lung Manor. The brothers are all and takes a job preparing corpses for burial. skilled fi ghters individually, but eventually Too embarrased to admit his new career When a quintet of nasty ninjas hell-bent realize that it will require teamwork if they to his family, Daigo keeps his profession on world domination nearly massacres From comedy to horror, hope to defeat the villains and avenge their a secret, until he learns the true joy and an entire clan, its lone survivor must take father’s murder. wonder of living. the path of revenge. He meets up with an find more Asian film & K-drama Blu-ray old master, well-versed in the ways of the N/R • #E1EDV6757 • SUB ONLY • 131 mins • $20.24 on RightStuf.com! N/R • #WGU01110B • SUB ONLY • 102 mins • $14.98 ninja. Now armed with secret knowledge and newfound friends, he must battle the DEVILMAN awesome power of the Five Element Ninjas. Best friends Akira and Ryo are just your N/R • #TSDVD0942 • 105 mins • $14.99 average high school students. That is,

24 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 25 MACHINE GIRL one Kunoichi must make a terrible choice: quickly unraveling. soothe their broken hearts after a break- sacrifi ce her lover and use her body as her Released 5/4/10 up. Little do they know, they’ve stumbled Ami’s world comes crashing down when her “I will always shop here! Thank you very much for all masters command, or forsake her vows and N/R • #E1EDV6811 • SUB ONLY • 119 mins • $20.24 upon a cult of backwater maniacs. Split up brother and his friend are killed by ruthless be outcast forever! you do.” - Michelle D. from each other, they keep in via cell bullies. After revenge, she soon fi nds herself phone with the action constantly rewinding 17+ • #SWB1877 • SUB ONLY • 75 mins • $14.98 in over her head and minus her left arm. TORA-SAN: JAPAN’S to show us what’s happening from multiple Barely surviving, Ami escapes and hides MOST BELOVED LOSER points of view. with two kindly garage mechanics. They NU-MERI ~ BOOK OF RIGHTEOUS TIES SPACE RANGER fi t her with a high-powered machine gun Tora-san visits a different part of Japan N/R • #TSDVD0915 • 128 mins • $18.74 DVD & BLU-RAY THE NEW SPAWN An eccentric but faithful mafi a man, Chi- With the power of the Treasure Sword, the where he meets a beautiful young woman where her arm used to be. She then teams sung is sent to prison for his part in a gang King of Valhalla maintained peace across up with the chainsaw-wielding mother of For centuries man has taken from the ocean, and tells her if she ever needs help, she YAKUZA: fi ght. But when his parents are attacked the universe. But when the sword goes should come visit him in his small hometown her brother’s slain friend and together they never dreaming what might lurk beneath the by a rival mob and his own people take missing it’s up to three magnifi cent female unleash an over-thetop kill fest. waves. For young Mari, whose family have of Shibamata. After returning home to his LIKE A DRAGON no action, he realizes that a decade of warriors - Sting Blue, Orna Black, and disapproving family, the damsel in distress Ultimate Collector’s Tin Released 6/29/10 fi shed for generations, her studies in marine , once one of the most loyalty has become futile. Determined to Caliban Red - to recover it. Unfortunately, shows up, and Tora-san falls in love. Alas, N/R • #TSDVD0963 • 96 mins • $29.99 bio-engineering at the Pacifi c Institute confront his own boss, he fi nds a way to they don’t get along and foolishly divide fearsome yakuza and known as the “Dragon represent a new future for her entire family. his attempts to help her and win her heart of the Dojima Family,” comes back to escape from prison with his fellow inmates. their forces as the nefarious Dron Brothers invariably cause her to fall for someone else! MIIKE COLLECTION But when her friend Nanako is mysteriously Meanwhile, his friend Joo-joong is given of the Dark Planet close in. Now, on an Kamuro-cho after a ten-year jail sentence. discovered dead, covered with fi shbites and the task to stop Chi-sung, forcing him to insignifi cant world known as Earth, the fate Collector’s Set 1 (Movies 1-4) His return means many things to many Family: Lightning Takeshi’s cover is blown growing scales, it becomes all too clear that choose between the bond of friendship and of all creation will be determined in a knock 13+ • #ANMDV1301 • SUB ONLY • 365 mins • $59.98 different people, but to one girl, it means she while executing a hit on a mobster. Soon the someone - or something - at PI has a new loyalty towards the gang. down battle to the fi nish! may have a chance of fi nding her mother. To Matsuma gang is after Takeshi and his entire future in mind for all human kind... one of Kazuma’s yakuza friends, however, it 17+ • #829567066126 • SUB ONLY • 126 mins • $14.99 N/R • #SWB0158 • SUB ONLY • 120 mins • $14.98 TWIN BLADES means a chance to settle a score. family. Takeshi’s brothers are important men 17+ • #SWB0114 • SUB ONLY • 76 mins • $14.98 in a rival gang and will do whatever it takes OF THE NINJA

DVD & BLU-RAY DVD N/R • #TSDVD0962 • SUB ONLY • 110 mins • $18.74 to protect him. Bodyguard Kiba: Big bucks OASIS RYUJI THE YAKUZA SUNLIGHT UPON ME For Yamame and Suzume, two beautiful bodyguard Naoto Kiba is hired to be the young ninjas-in-training, the prospects of “Bodyguard of Darkness” to protect the For all their power, the Yakuza are governed Poor Yeon-woo is shocked when she fi nds YAYOI KUSAMA: Fleeing an arranged marriage, In-hee meets by their own codes of loyalty and honor, out her sister’s true identity. Against her a long life are shortened dramatically when Soryukai Family from the thieving Ishimine in Gi-hyun, an aspiring musician, and they they choose the wrong samurai to relieve of I LOVE ME this action-fi lled drama. and there are those who are seen not as family’s wishes, Yeon-woo gets a job as a slowly fall in love. Eventually, In-hee ends up criminals, but heroes. Ryuji Ogami is one home shopping channel host, and falls in his wallet. Suddenly they fi nd themselves This fi lm captures Kusama’s creative THE GEISHA Litebox working for Young-jin. As Gi-hyun’s musical such enigma, torn between the worlds of love with lawyer Dong-suk. What she doesn’t caught up in a deadly game with both the process as she diligently works to complete 17+ • #TSDVD0950 • SUB ONLY • 315 mins • $14.99 career begins to take off, he discovers that bullets and bushido. If your cause is just, know is that the owner of the TV network is life of a princess and their own at stake! her new series of 50 large monochrome Young-jin is the same man who murdered seek out Ryuji. But endanger those he her real grandfather - and his extended family But Yamame and Suzu have at least one drawings. As her work comes to life, one MIYAMOTO MUSASHI, his father. However, Gi-hyun is suspiciously cherishes, and he will fi nd you. And when isn’t too fond of Yeon-woo. Will Yeon-woo trick no one’s expecting inside their ninja can witness the essence of her art as it KID WITH THE sent to work hard labor at a coal mine in the code of the Yakuza is violated by his and Dong-suk be able to fi nd any sunlight arsenal... and they’re willing to bare all their wells up in the confl ict between life, death, THE ULTIMATE SAMURAI Japan. Upon the Japanese defeat in World own gang, the city will burn as the deadliest amid a storm of lies and secrets? weapons in order to survive! and love; sometimes quietly and sometimes Welcome to a world where violence is a GOLDEN ARM War II, Gi-hyun returns home full of revenge. virtue and depravity is a way of life. This Japan’s most famous samurai, Miyamoto man in Yokohama takes on his own! Box Set (Eps. 1-16) 17+ • #SWB1790 • SUB ONLY • 75 mins • $14.98 just the opposite. Her fi rm self-confi dence Musashi, was an unmatched warrior whose Box Set and dignifi ed spirit, combined with a year is the underside of and the home 17+ • #SWB0155 • SUB ONLY • 139 mins • $14.98 N/R • #880604000862 • SUB ONLY • 960 mins • $52.49 of Kakihara, a sadistic Yakuaza killer. He innovative two-sword technique left him N/R • #880604000923 • SUB ONLY • 180 mins • $18.74 and a half worth of invaluable footage, relentlessly tears apart the underworld victorious in over 60 duels. Set against the TALES FROM THE DEAD allows viewers to enter Kusama’s world with searching for the man who killed his boss. backdrop of Japan’s tumultuous warring- OLD PARTNER SAMURAI PRINCESS When the world is threatened by alien never a dull moment. The mastermind behind the plot is Jijii, states period, this fi ve-fi lm saga chronicles Deception is as unavoidable as death - and invaders and prehistoric monsters, there An eloquent, touching, and gut-wrenching In an alternate fuedal Japan, mad scientist N/R • #896911001195 • SUB ONLY • 102 mins • $18.69 an ex-cop bent on turning the gangsters the rise of Musashi as he evolves from so is payback. Tales From the Dead is an is only one agency equipped to handle peek into the reality of Mr. Choi Won-Kyun Kyoraku creates a female ninja mechanical of Japan against one another. His trump untamed warrior to become Japan’s most anthology of four stories that look at the the situation: The Science Patrol, an ultra- and his relationship with his 40-year-old doll. Equipped with 11 types of built-in card is a physically powerful lunatic who is famous swordsman. quiet terror lurking inside the human soul, sophisticated police force equipped with ZATOICHI ox. In the backdrop of what seems to be weapons, she is infused with the souls of constantly on the verge of snapping. Released 5/4/10 eleven of her fallen sisters and she uses showing us that evil does not end when high-tech weaponry. Ubeknownst to the MOVIE a dying way of life for many farmers, an life departs. These original stories show us team, one of their members, Hayata, Blu-ray 17+ • #ANMDV1429 • SUB ONLY • 570 mins • $74.98 their combined power to take down anyone THE BLIND SWORDSMAN: ZATOICHI SSTAFFTAFF old man perseveres, while his wife bickers that life, and the inescapable agonies of the has the ability to transform into the giant 17+ • #TSBD0911 • 124 mins • $26.99 and complains about her own unlucky fate. who stands in the way. The ninja doll will PPICKICK not die even if she is slashed by a sword or living carry on into the next, well, life. superhero from Nebula M7B, Ultraman! In an empire ruled by fear, the people’s only MY DESTINY There is no denying that this particular ox is hope is the ultimate weapon: Zatoichi - a a beast of burden, but it is also cherished shot by a gun; she is virtually indestructible N/R • #SMNDV6123 • SUB ONLY • 84 mins • $18.74 Complete Series JAPAN AT WAR College sweethearts Jia Ying and Tang Hao blind, nomadic samurai whose sword has Yang Yu Heng is asked by the government and loved as the old man’s constant and on her quest to save humanity. N/R • #683904507389 • 840 mins • $11.24 have gone through thick and thin together, made him a hero and whose courage has This collection features four remarkable fi lms to escort a cargo of gold into a famine area. dependable companion. Regular Edition made him a legend. Determined to help the told from Japan’s perspective. The tense but life changes when they step into the TAMRA ISLAND However, he must contend with the vicious Released 4/27/10 17+ • #WD103 • 85 mins • $14.98 UZUMAKI desperate residents of a village, Zatoichi drama Japan’s Longest Day examines the Chi Sah gang who boast the individual real world. After joining a corporation, Tang Box Set Released 5/31/10 Hao is led astray by the lure of power and N/R • #880604000961 • SUB ONLY • 77 mins • $18.74 Blu-ray Released 5/11/10 N/R • #880604000978 • SUB ONLY • N/A mins • $74.99 Residents of a remote town have become seeks justice through revenge. decisions that led to Japan’s surrender. talents of leader Golden Arm, Silver Spear, 17+ • #WGU01124B • 85 mins • $18.73 Battle of Okinawa chronicles the bloodiest Iron Robe, and Brass Head. In order to the wiles of the boss’s daughter. Jia Ying, inexplicably become obsessed with spiral Blu-ray battle of the Pacifi c Theater. Father of protect the gold from their attentions, Yang meanwhile, develops a friendship with her ONIMASA: TAXI HUNTER shapes. Kirie, a young schoolgirl, fi rst notices 17+ • #786936790597 • 116 mins • $35.99 the recounts the life of Admiral hires the services of swordsman Li Chin boss and Tang Hao’s rival, CEO Kim Hong SHAOLIN HAND LOCK this phenomena when she encounters her Ming. When business and romance begin to A JAPANESE GODFATHER Inspired by an actual Hong Kong taxi strike, ’s father, maniacally videotaping Onishi, the complex man who refused to let Ming and his girlfriend Miss Leng. What From the director who gave Jackie Chan collide, can love hold up to the test? Ah-Kin is a pissed-off insurance agent out a snail. Later, her brooding beau, Shuichi, his country fall to defeat. Lastly, in Shohei follows is a battle of wits and strength Onimasa is the egocentric boss of a small and Sammo Hung early breaks in fi lm, for revenge. When his pregnant wife is reveals that the odd behavior goes further In 1978, Shinichi was a huge fan of the Imamura’s stunning Black Rain victims of between the protagonists. Box Set (Eps. 1-26) yakuza clan on Shikoku Island, whose Ho Meng-hua teams up with Mr. Kung-fu brutally run over by a taxi driver and left for - his father has fi lled an entire room with super hero TV show Zebraman. In 2010, the atomic bomb learn to cope with an N/R • #880604000695 • SUB ONLY • 1560 mins • $37.49 criminal duties confl ict with his self-image hero, David Chiang, in a funky, over the Released 5/11/10 dead, he goes on a rampage of death and various spiral objects. Before long, this Shinichi sews himself a makeshift Zebraman uncertain future. as a chivalrous samurai. His struggles with top, martial arts chiller based upon a secret N/R • #TSDVD0956 • 81 mins • $14.99 destruction. Ah-Kin decides to take out his growing madness leads to a series of costume. His harmless escapism becomes his boss, the Shikoku Godfather, and the kung-fu technique that is also the fi lm’s Collection NAKED SWORD aggressions on the bastard taxi drivers that gruesome and unbelievably bizarre deaths. reality when he runs into a half-crab, half- 17+ • #ANMDV1148 • SUB ONLY • 629 mins • $59.98 tumultuous life of his adopted daughter, English title, Shaolin Hand Lock. Fans and KIRENJI GIRLS In the time of warring states, the female ninja Matsue, form the backdrop of this epic tale overcharge and treat their customers poorly. man enemy of the same TV show and non-fans of the genre will elate to again 17+ • #ES007 • SUB ONLY • 90 mins • $18.71 begins to realize the stories of Zebraman COMBAT SCHOOL Murasame is assigned to assassinate the of justice, obedience, and bloody vengeance. see Chiang match fi sts with Shaw Brothers’ 17+ • #ES010 • SUB ONLY • 89 mins • $14.96 KAZUO UMEZZ’S rebel Lord Daizen Osakabe, who has aligned and his strange alien enemies were actually 17+ • #ANMDV1409 • SUB ONLY • 146 mins • $18.74 number one villain, Lo Lieh. VENUS RANGER prophecies. HORROR THEATER Kirenji is so defi nitely not your typical himself with the Tokugawa clan in a plot to TOKYO 10+01 Japanese girls’ school. While the word “hot” betray the Taiko! Despite overwhelming N/R • #FUN01221 • 88 mins • $14.98 When four beautiful girls sneak into the Special Edition Six Japanese masters of horror have united might describe an attractive girl at other odds, Murasame nearly succeeds, but in the OPIUM & THE Neo Tokyo in the year 2XXX AD. Eleven hideout of a shadowy organization, they 17+ • #TSDVD0945 • 115 mins • $18.74 to adapt the works of Kazuo Umezz, schools, at Kirenji it’s more likely to mean end is outnumbered and badly wounded. people, all with criminal backgrounds suddenly fi nd themselves being drafted the godfather of horror manga. He is so KUNG-FU MASTER SIREN “hot blooded,” “hot tempered,” and “ready Now she must use all her skills, both as a and different talents, awake in a deserted as holy warriors in the ancient war of infl uential the awards are They thought they’d committed the perfect ZOMBIE HUNTER RIKA for red-hot action” - as in physical combat, ninja and as a woman, to escape a deadly Film legend Ti Lung battles the scourge of warehouse. They are forced to play a game good ! On the side of darkness named “Umezz Awards.” Re-imagined by crime... Instead they encountered the that is! When 17-year-old Maki enrolls, web of slavery and deception. the orient in this epic fi nal fi lm from director with a reward of 300 million yen and a chance is the Golden Venus; on the side of light, When typical Japanese high school student the minds behind cutting-rdge Japanese perfect killing machine! Who could imagine, thinking she’s the baddest bad girl of them Tang Chia. Schooled in the martial arts to start a new life. Only one will survive. the Mysterious Silver! Scheming beastly Rika skips school to visit her grandfather, horror classics The Ring, Ju-On: The 17+ • #SWB1843 • SUB ONLY • 75 mins • $14.98 in these modern times, that a creature like all, she quickly learns the hard way that at by the Peking Opera, Chia’s deft touch goddesses, massive girl-on-girl battles, and she fails to take into account the fact that Grudge, , and many the Siren would have found a new way to 17+ • #ES009 • SUB ONLY • 70 mins • $18.71 Kirenji, she’ll have to punch her way to the guides the gut-wrenching tale of a Kung an epic spin on the power ranger genre! his remote village is infested with the living others, his horrifi c tales have been crafted top of the shapely power pyramid! NEGATIVE HAPPY Fu master wrecked by opium. Starring a trap its masculine prey? dead. What happens next isn’t pretty, but to rattle your nerves, assault your senses legitimate champion of the Gibbon Fist style Released 4/27/10 fortunately, Grandpa Ryuhei just happens 17+ • #SWB0154 • SUB ONLY • 125 mins • $14.98 CHAINSAW EDGE 17+ • #SWB2084 • SUB ONLY • 78 mins • $14.98 TOKYO GORE POLICE 1.5 and make you question reality. as the fi lm’s villain - Chen Kuan Tai - Chia’s N/R • #SWB0159 • SUB ONLY • 95 mins • $14.98 to be the greatest surgeon ever! Picking After his buddy dies in a glorious motorcycle masterpiece showcases the talents of at In the near future, the Tokyo Police up what’s left of Rika, he dusts her off and Litebox Corporation is locked in a bloody war with 17+ • #TSDVD0948 • SUB ONLY • 305 mins • $14.99 LADY NINJA KASUMI accident, Yosuke vows to make something least six different martial arts directors. SLEEPY EYES OF DEATH VERSUS rebuilds her, better than she was, into the more of his nondescript life, starting with the “engineers.” These genetically modifi ed ultimate zombie fi ghter! It is the , a time when Released 4/27/10 Edo has degenerated into a tangled web super-criminals can bio-fuse their wounds Deep within the mysterious Forest of Japan’s states are constantly at war. When winning the heart of steely schoolgirl Eri. N/R • #FUN01222 • 90 mins • $14.98 of political intrigue and personal vice. KI-GAI Pursuing Eri is a tad diffi cult, however, with weapons, turning self-mutilation into Resurrection, the spectacular battle 17+ • #SWB2031 • SUB ONLY • 86 mins • $18.74 Kasumi’s parents are killed, she and her Nemuri Kyoshiro, the son of a Japanese between good and evil has gone on since When Miki Takenotori starts talking about because she’s busy every night waging a combat form. Ruka, the daughter of the brother are adopted by a powerful warlord. noblewoman raped by a Christian the dawn of time. When Prisoner KSC2-303 ghosts, and ghouls, most people dismiss battle against a mysterious chainsaw- ORESAMA police chief’s murdered right-hand man, is ZOMBIE Soon she joins the Kunoichi to protect her missionary, lives only for the moment, escapes from a maximum security jail, he her stories as the fantasies of a strange wielding giant that’s haunting the streets now the top engineer hunter. Nothing keeps brother and defend her new people. When The year is 2003. Miyavi is a young, insanely amused by the chaos that surrounds him. enters the forest believing it will lead him to a SELF-DEFENSE FORCE teenager. Unfortunately for Miki, the things for some unknown reason. Between fl ying her from her sworn duty, even when she a spy turns up dead, Kasumi investigates. popular rockstar. His days are spent warding But those who decide to use him for their safe haven. Instead, he fi nds himself a pawn she’s talking about are real, and most knives and kung-fu fi ghts, will Yosuke live to fi nds out the truth behind her father’s death. They thought it would be a routine training Soon she fi nds herself forced to choose off screaming gaggles of female fans until own ends soon discover that they have in an endless struggle played out against an of them don’t like being talked about! see that date? Released 5/18/10 mission for the Japanese Self Defense between love and the code of the Kunoichi. one day, when he suddenly fi nds himself made a fatal error! For Kyoshiro wields the ever-changing background across multiple Fortunately, she’s found a believer in in an unfamiliar atmosphere. An outdated fabled Musou-Masamune blade and all N/R • #TSDVD1002 • 109 mins • $18.74 Force; instead it became a blood-soaked Vol. 1 N/R • #WGU01105D • SUB ONLY • 107 mins • $14.98 temporal planes of existence. beautiful archaeologist Reiko Kaguya, and dress on a woman. Old commercials those who challenge him must face - the battle for survival against the living dead! 17+ • #TSDVD0727 • SUB ONLY • 72 mins • $14.96 together the two young women do their playing. Miyavi encounters a young rocker, sleepy eyes of death! TOKYO SONATA Blu-ray Released 6/29/10 As the handful of survivors end up trapped best to keep aliens, demon mirrors and Vol. 5: Counter Attack NINJA SHE DEVIL Shinni and soccer player. What lessons can 17+ • #TSBD0951 • 119 mins • $18.74 inside the inevitable secluded hotel, the Collector’s Set 1 (Movies 1-4) Ashamed after unexpectedly losing his paths of fashion models, gangsters and the even giant dragons from destroying Japan. 17+ • #TSDVD0964 • SUB ONLY • 80 mins • $14.96 They are masters of sword, bow, shuriken, Miyavi learn from these guys? 17+ • #ANMDV1220 • SUB ONLY • 338 mins • $59.98 job, Ryuhei decides to keep his news a heroic JSDF team collide in combat against More volumes also available! and poison, but for a female ninja, sex is the X CROSS 17+ • #SWB0111 • SUB ONLY • 130 mins • $14.98 Released 4/27/10 Collector’s Set 2 Released 7/27/10 secret. His lies and personal torment go the cannibalistic hordes of hell! deadliest weapon of all. Torn between her N/R • #ES013 • SUB ONLY • 66 mins • $18.71 17+ • #ANMDV1221 • SUB ONLY • N/A mins • $59.98 unnoticed by his family, whose lives are also Friends drive out to a remote hot spring to love for one man and her duty to the clan, 15+ • #SWB0104 • SUB ONLY • 76 mins • $18.74

The Geisha © 1983 Toei Company, Ltd.

26 video.rightstuf.com 800.338.6827 800.338.6827 video.rightstuf.com 27 BOOKS 28 Three yearsafterthepopularvideogame LINK 13+ •#9781427815965192pgs$8.24 challenged, whatactionwillNanasetake? serious trouble andherloyaltytotheguildis of allherproblems. ButwhenSilabusisin her quiet,helplessattitudeisthesource shadow, Nanaseisforced torealize that exception! AsAlkaidcontinuestocastabig Arena ChampionAlkaid,andSilabusisno everyone hastheireyesgluedtothenew with Silabus,herguildmaster. However, online game,TheWorld, shefallsinlove As Nanaseengagesinthepopular ALCOR 13+ •#9781427816078192pgs$9.74 series of.hackvideogames. Helba, etc.)andsecond(Haseo,Atoli, characters ofthefi rst (Kite,BlackRose, parodies centeringmostlyaround themain of the4komaare fi lled withgagsand popular multimediaworldof.hack.Most A four-panel mangaseriessetinthe 4KOMA 13+ •#9781427817785656pgs$14.99 Complete Collection powerful weapon. who Auraisandwhyshegavehimthis the mysteriousAura.Shugomustfi nd out entrusted tobeartheTwilight Braceletby is transportedtoanotherlevelwhere heis World.” WhenShugo’s characterdieshe middle schoolstudentswhoenter“The Web. TwinsWide RenaandShugoare two experiencing arenaissance ontheWorld Old-fashioned role-playing gamesare LEGEND OFTHETWILIGHT .HACK// JAPANESE books.rightstuf.com 800.338.6827 MANGA 17+ •#9781421523408216pgs$9.74 Vol. 5 17+ •#9781591169222216pgs$9.74 Vol. 1 to savetheworld. This isthestoryofagangboyswhotry slowly startstounfold,thatsymbolreturns. a symbol.In1997,asthecomingdisaster In 1969,duringtheiryouth,theycreated the newmillenniumifitweren’t forthem. of the20thcentury, wouldnothaveentered Humanity, havingfacedextinctionattheend 20TH CENTURY BOYS 16+ •#9781569708347200pgs$12.95 the throne? brothers isunfolding.Whowillascend king empty, aviciousbattlebetweentwo Shishioh. Butnow, withthethrone ofthe and savedtheworld.HisnamewasKing day ofDespaira,agodappeared inthesky The planethaddiedoncebefore... Onthe 9TH SLEEP 16+ •#9781934287873 Vol. 1 what theymostcherish. they racetoprotect botheachotherand out humanity. Two livesshare oneheartas of anintergalacticmurderer intentonwiping lifeform knownasCiel,ahunterinsearch girl. Butwithinherbodyresides another Hikaru isasomewhatreclusive teenaged close outthepeopleandworldaround her, Always sportingherheadphonestotry 7 BILLIONNEEDLES 13+ •#9781427817761 Vol. 1 and makeshimherservant! transfer studentforces himintothegame the game.Thatis,untilamysteriousnew a copyandfi nds himselfwithnoaccessto Unfortunately forhim,heforgetstoreserve cannot waitforTheWorld R:Xtocomeout. The World wasshutdown,Tokio Kuryuu Released 8/10/10 Released 6/29/10 192 192 pgs•$8.21 pgs•$8.24 16+ •#9781935429043288pgs $18.74 Vol. 3 16+ •#9781935429029304pgs$18.74 Vol. 2 16+ •#9781935429005368pgs$18.74 Vol. 1 monstrous powerknownonlyasAkira. raw, all-consumingfearofanunthinkable, the core of theagency’s motivation isa him atargetforshadowyagency. At abilities begintowakeninTetsuo, making Kaneda, changeforever whenparanormal two streetwise teenagefriends,Tetsuo and origin thattriggered World War III.Thelivesof of aTokyo annihilatedby ablastofunknown Welcome toNeo-Tokyo, builtontheashes AKIRA More volumesalsoavailable! 16+ •#AWNOV0949 •184pgs$8.99 Vol. 6 16+ •#AWNOV0856 •200pgs$8.99 Vol. 1 district forthefuture oftheindustry. battle isabouttobeginintheAkihabara in aworldofinformationtechnology. A be draggedintothestruggleforsupremacy legendary otakuofAkihabara.Soon,they’ll is smallbuteliteandorganizedbythe Akihabara@DEEP. Itisanenterprisethat AKIHABARA@DEEP More volumesalsoavailable! 16+ •#9780345508171208pgs$8.21 Vol. 14 16+ •#0345492781224pgs$8.21 Vol. 1 and everythinghecares about. Now hestandstolosehisschool,friends, Westside punkswithgangsterconnections. his schooltovictoryoversomevindictive gets downrightdangerous whenItsukileads Noyamano sisters,solife’s neverdull.Butit Plus, Itsukiliveswiththemysteriousandsexy dangerously rough whenheneedstobe. Junior High-easyontheeyes,but Itsuki MinamiisthetoughestkidatHigashi AIR GEAR 17+ •#9781421533971208pgs$9.74 Vol. 1 they create theirowndestinies? the fateoftheirgeneticprogenitors, orcan is killed.Are theclonesdoomedtorepeat fi rst graduate,thecloneofJohnF. Kennedy, to adaptthisunusualcampus,St.Kleio’s except forShiro Kamiya.AsShiro struggles Mozart, andFreud. Allofthem,thatis, Beethoven, QueenElizabethI,Napoleon, of famoushistoricalfi gures suchas school: allofthestudentsare clones St. KleioAcademyisaveryexclusive CHARISMA AFTER SCHOOL More volumesalsoavailable! 17+ •#9781421523453216pgs$9.74 Vol. 10 17+ •#9781421523446216pgs$9.74 Vol. 9 17+ •#9781421523439216pgs$9.74 Vol. 8 17+ •#9781421523422224pgs$9.74 Vol. 7 17+ •#9781421523415216pgs$9.74 Vol. 6 SEE OH!MYGODDESS Released 6/15/10 Released 6/15/10 Released 4/20/10 Released 8/17/10 AH! MYGODDESS ABANDON THE SEE PUSHMAN OLD INTOKYO 13+ •#9780345512499208pgs $8.21 Vol. 2 13+ •#9780345512482240pgs$8.21 Vol. 1 so thatshecancontrol therain! goddess, Ciel,wantsSora’s sacred tree - provides water tothetown.Butanother sassy deity, Sora,theraingoddesswho them, Gimmycomesface-to-facewitha and sisterdisappear. Whilesearching for desert townwhenhisyoungertwinbrother Gimmy isjustanordinary teenlivingina THE RAINGODDESS AMEFURASHI: 16+ •#9781421532400208pgs$9.74 her boyfriend. in thehouseanddecidestomovewith out tofl eece hermom,can’t standtostay younger thanYukiko. Yukiko, convincedhe’s - toanex-hostandaspiringactorwho’s Mari announcesthatshe’s gettingmarried relationship suffers asudden changewhen still liveswithhermotherMari.Buttheir Yukiko, asalarywomaninherthirties, DAUGHTERS ALL MYDARLING More volumesalsoavailable! 16+ •#9780345500830208pgs$8.99 Vol. 8 16+ •#9780345497468208pgs$8.21 Vol. 1 wondering whytheyare stillalive. teens whohavesurvivedtheoutbreak are in lessthanaweek.Nowgroup ofTokyo suicide -andbecomingalethalpandemic the globe,causingitsvictimstocommit A strangevirusismakingitswayaround ALIVE 16+ •#9781569701669200pgs$12.95 Vol. 1 like anoutcast,callinghim“the101st.” into theprogram, andproceed totreat him classmates wonderhowheevenmadeit into theprogram asthe101ststudent!His read amusicscore -issomehowaccepted formal musictrainingandisunabletoeven But thisyear, AlistairLang-whohasno are acceptedintotheprogram eachyear. around theworld,butonly100students thousands ofelitemusicianapplicantsfrom Mondonville MusicAcademyattracts 101ST ALICE THE 16+ •#9781427818188N/Apgs$8.24 Vol. 3 13+ •#9781427817709192pgs$8.24 Vol. 2 13+ •#9781427817693184pgs$8.24 Vol. 1 full ofdangerandbeautifulyoungmen? will shebeabletofi nd happinessinaworld insidious cause...Unabletoreturnhome, citizens wielddangerous weaponsforan into afrightfulworldwhere thefairytale-like young manwithrabbitearsandleadsher into therabbithole,where intoa heturns clothes?! Therabbitforcefully dragsAlice wakes uptofi nd awhiterabbitwearing Alice, whohasfallenasleepinhergarden, COUNTRY OFHEARTS ALICE IN THE Released 6/8/10 Hellsing ©KOHTA HIRANO199 PICK SSTAFF P T I A C K F 8 . transform intohumanform! students are magicalanimalswhocan outthatalltheother school... anditturns senses thatsomethingisoff aboutthis school calledMorimori.Nekoimmediately Neko isfi nally acceptedtoamysterious she triedtoenroll induetoherbadgrades, After beingrejected from everyhighschool Neko isherpeculiarnamethatmeanscat. The onlythingspecialabout15-year-old HAKOBUNE HAKUSHO ANIMAL ACADEMY: Hayate XBlade©ShizuruHayashiya2004. up withtheoddgroup ofgirlsthatattend student! Butthisworkswell inkeeping in fact,sheactsmore likeanairheaded Miss Yukari isnotyourtypicalteacher; AZUMANGA DAIOH More volumesalsoavailable! 16+ •#9781427805140192pgs$8.24 Vol. 5 16+ •#MM1427805105208pgs$7.49 Vol. 1 entire city. amidst thebeautifulscenicbackdrop ofthe people asshetakesthemongondolarides Company. She getstomeetallsortsof in trainingandalsoanemployeeofAria people. AkariMizunashiisagondolier revered astheyact tourguidesforthe gondoliers knownasUndinesare well- travel around ingondolas.Professional Neo Venezia, atouristhubinwhichpeople On theplanetAqualieswaterycityof ARIA 13+ •#9781421534213208pgs$7.49 Vol. 2 13+ •#9781421534206208pgs$7.49 Vol. 1 after hislife! world andfi nds himselfdealingwithpeople Hinohara getssuckedintothefi rst Arata’s day Japan!Meanwhile,aboynamedArata and hesomehowwindsupinmodern- an assassinationplotforces himtofl ee, discovered! Onthedayofhisinauguration, a girlorfacedeathifhistruegenderis Clan. Thismeanshehastopretend tobe being thesuccessortomatriarchal Hime co-exist, Aratahastheunfortunatehonorof In amythicalworldwhere humansandgods ARATA:LEGEND THE More volumesalsoavailable! 13+ •#9781401225520192pgs$7.49 Vol. 9 13+ •#9781401222277192pgs$7.49 Vol. 8 13+ •#140121181X192pgs$7.49 Vol. 1 has itselfbecomepoisonous. will haveitslimits,asArgentum’s verytouch bodyguard. Butanypotentialrelationship he isassignedtobePrincessPrimula’s afteralongabsence, any illness.Returning a masterchemistwiththeabilitytocure immunity totoxicsubstancesandbecame for aroyal family. Later, hedevelopedan As aboy, Argentumwasapoisontester ARGENTUM APOTHECARIUS 10+ •#9781427816313 Vol. 5 10+ •#9781427810984192pgs$8.24 Vol. 4 10+ •#9781427810977192pgs$8.24 Vol. 3 10+ •#9781427810960192pgs$8.24 Vol. 2 10+ •#9781427810953192pgs$8.24 Vol. 1 Released 6/8/10 Released 6/2/10 Released 8/3/10 are thelowestIhaveseen.”-RaulH. Your“I wouldliketosaythanksforeverything. prices 192 pgs•$8.24 ALL •#978034552021096pgs$5.99 Vol. 3:AFeud BetweenFriends ALL •#978034551540796pgs$5.99 Vol. 2:TheMasqueradeBall ALL •#978034551368796pgs$5.99 Vol. 1:TheBattleBegins fi lm framestonarratethestory. secret origin oftheBakugan!Usesfull-color quest tosaveVestroia... anddiscoverthe from thefi re worldofPyrus.Drago’s ona ally: Drago,anawesome,giganticdragon against evil.NowDanhasanewBakugan Bakugan guardians -intheultimatefi ght of theirmagiccards -andtheirbattling Battle Brawlers,warriorswhousethepower Dan Kusoandhisfriendsare Bakugan ANI-MANGA BRAWLERS BAKUGAN BATTLE More volumesalsoavailable! ALL •#9781421521718216pgs$5.99 Vol. 5 ALL •#9781421517933200pgs$5.99 Vol. 1 are abunchoflittlemudballs?! when themonstershe’s beenpaired with with atwist.ButhowfarcanSanshiro get game pittingmonstersagainst reverse universetoplayBakegyamon-a Sanshiro istakentoa warning, Without stranger inviteshimtoplayagame... hometown -untilthedayamysterious are slimtononeonhistinyisland Sanshiro’s chancesofhavinganadventure BAKEGYAMON More volumesalsoavailable! 13+ •#9781421524719184pgs$7.49 Vol. 18 13+ •#9781421524702184pgs$7.49 Vol. 17 13+ •#VIZ1421502348200pgs$6.74 Vol. 1 resentful ofhislittlebrother. no playhasTakuya incredibly frustratedand responsibilities ofanadult.Butallworkand usually associatedwithchildhoodforthe Minoru. Takuya mustsacrifi ce theplaytime job totakecare ofhisbabybrother his motherpassedaway, it’s beenhis Young Takuya hasittough.Eversince BABY &ME More volumesalsoavailable! 16+ •#9781421527925184pgs$7.49 Vol. 10 16+ •#9781421527918184pgs$7.49 Vol. 9 16+ •#9781421527901184pgs$7.49 Vol. 8 16+ •#9781421523620192pgs$7.49 Vol. 7 16+ •#VIZ1421518023200pgs$6.74 Vol. 1 in B.O.D.Y.: youcan’t putapriceonlove! be withhimso...?Onlyonething’s forsure a jobattheclubsohecanquitshe club, willshefi nally wiseup?Orwillshetake When shediscoversheworksforahost drooling overFuji,thestrong, silenttype. weird tasteinguysbecauseshecan’t stop Everyone thinks16-year-old Sakurahas B.O.D.Y. 16+ •#9780316077385672pgs$18.74 Omnibus Yomi, thesensiblebookworm. spaz; Osaka,thegirlfrom outer-space; and problem withanimals);Tomo, theultimate and admirablegirl(whoalsohasanunusual 10-year-old high-schoolgirl;Sakaki,thetall her class,suchas:Chiyo,theprecocious Released 5/4/10 Released 8/3/10 16+ •#9780316072984224pgs$8.24 Vol. 5 16+ •#9780759530867224pgs$8.24 Vol. 4 16+ •#9780759530478224pgs$8.24 Vol. 3 16+ •#9780759530461192pgs$8.24 Vol. 2 16+ •#9780759530058192pgs$8.24 Vol. 1 athlete extraordinaire. fi rst girlheneedsisTamaki Kawazoe,kendo put togetherafi ve-woman squad-andthe schools’ kendoteams,heneedstoactually he canarrangeakendomeetforboth to beathisfriend’s kendoteam!Butbefore the line,Kojiro fi nds anewpurposeinlife: an entire year’s worthofdeluxesushion when anoldfriendmakeshimabetwith club. Hecanbarely feedhimselfasitis,so the supervisorofhishighschool’s kendo Kojiro isanimpoverishedyoungteacherand BAMBOO BLADE 13+ •#9781421535135208pgs$7.49 Vol. 1 Moritaka totesthislimits! Akito andmotivationfrom hiscrushpush can be.Still,encouragementfrom persistent how diffi cult reaching theprofessional level manga-publishing world?Moritakaknows exactly doesittaketomakeinthe him asamanga-creating duo.Butwhat talent, hebegsMoritakatoteamupwith aspiring writerAkitoTakagi discovershis drawing forfun.Whenhisclassmateand Average studentMoritakaMashiro enjoys ALL •#978034552022796pgs$5.99 Vol. 4:Dan&Drago Released 6/30/10 Released 8/3/10 800.338.6827 books.rightstuf.com very attractiveFusano,whotakesherown with agreat group offriends,includingthe Jin’s ahappy, irresponsible highschoolkid BATTLE OFGENRYU More volumesalsoavailable! 16+ •#9781421533513208pgs$7.49 Vol. 13 16+ •#VIZ1569318247200pgs$7.46 Vol. 1:AngelReborn and theTipharians? the robotic denizensoftheM.I.B.Bureau ever known.CanAlitastopthewarbetween Kunst, themostpowerfulfi ghting technique thing herbodyhasn’t forgotten:thePanzer Alita haslosthermemory. Butthere’s one Alita returns!ReconstructedbyDocIdo, LAST ORDER BATTLE ANGELALITA More volumesalsoavailable! 13+ •#9780867196016270pgs$14.99 Vol. 10:NeverGiveUp 13+ •#9780867196009270pgs$14.99 Vol. 9:BreakingDownBorders 13+ •#9780867196023284pgs$14.99 Vol. ofHiroshima 1:CartoonStory Gen Nakaoka. as seenthrough theeyesofseven-year-old in Japanafteryearsofwarandprivations that event,thisten-volumesagashowslife the U.S.A.Startingafewmonthsbefore destroyed byanatomicbombdropped by days ofAugust1945whenthecitywas old andlivinginHiroshima intheearly Cartoonist KeijiNakazawawassevenyears BAREFOOT GEN 16+ •#9780316072991 Vol. 6 Released 9/30/10 Released 6/8/10 HAYATE XBLADE 224 pgs•$8.24

29 BOOKS BOOKS 30 which intriguesoverzealous animallover special connectionwithanimals though, will gonearhim!Hedoesseem tohavea eyes -andnooneathisnew highschool Leo Aoilookslikeacrazyanimal withwild More volumesalsoavailable! 17+ •#9781427817587176pgs$9.74 Vol. 15 Hearing this,sheimmediatelyrefuses. her newbestfriendwillbeahospitalbed. Yoshuu school,andsaysifsherefuses encounters aToushi who wantshertojoin beat peopleup.Onedayatschoolshe desireand assuchshehasaburning to country withhermother. SheisaToushi, a largechestbutsmallbrain,livesinthe Hakufu Sonsaku,ayounggirlblessedwith BATTLE VIXENS 16+ •#9781401218737 Vol. 3 16+ •#9781401218720200pgs$7.49 Vol. 2 16+ •#9781401218713162pgs$7.49 Vol. 1 Fusano, thewarbetweenbrothers ison. Jin possesses.WhenSoichiro laterattacks brother Soichiro, who’s aftersomething out, theywere hired byhisestranged days whenheisn’t powered up.Turns tough guyschallengehimononeofthe does his.Butthatchangeswhensome fi ghting skillswaymore seriouslythanJin Released 7/27/10 Released 5/4/10 books.rightstuf.com 800.338.6827 200 pgs•$7.49 PICK SSTAFF P T I A C F K F 17+ •#9781421531861216pgs $9.74 Vol. 3 17+ •#9781421531854216pgs $9.74 Vol. 2 17+ •#9781421531847220pgs$9.74 Vol. 1 against mind-bendingevil. surreal landscapesandhurlhimintobattle acrosssalvation willtakehimonajourney motorcycle, Zoichi’s search forthekeyto computer systemofhisHeavyDutyCoil Fuyu, anartifi cial intelligencebuiltintothe and he’s thehelpof notevenhuman!With Heavy Industry, ishumanity’s lasthope, like drones. ZoichiKanoe,anagentofToa mostofthepopulationintozombie- turning The N5Svirushassweptacross theearth, BIOMEGA More volumesalsoavailable! 17+ •#9781595823724232pgs$11.21 Vol. 33 17+ •#9781595823670232pgs$11.21 Vol. 32 17+ •#DHGN1593070209224pgs$10.46 Vol. 1 to opposehim! the damnedandanyoneelsefoolishenough throughdown: he’llcutaswathofcarnage sacrifi ce. ButGutswon’t takehisfatelying darkness tohimanddoomsastheir an unholysymbolthatdrawstheforces of is alsoindeliblymarkedwithTheBrand, an iron hand,andcountlessscars,hisfl esh only inwhispers.Bearer ofagiganticsword, His nameisGuts,afeared warriorspokenof 16+ •#9781421532028200pgs$7.49 Vol. 2 16+ •#9781421532011192pgs$7.49 Vol. 1 ferocious sideeventuallydevourher? Leo duringtheseviolentfi ts? OrwillLeo’s Yuikoblood! Will beabletogetthrough to out thathegoesberserkwheneversees frightening asheappears,butYuiko fi nds Yuiko Kubozuka.Inreality, Leoisn’t as Released 8/10/10 Released 5/11/10 ORFINA More volumesalsoavailable! 13+ •#9781934287798 Vol. 12 13+ •#9781934287781 Vol. 11 N/R •#9781934287743300pgs$12.71 Vol. 10 N/R •#9781934287736300pgs$12.71 Vol. 9 N/R •#9781934287613300pgs$12.71 Vol. 8 N/R •#9781934287279300pgs$12.71 Vol. 1 illegal operations. well ascriminalswhoapproach himfor occasional run-inswiththeauthorities-as corruption. ThisleadsBlackJackto the medicalcommunity’s hypocrisyand a medicallicenseduetohishatred of a trainedphysician,herefuses toaccept performing amazingmedicalfeats.Though genius surgeonwhotravelstheworld Black Jackisamysteriousandcharismatic 16+ •#9780316084253192pgs$8.24 Vol. 2 16+ •#9780316080842192pgs$8.24 Vol. 1 true... oratleast,toogoodtobehuman... underbelly. He’s almosttoogoodtobe or probing thedarksecrets ofLondon’s whether it’s savingadinner partygoneawry it seemsthere’s littleSebastiancan’t do, faithful butler, Sebastian. EveratCiel’s side, the youngboytohandlewere itnotforhis Phantomhive Manor. Itwouldbealotfor of hisfather’s company andasEarlof Phantomhive muststepupasthehead When aterriblefi re claimshisparents, Ciel N/R •#9781770460126144pgs$19.95 Released 5/31/10 how lovedrove himtobecomeamurderer. around thefi re theybuilt,Susumurelates an abandonedrangerstation.Astheysit outside. Theyfl ee intothemountainsto Susumu withhimintotheblizzard raging opportunity toescape,draggingareluctant derails thetrainandcriminaltakes that willtakethemtoprison.Anavalanche handcuffed toacareer criminalonthetrain is arrested formurder andendsup Susumu Yamaji, a24-year-old pianist, BLACK BLIZZARD 16+ •#9781421527680200pgs$7.49 Vol. 5 16+ •#9781421527673200pgs$7.49 Vol. 4 16+ •#9781421527666200pgs$7.49 Vol. 3 16+ •#9781421527659200pgs$7.49 Vol. 2 16+ •#9781421527642194pgs$6.74 Vol. 1 for themselves...byeatingher! But mostdemonswanttokeepherpower power tothedemonclanwhoclaimsher. is thebrideofprophecy, whosebloodgives outMisao her cuts-withhistongue!Itturns suddenly returnstosaveherandtend by ademon.HerchildhoodfriendKyo But thatchangeswhenMisaoisattacked high schoollifeandmaybegetaboyfriend. Misao Haradajustwantstohaveanormal Released 8/3/10 Released 5/4/10 Released 5/31/10 Released 7/20/10 Released 5/18/10 300 300 pgs•$12.71 pgs•$12.71 PICK SSTAFF P T I A C F K F this violationofhumanhairrights. Bo-BoBo, to theoccasionandtakesa standagainst Maruhage Empire. Butasinglemanrises mandated thehuntingof all hairinthe In theyear300X,acruel dictatorhas BOBOBO-BO BO-BOBO 13+ •#9781427815804208pgs$8.24 Vol. 2 13+ •#9781427815798192pgs$8.24 Vol. 1 new vampire bride... seems tohavehiseyessetonKiyofor including thehandsomeKuroboshi, who already inhabited byacoupleofvampires, But shesoonfi nds outthatthemansionis thinks she’s fi nally hitastreak ofgoodluck. name. Whensheinheritsamansion,Kiyo to becomealawyerandclearherfather’s Kiyo isastrugglingstudentwhostrives 16+ •#9781595824448176pgs$7.46 murders andbringdowntheWong family. Hagi astheytrytofi nd thesource ofthe works withamysteriouscelloplayernamed hunting RedShieldorganization,Nishi into anuneasyalliancewiththeChiropteran- abandoned KowloonWalled City. Forced being completelydrainedofbloodinthe murder victimslikethebodiesofthose offi cer, NishiTatsuyoshi hasneverseen In hisyearsasaHongKongpolice KOWLOON NIGHTS BLOOD+ More volumesalsoavailable! 13+ •#9781421528090192pgs$7.49 Vol. 31 13+ •#9781421523880192pgs$7.49 Vol. 30 13+ •#9781421523873208pgs$7.49 Vol. 29 13+ •#VIZ1591164419200pgs$5.96 Vol. 1 protect thoseheloves. fi ll-in, hemustbattlemonstrous Hollowsand last drop ofherenergy. Nowhertemporary much tohersurprise,Ichigoabsorbsevery to lendIchigosomeofherpowers,but who displaypsychicenergy, Rukiaattempts Hollow, anevilspiritthatpreys onhumans the mysteriousSoulSociety. Whilefi ghting a Rukia Kuchiki,asoulreaper andmemberof nearly asmuchhiscloseencounterwith ghosts, butthisabilitydoesn’t changehislife Ichigo Kurosaki hasalwaysbeenabletosee BLEACH More volumesalsoavailable! 17+ •#9781595824431232pgs$14.96 Vol. 22:Footsteps 17+ •#DHGN2395136pgs$11.21 Vol. 1:BloodofAThousand thousand hasspilled! his questwon’t enduntilthebloodofa taking revenge onherparents’ killers...and begins whenayounggirlseekshishelpin must slayonethousandevilmen!Hisquest of thiscurseandendhislifemisery, he been cursedwithimmortality. To ridhimself Manji, aronin warrioroffeudalJapan,has IMMORTAL BLADE OF THE More volumesalsoavailable! 17+ •#9781421536293272pgs$9.74 Vol. 9 17+ •#9781421513829216pgs$9.74 Vol. 1 of theBlackLagoon! along theway-youcancountoncrew you don’t mindalittleproperty damage But ifyou’vegotadeliverytomake-and mercenaries, it’s hard toknowwhotrust. cartels, crazedassassins,andruthless mafi a, Chinesetriads,Columbiandrug In thedangerous underworldoftheRussian BLACK LAGOON Released 7/13/10 Released 6/1/10 Orfi na ©2005KITSUNETENNOUJI/FUJIMISHOBO. out thetruepurposeoftheirdeadlypact. game stopsbeingfunwhenthekidsfi nd they havetodoissignalittlecontract.The robot againstahorde ofalieninvaders.All This game,heexplains,pitsalonegiant new videogame.Soundslikefun,right? a strangemanwhoinvitesthemtoplayan into anearbyseasidecave.There theymeet One summer, 15kidsinnocentlywander BOKURANO: OURS 13+ •#9781421531281192pgs$7.49 Vol. 4 13+ •#9781421531274192pgs$7.49 Vol. 3 13+ •#9781421521947200pgs$5.99 Vol. 2 13+ •#9781421502724192pgs$5.99 Vol. 1 as theyleadtheirhilariousrebellion. Bo-BoBo andhissentientsidekicksnacks ends. Followthenonsensicaladventures of prehensile hairsofhisshnoztomostlethal master ofFisttheNoseHair, usesthe 17+ •#9781421532035200pgs $7.49 Vol. 1 locked insuchacrazyrole reversal? lady. Isromance evenpossible foracouple after hoursheinsistsontreating herlikea knew asachild.Atworkhe’s atyrant,but realizes he was theyoungservantboyshe him inadvertentlycallher“milady,” she anyone elseinthecompany!Afterhearing her eccentricbossisharder onherthan family. Shejoinsareal estatecompany, but Choko Kuzeisthedaughterofabankrupt BUTTERFLIES, FLOWERS N/R •#9780759531192 Vol. 2 N/R •#9780759531222192pgs$9.74 Vol. 1 key tomakingRincomeoutofhershell? But islivingwithanovergrown teenagerthe spontaneity, Daikichi decidestoadopther! who refuses tosayaword. Inafi t ofangry them wantsanythingtodowiththelittlegirl, rest ofthefamilyisshocked,andnotone much youngerlover!Needlesstosay, the the oldmanhadanillegitimatechildwitha bachelor Daikichiisfl oored todiscoverthat grandfather’s funeral, thirty-something tohisfamily’sReturning estateforhis 13+ •#9781401218850 Vol. 4 13+ •#9781401218843162pgs$7.49 Vol. 3 13+ •#9781401218836162pgs$7.49 Vol. 2 13+ •#9781401218829162pgs$7.49 Vol. 1 been abletofi gure outhowtorun. powerful, ancientmechthatnoonehas he’s intheway-untilhecomesacross a mechanized battlesuits.Arrow justfeelslike neighboring kingdominanattackwithgiant, is Zess,theguyleadingarmyofa happen tobeoldcollegefriends,butso the machinesrun.Still,KingandQueen quartz, theenergysource thatmakesallof who lackstheinherent abilitytopowerup Arrow istheonlyoneinhisworld Rygart N/R •#9781897299913128pgs$21.95 Hardcover hybridity permeatesthroughout. simplifi ed tonearabstraction;thethemeof between adensecityandcountryside through acomplexlandscapethatoscillates follows itsprotagonists alongascootertrip their equallybizarre environs. TheBoxMan that emergefrom oneanotheraswell whose denizensare zoomorphiccreatures Enter thestrangeworldofImiriSakabashira, BOX MAN 16+ •#9781421533612200pgs$9.74 Vol. 1 Released 6/8/10 Released 9/30/10 Released 8/10/10 Released 4/27/10 240 200 pgs•$9.74 pgs•$7.49 16+ •#9780316077354192pgs $8.24 Vol. 3 16+ •#9780759529243192pgs $8.24 Vol. 2 16+ •#9780759529236192pgs$8.24 Vol. 1 demonic miniononcampus! themselves face-to-facewithamurderous But onthefi rst dayofschool,thetwofi nd go wrong with herbestfriendatside! like asure bet. Afterall,nothingcanpossibly clothes forherkittyKansuke,Matabiseems Hayakawa, whosefavoritehobbyismaking bring theirpetcatstothedorms.ForYumi At MatabiAcademy, studentsare allowedto CAT PARADISE More volumesalsoavailable! 13+ •#9781421528861200pgs$7.49 Vol. 35 13+ •#9781421528854200pgs$7.49 Vol. 34 13+ •#9781421528847200pgs$7.49 Vol. 33 13+ •#9781421522005192pgs$7.49 Vol. 32 13+ •#VIZ1591163277192pgs$7.46 Vol. 1 P.I. fathersolvemurder cases. “Conan” andhelpsRachel’s incompetent to adolescence,Jimmytakesonthename grade schooler!Whilewaitingtoberestored awakens, he’s beentransformed intoapuny man andendsupunconscious.Whenhe from acase-untilhefollowssuspicious Rachel Moore. NothingcankeepJimmy his childhoodfriendandalmost-girlfriend minds, buthegetshisreality checksfrom Jimmy Kudoisoneofhisschool’s best CASE CLOSED 13+ •#9781595825223 Omnibus 1 the Earth. of themissingcards before disasterbefalls the Cardcaptor; hermission:tocollectall so waslifeassheknewit.NowSakurais however, theClowCards were gone-and her father’s library. Whensheopenedit, Sakura Kinomotodiscovered thebookin One fatefulday, ayounggirlnamed deck ofcards calledtheClowCards. enchantmentstocreateEastern amagical sorcerer mixedWesternwizardry with Once uponamagicnight,anEnglish 16+ •#9781569701843200pgs$12.95 Released 6/9/10 meek. What’s holdinghimback? realizes thatKeitoisextremely shyand a great relationship. Thatis,untilSerizawa it seemslikethiscouldbeabeginningof meet more andmore ofteninthebookstore, love atfi rst sightforSerizawa.Asthesetwo and intense-eyedman,inthestore. Itwasa young man,spotsKeito,aimmenselytall Serizawa, ashort,comical,andadorable beginning. Abookstore employee, They justlookoddtogetherfrom the CAFÉ LATTE RHAPSODY 13+ •#9781421531908176pgs$7.49 Vol. 2 13+ •#9781421531892192pgs$7.49 Vol. 1 to himthathe’s theonesheloves? her loveconfession.CanMikugetthrough offers himselfupasapracticepartnerfor unaware thathe’s theobjectofheraffection, chocolates forValentine’s Day. ButKyohei, try tellingKyoheiherfeelingsbygivinghim anygirlintoacactus!Mikudecidesto turn Falling inlovewithacluelessboywould CACTUS’S SECRET 17+ •#9781421532059200pgs$7.49 Vol. 3 17+ •#9781421532042200pgs$7.49 Vol. 2 Released 6/1/10 Released 6/1/10 Released 7/13/10 Released 7/13/10 576 pgs•$14.99 ALL •#9781421527581176pgs$5.99 Vol. 1 both haveafl air forfashion! Mimi issillyandspoiledrotten -butthey grade. Chocoisseriousandreliable, while Meet ChocoandMimi,bestfriendsineighth CHOCO MIMI 16+ •#9781595825148720pgs$18.71 Omnibus 2 16+ •#9781595824516720pgs$18.71 Omnibus 1 emotions andfree will? built tohavetheriskiestfunctionsofall:real one oftherumored -persocoms to getalongintheeverydayworld.Isshe Hideki fi nds himselfhavingtoteachChihow “Chi.” Insteadofbeinghisdigitalassistant, it, Hidekifi nds shecanonlytosaytheword Taking thecuterobot homeandactivating persocom seeminglydiscarded inanalley. trying togetintoaTokyo university, fi nds a Poor studentHideki,fresh off thefarmand CHOBITS 16+ •#9781421529202320pgs$11.21 Vol. 3 16+ •#9781421529196320pgs$11.21 Vol. 2 16+ •#9781421529141320pgs$11.21 Vol. 1 disappearance oftheoceans’fi sh. as they’re sweptupinthemysteryof aware ofwhatthechildren are experiencing work attheaquariumare onlydistantly from theseaasshedoes.Theadultswho dugongs andhearthesamestrangecalls there, UmiandSora.Theywere raisedby and thetwomysteriousboysshemeets Now shefeelsdrawntoward theaquarium at theaquariumwhere herdadworked. When Rukawasyounger, shesawaghost CHILDREN OF THE SEA ALL •#9781934287859 Vol. 2(Color) N/R •#9781934287811168pgs$10.46 Vol. 1(Color) allowed intheirbuilding... But theirleaseexplicitlystatespetsare not is fi lled withsomethingweallcancherish. Yamadas. Everymomentoftheirdailylife soon undertheprotection andcare ofthe what hither, thelittlekittyispickedupand lost andalone.Butbefore sheevenknows a leisurely stroll withherfamily, fi nds herself kittenwho,on Chi isamichievousnewborn CHI’S SWEETHOME 16+ •#9780316077378 Vol. 5 16+ •#9780316077378192pgs$8.24 Vol. 4 Released 6/15/10 Released 9/30/10 Released 5/31/10 on RightStuf.com! Find evenmoreitems Don’t seewhatyouwant? Released 5/26/10 Released 8/3/10 Released 6/1/10 176 192 pgs•$10.46 pgs•$8.24 PICK SSTAFF P T I A C F K F 800.338.6827 books.rightstuf.com the malecharactersofCodeGeassand The Knightanthologyseriesfocuseson KNIGHT 13+ •#9781604962048180pgs$8.24 Vol. 5 13+ •#9781604961621180pgs$8.24 Vol. 4 13+ •#9781604961614164pgs$8.24 Vol. 3 13+ •#9781594099809180pgs$8.24 Vol. 2 13+ •#9781594099793180pgs$8.24 Vol. 1 beginning ofNunnally’s nightmare... forces ofBritannia.Butthisisonlythe and engagesinaviolentbattlewiththe pilot oftheKnightmare frameMarkNemo like energyform“Nemo,”Nunnallybecomes the aftermathofbecomingonewithdoll- power insteadofherbrother Lelouch?In What ifNunnallyhadacquired theGeass NIGHTMARE OFNUNNALLY More volumesalsoavailable! 13+ •#9781604962031180pgs$8.24 Vol. 7 13+ •#9781604961607180pgs$8.24 Vol. 6 13+ •#9781594099731180pgs$7.49 Vol. 1 including hisboyhoodfriendSuzaku! destroying anywhostandsinhispath- the ruthlessterrorist knownonlyasZero, of Geass!Hedonsamaskandbecomes power tocontrol people’s minds-thepower meets amysteriousgirlwhogiveshimthe he can’t changeanything.Thatis,untilhe butnowhe’sgovernment, acceptedthat As aboyLelouchvowedtocrushhisown LELOUCH OFTHEREBELLION CODE GEASS 16+ •#9780345520999 Vol. 1 their lives. He bringscriminalstojusticebyeliminating and Rei,aself-proclaimed “Code:Breaker.” student wholovesfoodandmartialarts, follows thelivesofSakura,anordinary Blending horror andaction,thisseries CODE:BREAKER More volumesalsoavailable! 16+ •#9781421534152192pgs$7.49 Vol. 16 16+ •#9781421531496200pgs$7.49 Vol. 15 16+ •#VIZ1421506181208pgs$5.99 Vol. 1 blood withmonster’s blood. transformed themselvesbymixingtheir are half-humans,half-demonswhowillingly who are almostimpossibletokill.Claymores who disguisethemselvesashumansand village todestroy Yoma, monsters sword shecarries-travelsfrom medieval A Claymore -afemalewarriornamedforthe CLAYMORE ALL •#9781421529004184pgs$5.99 Vol. 4 ALL •#9781421527604184pgs$5.99 Vol. 3 ALL •#9781421527598200pgs$5.99 Vol. 2 Released 7/27/10 Released 6/1/10 208 pgs•$8.21

31 BOOKS BOOKS 32 books.rightstuf.com 800.338.6827 More volumesalsoavailable! Bleach © 2001 by /SHUEISHAInc. Bleach ©2001byTite shadow, butthatchanges when Shinkai Akito hasalwaysbeeninhis olderbrother’s CROSS XBREAK More volumesalsoavailable! 13+ •#9781421527970176pgs$7.49 Vol. 13 13+ •#9781421527963208pgs$7.49 Vol. 12 13+ •#VIZ1421501406192pgs$6.74 Vol. 1 decides tostartplayingoffense. some connectionsatCrimsonField,Nobara from herfeisty AuntMomoko,whohas assistance her daughteroff thecourt.With her motherwillstooptodirtytrickskeep outthat top-notch volleyballteam,itturns Crimson FieldHighSchool,knownforits No thanks!WhenNobaratransfersto family’s old-fashionedJapanese restaurant. role ofmistress, serving richpatrons ather Nobara’s familywantshertoinheritthe CRIMSON HERO 17+ •#9781401221034 Vol. 12 17+ •#9781401221010128pgs$5.99 Vol. 11 17+ •#9781401221027128pgs$5.99 Vol. 10 17+ •#9781401217150128pgs$5.99 Vol. 1 neither are you! Shinchan’s verbaloutbursts... andnow, his strugglingparents. Nooneissafefrom and bodilyfunctionsmakelifestressful for comments andobsessionwithbodyparts whenever he’s around. Hisinappropriate He’s rude,he’s crude,andadultstremble CRAYON SHINCHAN 13+ •#9781604962192200pgs$8.24 Vol. 1 of mangaartists. presents sidestoriesbyaneclecticgroup Released 5/19/10 Released 6/1/10 Released 8/31/10 Released 5/4/10 128 pgs •$5.99 16+ •#VIZ1421506238208pgs $5.99 Vol. 1 destroy allhumankind. uses thedemonstothencarryouthisgoal: devastation anddespair. Thephantom into ahuman’s soulduringamomentof by a1,000-year-old phantom,isimplanted down andkillakuma.Anakuma,generated enormous weaponwhichheusestohunt his hand.Thecrossarmintoan turns is ateenagercursedwithcross markon In late19th-centuryEngland,AllenWalker D.GRAY-MAN 16+ •#9781421531953224pgs$7.49 Vol. 3 16+ •#9781421531946200pgs$7.49 Vol. 2 16+ •#9781421531939192pgs$7.49 Vol. 1 him ascompetitionforIkeshiba’s attention... into anidolhimself!Too badRimaonlysees Hisayoshi perfect opportunity-byturning Rima’s formeragentIkeshibagiveshimthe chance tomeetheragain.Thatis,until Living worldsapart,he’llneverhavea Fujio, hecan’t stopthinkingabouther. accidentally bumpsintoteenidolRima wasn’t lookingforlove.Butafterhe Sixteen-year-old Hisayoshi“Kumi”Tajima CROWN OFLOVE 16+ •#9781605100265200pgs$10.99 Vol. 3 16+ •#9781933617756200pgs$10.99 Vol. 2 16+ •#9781933617749200pgs$10.99 Vol. 1 Akito’s brother! who seemstoknowalittletoomuchabout of amysteriousbenefactornamedNeon- have nothingbuttheirwitsandthehelp a fewsecrets, AkitoandhisfriendYaya warlocks, poisonousbugs,andmore than heard of!Suddenlytrappedinaworldfullof though it’s notany“abroad” he’s ever offers tosendhimstudyabroad... Released 8/3/10 Released 5/4/10 BLEACH More volumesalsoavailable! 16+ •#9781401218928162pgs$7.49 Vol. 3 16+ •#9781401218911162pgs$7.49 Vol. 2 16+ •#9781401218904162pgs$7.49 Vol. 1 what Toyama needstocrackthecase! student’s disturbingvisionsmayprovide just the demonsinsideofpeople.Thisstrange a troubled youngmanwhocanactuallysee to occupyalotofToyama’s time.Makotois body. Butthere’s onestudentwho’s going the mysteryistestedbyrowdy student school murder. Hisdeterminationtosolve undercover tofi nd outthetruthabouta Toyama, akind-hearted detective,goes DEKA KYOSHI 16+ •#9781427817426192pgs$8.24 Vol. 2 16+ •#9781427817419215pgs$8.24 Vol. 1 and brutalgameofprisonsurvivalbegins! known asDeadmanWonderland. Aninsane to deathandsentthebizarre prison innocent ofthecrime,Gantaissentenced and hisfateischangedforever. Although until thedayhisentire classismurdered fi nally beguntoliveanormallife...Thatis, the disasterhavefaded.GantaIgarashihas Earthquake, andthepeople’s memoriesof It’s beentenyearssincetheGreat Tokyo WONDERLAND DEADMAN 16+ •#9780316073301 Omnibus partners knowlittleabout. is theassassinBlack,amanwhoseown The mostsoughtafteroftheContractors resulting inviolentclashesacross thecity. seek tousetheirpowerforownends, makes themtargetsfororganizationswho enabling themtokillatwill.Theiramorality have specialpowersandlackempathy, stars linkedtoContractors,peoplewho have alldisappeared, replaced bystrange The celestialbodiesoftheTokyo nightsky DARKERBLACK THAN 16+ •#9781934876817 Vol. 8 16+ •#9781934876800 Vol. 7 16+ •#9781934876749208pgs$10.99 Vol. 6 16+ •#9781934876657208pgs$10.99 Vol. 5 16+ •#9781933164809192pgs$9.99 Vol. 1 terrorists are plottingtoassassinateher! announcing theexistenceofvampires, the eveoflandmarkpress conference become thehaventoallvampires! Now, on district” off thecoastofJapanthatisto gained theauthoritytocreate a“special national debtofJapanand,insodoing, vast wealth,she’s paidoff theentire gross of allvampires, wantschange.Usingher After millenniainhiding,MinaTepes, theruler VAMPIRE BUND DANCE IN THE More volumesalsoavailable! 16+ •#9781421535432192pgs$7.49 Vol. 18 16+ •#9781421531601200pgs$7.49 Vol. 17 16+ •#9781421530383200pgs$7.49 Vol. 16 16+ •#9781421527741192pgs$7.49 Vol. 15 Released 6/16/10 Released 6/8/10 Released 9/30/10 Released 6/30/10 Released 8/3/10 Released 5/4/10 DETECTIVE CONAN SEE CASECLOSED Released 6/30/10 384 208 208 pgs•$14.24 pgs•$10.99 pgs•$10.99 800.338.6827 books.rightstuf.com Daisuke Niwaisanordinary, ifslightly DNANGEL N/R •#9788492444298208pgs $22.99 Vol. 2 N/R •#9788492444281200pgs$22.99 Vol. 1 start toform... somehow subtlychanged.Thequestions memories ofhischildhoodreturnbutare make senseofhispredicament, hisadult and knowledgeintact.Ashestrugglesto 8th grader-butwithallhisadultmemories that heiscatapultedbackintohislifeasan him tohismother’s grave,andit’s there childhood hometown.Hisfootstepstake himself onthewrong trainheadingforhis home from abusinesstripwhenhefi nds Middle-aged Hiroshi Nakaharaisonhisway NEIGHBORHOOD DISTANT ALL •#9781421532547192pgs$5.99 Vol. 2 ALL •#9781421532530192pgs$5.99 Vol. 1 the world? them before Dr. Zusesthemtotakeover dinosaurs needMax’s help, butcanhesave there are afewwhohaveresisted. The by theevilDr. ZandhisAlphaGang,but of themightybeastsare beingcontrolled thatmost new dinosaurfriend,Maxlearns to understanddinosaurs.From King,his of dinosaurs.There hediscoverstheability he istransportedbackintimetotheage When MaxTaylor discovers astonetablet, 13+ •#9781401224417 Vol. 2 13+ •#9781401224400162pgs$7.49 Vol. 1 to recruit hermightjustdriveaway. from theworsttobest,buttheirefforts get hertojoinandhelptransformthem baseball. Theschoolteamisdeterminedto action, Tsubura reveals herhiddentalentfor her classroom windowandshespringsinto in. Butwhenanerrantballshattersthrough her newschool,allshewantsistoblend and isready forsomepeaceandquiet.At Tsubura hasjustmovedtothecountryside DIAMOND GIRL 16+ •#9781569700815200pgs$12.95 and beginstofallinlovewithhim...?! of itwhenhereunites withthefortune-teller destiny?! Andlater, whatisKoumatomake that Koumawillsoonmeetthemanofhis fortune-teller makesaboldprediction: happens whenastrangeyethandsome king ofgettinghisheartbroken. Butwhat grating onpeople’s nervesandhe’s the love wherever hegoes,buthe’s constantly Kouma isvirtuallypredisposed tofallingin DEVIL INSIDE 17+ •#9781421527468208pgs$9.74 Vol. 5 17+ •#9781421527451200pgs$9.74 Vol. 4 17+ •#9781421527444192pgs$9.74 Vol. 3 17+ •#9781421527437200pgs$9.74 Vol. 2 17+ •#9781421527420200pgs$9.74 Vol. 1 from hissoul-devouringheavymetalsound. not eventhedenizensofhellitselfare safe he transformsintohisalterego,KrauserII, Paris, butwhenthemakeupgoesonand dreams ofacousticguitarsandtripsto music scene?Deepdowninside,Soichistill demonic deathmetalbandontheJapanese City, themostscandalous, outrageous,and so what’s hedoingplayinginDetroit Metal and startingupabubblegumpopband, Soichi Negishidreamed ofmovingtoTokyo Released 8/17/10 Released 6/8/10 162 pgs•$7.49

33 BOOKS BOOKS 34 16+ •#9781569701119200pgs$12.95 Released 7/7/10 in hisshow. Mitsuru, hasdecidedtocastbothofthem of theshow“CasualLover,” isalsoafter complicated, Ohtaki,whoistheproducer toying withYuki! To makemattersmore the otherwayround -Mitsuru’s theone named MitsuruSawaki,butit’s actually to betoyingwithayoung,innocentactor one cantaketheireyesoff of.Heseems Yuki Yamamuro isatalentedyoung actorno DOUBLE CAST More volumesalsoavailable! 17+ •#9781401222246226pgs$9.68 Vol. 6 17+ •#9781401214357164pgs$9.68 Vol. 1 existence ofayoungwomanwarrior. of thosewhoare scandalizedbythevery of Arc, shemustdealwiththeprejudices tradition andenlistinthemilitary. LikeJoan home, andDorothea isprepared todefy attacked, allthemenrisetodefendtheir her cloistered existence.WhenNaudarsis has alwayswantedtoseetheworldbeyond Dorothea isoneofthesechildren, andshe children holdarevered andprotected status. In themedievaltownofNaudars,albino DOROTHEA 17+ •#9781421533766160pgs$9.74 Vol. 2 17+ •#9781421533636176pgs$9.74 Vol. 1 igniting awarbetweentwoworlds. he sendsacrew of“cleaners”intotheHole, But whenEn,theheadSorcerer, getsword, who canundohiscurseandkillingtherest. sorcerers intheHole,searching fortheone best friend,Nikaido,Caimanishuntingdown completely immunetomagic.Alongwithhis Caiman hasonekeyadvantage:he’s now a specterofmanlivinginsidehim.But previous life.Addingtothemystery, there’s head andlefthimwithnomemoryofhis A sorcerer cursedCaimanwithareptile 17+ •#9781421527819204pgs$9.74 Vol. 3 17+ •#9781421527048200pgs$9.74 Vol. 2 17+ •#9781421527031200pgs$9.74 Vol. 1 17+ •#9781421527024208pgs$9.74 Vol. 0:Prelude had foraprice. all thesecrets -butsecrets thatcanonlybe dangerous sectorbelowthecitythatholds drawn tothe“Underground,” thedarkand for truth,theyandothersare inexorably intent. Drivenbytheirghostsandadesire non, whosereckless facadehidesaserious Badou: ahired gunforpettyjobs,legaland his neckandadisturbingtalentformayhem. man withamysteriousmetalcollarboltedto Haine, the“StrayDog”:acipherofyoung CARNAGE DOGS: BULLETS& More volumesalsoavailable! 13+ •#9781427816269192pgs$8.24 Vol. 13 13+ •#MM159182799X184pgs$7.49 Vol. 1 Risa tofallinlovewithhim... cure forthiscrazinessisifDaisukecanget he transformsbackintoDaisuke.Theonly when Darkseeshiscrush,Risa’s twinRiku, ego, thephantomthief,Dark.Unfortunately, his crush,Risa,hetransformsintoalter family forthree hundred years:whenhesees “condition” thathasplaguedthemeninhis fourteenth birthday, hecomesdownwitha unlucky, middleschoolstudent.Onhis Released 8/17/10 books.rightstuf.com 800.338.6827 to becomeaproper Britishmaid.Emma rescued from alifeofdestitutionandraised England,ayoung girlis In Victorian-era EMMA More volumesalsoavailable! 16+ •#9781427806284192pgs$8.24 Vol. 11 16+ •#MM1598165984184pgs$7.49 Vol. 1 killing themselves...oreachother? Agency joinforces torescue herwithout agents oftheElementalGeladeProtection her ontheblackmarket.CanCoudand is captured byamanwhointendstosell is evenmore prizedthanhethought,she fi ghting machine.Asherealizes thatRen that reacts withahumantobecome Ren, an“EdyllRaid,”isalivingweapon Van Giruetdiscoversamostunusualbounty: After aroutine raid,rookie airpirateCoud ELEMENTAL GELADE 16+ •#9781569701133200pgs$12.95 across theroom?! accidental contactsendshimskittering will Fujino’s fellowstudents react wheneach Takie’s handsgiveshimaliteraljolt.How for theshockofhislifewhenabrushwith appendages isonething,butFujinoin Hours spentadmiringanattractivesetof hands ofhisclassmateandtutor, Takie. for hands-specifi cally, thesleek,beautiful starting torevolve around apeculiarfetish High schoolstudentFujino’s daydreams are ELECTRIC HANDS N/R •#9781897299746840pgs$29.95 and, attimes,stylisticrivals. whom Tatsumi eventuallybecamepeers his idol,mangaartistOsamuTezuka -with of followingintheconsiderablefootsteps of mid-twentieth-centuryJapan.Hedreams await himinthecompetitivemangamarket health, andtheinnumerablepitfallsthat marriage, hisjealousbrother’s deteriorating fi nancial burdens andhisparents’ failing in protagonist, Hiroshi, faceshisfather’s 1945 toJuneof1960,Tatsumi’s stand- Spanning fi fteen yearsfrom Augustof DRIFTING LIFE 13+ •#9780759531666192pgs$8.24 Vol. 1 do better! father thatanythingtheycando,she she’s determinedtoshowtheboysandher ouendan (cheerleadingsquad)member, the daughterofschool’s mostlegendary Aizome won’t takenoforananswer;as all-male territory. Butfi esty, fi inonpreviouslyabout thegirlshorning erce Rinna in theirmidst,they’re stillalittlewary though theboysare excitedtohavegirls An all-boyshighschoolgoesco-ed,and DRAGON GIRL More volumesalsoavailable! ALL •#9781421520711560pgs$13.49 Vol. 8 ALL •#9781421520704560pgs$13.49 Vol. 7 ALL •#9781421520698560pgs$13.49 Vol. 6 ALL •#9781421520681576pgs$13.49 Vol. 5 ALL •#VIZ1421520648528pgs$13.49 Vol. 1 Goku’s brother! Omnibus“Big”edition. Goku isanalien,andthevisitor, Raditz,is outer spacearrivesbearingterriblenews: Goku’s incredible strength? Avisitorfrom Son Gohan.Butwhatisthereal reason for family -he’s married,andhehasachild, Piccolo, he’s grown upandstarteda Five yearsafterdefeatingthearchdemon Son Gokuisthegreatest hero onEarth. BIG EDITION DRAGON BALL Z Released 5/31/10 Released 7/20/10 Released 4/20/10 has beenfriendswithShinji Ikari sincethey Stunning, hotheadedAsuka Langley Soryu SHINJI IKARIRAISINGPROJECT , 13+ •#9781604961874570pgs$14.99 Collection 2(Vols. 4-6) 13+ •#9781604961867552pgs$14.99 Collection 1(Vols. 1-3) change bothoftheirdestinies. to helpher, thatwill thetwobeginajourney a smittenRentonliterallyfallsoverhimself Eureka emergesandasksforrepairs. When the skyandabeautifulyounggirlnamed Operation) craftcalledNirvashfallsfrom One day, alargeLFO(LightFinding an extreme formofaerialhoverboarding. thing thatmakeshimhappyiswhenhelifts, who istired ofhismonotonouslife.Theonly Renton Thurstonisayoung14-year-old EUREKA SEVEN More volumesalsoavailable! 16+ •#9781401220723240pgs$7.49 Vol. 10 16+ •#1401211321192pgs$7.49 Vol. 1 from evercomingoutintheopen. rules oftheirsocietyprevent theirrelationship shares herfeelings, butthestrict William family, andimmediatelyfallsinlovewithhim. theeldestsonofawealthy meets William, Eureka Seven©JinseiKATAOKA 2006©KazumaKONDOU2005BONES/Project EUREKA-MBS. PICK SSTAFF P T I A C F K F 16+ •#VIZ1591167523208pgs $5.99 Vol. 1 crushing actionandslapstick comedy! cast ofcharacters,enjoythis manga’s bone- awacky and hislightning-fastspeed. With football teamalready hashiseyeonSena anymore. Unfortunately, thecaptainof school andhe’s vowednottogetpickedon Sena Kobayakawaisabouttostarthigh EYESHIELD 21 More volumesalsoavailable! 17+ •#9781421531618216pgs$7.49 Vol. 21 17+ •#9781421527826208pgs$7.49 Vol. 20 17+ •#VIZ156931988X200pgs$7.46 Vol. 1 smitten withhim. Il Palazzo,andExcel,theteenagedgirl global dominationwithjusttwomembers: small, becauseACROSSbeginsitsbidfor Japan. It’s agood thing he’s starting based somewhere deepbeneathFukuoka, boy leaderofACROSS,asecret society the planofIlPalazzo,haughtypretty- Today thecity-tomorrow, theworld!That’s 16+ •#9781595825209192pgs$7.49 Vol. 5 16+ •#9781595824547192pgs$7.49 Vol. 4 16+ •#9781595824479192pgs$7.46 Vol. 3 16+ •#9781595823779192pgs$7.46 Vol. 2 16+ •#9781595823212184pgs$7.46 Vol. 1 an eyeontheserelationships? more. Butwhyare somanypeoplekeeping to bejustfriendswithShinjiorsomething Rei, Asukaneedstofi gure outifshewants class! WhenShinjistartstogetcuriousabout beautiful, brilliantReiAyanami showedupin they’d staytogether-untiltheday were little.Shealwayssortofassumed Released 6/9/10 EUREKA SEVEN More volumesalsoavailable! completely? by theFestum,orwilltheybedestroyed continue towithstandthesebrutalattacks qualifi ed. CantheyouthofTatsumiya pilots, butKazukiisthemostskilledand on theislandmustbetrainedasFafner of continuousattacks,manytheyouths made bytheenemy, Festum.Asaresult and peaceful-untilasuddenattackis The smallislandofTatsumiya seemscalm DEAD AGGRESSOR FAFNER: More volumesalsoavailable! 16+ •#9781421531625192pgs$7.49 Vol. 32 16+ •#9781421529271192pgs$7.49 Vol. 31 16+ •#9781421528137192pgs$7.49 Vol. 30 16+ •#9781421527765200pgs$7.49 Vol. 29 haunted byherparents’ fi ery death.Three a promising rookie fi re investigator, still Firefi ghter academy studentNanaseis NANASE FIRE INVESTIGATOR 13+ •#9781427817594 Vol. 8 13+ •#9781427816290192pgs$8.24 Vol. 7 13+ •#9781427816283192pgs$8.24 Vol. 6 13+ •#9781427810373196pgs$7.49 Vol. 1 that heisabouttobecomeitsfocalpoint... is wagingamongsomechosenmagi,and of justice.Littledoesheknowthatawar stepfather’s footstepsandbecomeahero wants nothingmore thantofollowinhis was adoptedbyamagusman.Nowhe and amateurmechanicShirou Emiya When hewaslittle,highschoolstudent FATE/STAY NIGHT More volumesalsoavailable! 13+ •#9780345519924208pgs$8.21 Vol. 11 13+ •#9780345514578208pgs$8.21 Vol. 10 13+ •#9780345512338208pgs$8.21 Vol. 9 13+ •#9780345510402208pgs$8.21 Vol. 8 13+ •#9780345501332208pgs$8.21 Vol. 1 have whatittakestobeahero? boy shemetonhertravels,butdoeshe Her onlyhopeforrescue isNatsu,astrange of dangerous piratesanddeviousmagicians. ambitions landherintheclutchesofagang for themostpowerfulwizards, buther Lucy wantstojointheFairyTail, aclub 16+ •#9780345522269208pgs$8.21 Vol. 1 Fairy Childbegins! powers -andherquestastheLegendary of timebefore shediscovershersecret to happenaround her. It’s onlyamatter grade andstrangethingsare starting mysterious pendant.Nowshe’s infourth of aschoolforfosterchildren, wearinga As ababy, RunaRindowasleftinfront FAIRY NAVIGATOR RUNA 13+ •#9781569701157200pgs$9.95 Vol. 1 Released 6/29/10 Released 5/25/10 Released 7/7/10 Released 7/6/10 Released 6/22/10 bonus stuffyouadded.” -ThomasC. “You guys reallyarethebest,andIalsoenjoy little 192 pgs•$8.24 More volumesalsoavailable! 13+ •#9781401208844224pgs$7.49 Vol. 15 13+ •#1401205194232pgs$7.49 Vol. 1 Eroica with Love.” crime scenewithacard signed“From years tocatchthemanwhoclaimseach NATO intelligenceoffi cer -hastriedfor Klaus HeinzvondemEberbach,aGerman artthief.Hisnemesis-Major international alter egoEroica, Europe’s mostwanted British aristocratDorianRedGloriaandhis with Lovedepictstheadventures of Set inContinentalEurope, From Eroica WITH LOVE FROM EROICA 16+ •#9780345520203 Vol. 3 16+ •#9780345516312192pgs$8.21 Vol. 2 16+ •#9780345516244192pgs$8.21 Vol. 1 behind thosenerdy glasses. outthatAkihikoishidingasurprise turns and sister!Andifthatisn’t badenough,it must liveunderthesameroof, asbrother they’ve becomesiblingsbymarriage-and Akihiko, the“Four-Eyed Prince.”Butnow Sachiko iswildlyattractedtothequiet,cool FOUR-EYED PRINCE 16+ •#9781421532424200pgs$7.49 Vol. 2 16+ •#9781421532417200pgs$7.49 Vol. 1 her sleeve-shehassuperpowers! disposal. However, Rikohasonetrickup but hehasallthatmoneycanbuyathis o’clock thenextday, he’llgiveuponher, an answer!IfRancan’t capture herbyfi ve her ashiswife,andhe’s nottakingnofor most powerful17-year-old inJapanwants that herlifeisnowhis.Ran,therichest, her classroom carryingagunandtellingher school lifewhenRanTachibana burstsinto Riko Sassokuistryingtoleadanormalhigh FLOWER IN A STORM More volumesalsoavailable! 16+ •#9781421522043192pgs$7.49 Vol. 33 16+ •#VIZ1591160669184pgs$7.46 Vol. 1 the abilitytocontrol fi re! But hehasanaceuphissleeve:harbors howtonavigatetheworldofninjas. learn swears toprotect her!NowReccamust meets amysteriousgirlnamedYanagi and is unexpectedlythrown foraloopwhenhe who hopestobecomeareal ninja.Hislife Meet ReccaHanabishi-ahighschooler FLAME OFRECCA 16+ •#9781401220471 Vol. 5 16+ •#9781401220464192pgs$7.49 Vol. 4 16+ •#9781401220457192pgs$7.49 Vol. 3 16+ •#9781401220440192pgs$7.49 Vol. 2 16+ •#9781401220433192pgs$7.49 Vol. 1 with hisrole inherpersonaltragedy? Nanase reconcile hiswillingnesstohelpher helping hersolvefi re-related crimes.Can Now thisserialfi re-starter hasstarted responsible forthedeathofherparents. outtobethearsonist building; heturned years ago,shesavedamanfrom aburning Released 7/27/10 Released 8/3/10 Released 5/4/10 Released 8/24/10 Released 4/20/10 176 200 pgs•$8.21 pgs•$7.49 fi nd and befriendsevenCelestialWarriors, into astrangenewworld.They setoutto transports Miakaandherbest friend,Yui, The discoveryofamysterious book BIG EDITION ORIGINAL SERIES More volumesalsoavailable! 15+ •#9781421530352192pgs$7.49 Vol. 9 15+ •#VIZ1591168961200pgs$6.74 Vol. 1 fi nd thesevenCelestialWarriors! to Priestess ofGenbuinanepicjourney sucked intothestory, becomingthe of theFourGods,”sheisinsteadliterally her father’s translationof“TheUniverse schoolgirl Takiko Okuda attemptstodestroy Prequel totheoriginalseries.When GENBU KAIDEN FUSHIGI YUGI More volumesalsoavailable! 15+ •#9781421536309192pgs$7.49 Vol. 23 15+ •#9781421534138192pgs$7.49 Vol. 22 15+ •#9781421532325192pgs$7.49 Vol. 21 15+ •#VIZ1591169208192pgs$7.49 Vol. 1 who are alsopursuingthesamething... world iscrawlingwithruthlessalchemists treasure, thePhilosopher’s Stone.Butthe globe insearch oftheultimatealchemical the otherhaslosthislimbs.Theyroam the brother islockedinalivingsuitofiron, while go wildlyastray. Now, thesoulofone alchemy togranttheirdearest wish,things Edward andAlphonse,attempttoharness not betakenlightly. Whentwobrothers, world. Adangerous energywhichshould Alchemy: thepowertoalternatural FULLMETAL ALCHEMIST More volumesalsoavailable! 16+ •#AWNOV0995 •168pgs$8.99 Vol. 4 16+ •#AWNOV0803 •208pgs$8.99 Vol. 1 guy andafangirl?! wild! Canlovehappenbetweenanordinary each otherandislettingherfantasiesrun friend from middleschool,are inlovewith Takahiro andShunsukeChiba,Abe’s best -loving fangirl.Rumiisutterlyconvinced with RumiAsai,ananything-but-ordinary, young man.Freshman yearhefallsinlove Takahiro Abeisanordinary, well-adjusted FUJOSHI RUMI More volumesalsoavailable! 13+ •#9781427818157412pgs$11.24 Vol. 5 13+ •#9781427807311384pgs$11.24 Vol. 4 13+ •#MM1427806896416pgs$11.24 Vol. 1 new foreword. bonus contentsuchascolorartworkanda of theregular editionvolumesandincludes edition hardback bookencompassestwo their ChineseZodiacanimal!Eachultimate into of theoppositesex,theyeachturn greatest secret: whenhuggedbymembers well untilshediscoverstheSohmafamily’s cooking andcleaning.Everything’s going Tohru tostayintheirhouseexchangefor the teenagesquatter, theSohmasinvite the Sohmafamily. Afterstumblingupon the landshewasstayingonbelongedto tent intheforest. Littledidsheknowthat Tohru Hondawasanorphan,livingina ULTIMATE EDITION Released 6/8/10 SEE KIMINITODOKE Released 7/20/10 FROM METOYOU 800.338.6827 books.rightstuf.com 16+ •#9781427815538192pgs $8.24 Vol. 2 16+ •#9781427815521208pgs$8.24 Vol. 1 who seemstoknowhiseverysecret. thatYuukihe learns isatrainedassassin thinks he’s foundtheperfectpartner... until he runsintotheskilledandwittyYuuki, he and savingthedamselsindistress. When brother’s bodyguard agency, solving cases Memori isthepretty-boy mascotforhis GAME XRUSH More volumesalsoavailable! 13+ •#9781427807069192pgs$8.24 Vol. 12 13+ •#9781427807052192pgs$8.24 Vol. 11 13+ •#9781427807045192pgs$8.24 Vol. 10 13+ •#MM1427803196192pgs$7.49 Vol. 1 of befriendingherveryoddnewclassmates. exam” andfacetheevengreater challenge she hastobothpassthestrange“entrance eye. IfMikanwantstostaybyHotaru’s side, Alice Academyisalotmore thanmeetsthe outthat school forgeniuses.Butitturns enrolled inanexclusive,secretive private her bestfriend,Hotaru,whohasbeen Young MikanrunsawaytoTokyo following GAKUEN ALICE More volumesalsoavailable! 17+ •#9780345515858208pgs$10.46 Vol. 11 17+ •#0345492331208pgs$9.71 Vol. 1 girl certainlyhasitsadvantages! has achancetogetcloseher. Beinga that hecanchangeintoagirl,Akirafi nally Yurika. He’s alwaysbeentooshy, butnow all bad.Akirahasalwayshadacrushon a gender-bending switcheroo! Butit’s not Akira sneezes,hisentire bodyundergoes changes hislifeforever. Now, everytime school kid...untilaglitchinvideogame Akira Hatsushibaisjustyourtypicalhigh THE NEXTREVOLUTION GACHA GACHA More volumesalsoavailable! 16+ •#9781427816306192pgs$8.24 Vol. 6 16+ •#9781427815613192pgs$8.24 Vol. 5 16+ •#9781427815606192pgs$8.24 Vol. 4 16+ •#9781427815576208pgs$8.24 Vol. 1 to thedeath! who allpossessFuture Diariesinabattle his side,Yukiteru mustface12opponents ashadygirlnamedYunosurvival. With at Yukiteru hasbeendraggedintoabattleof near future ishisdeath.Unknowntohim, what hiscellphonetellshim,waitinginthe diary are from thefuture! Butaccording to herealizesmorning, thattheentriesinhis his timetypingincellphonediary. One Yukiteru isaquietboywhospendsmostof FUTURE DIARY More volumesalsoavailable! 16+ •#9781421523040600pgs$13.49 Vol. 6 16+ •#9781421523033600pgs$13.49 Vol. 5 16+ •#9781421523026600pgs$13.49 Vol. 4 16+ •#9781421522906600pgs$13.49 Vol. 1 safely. Omnibus“Big”edition. Suzaku, fi nd hertruelove,andgethome can Miakasummonthepowerofgod and wannabeempress Nuriko.Onlythen including dashingmercenary Tamahome Released 6/8/10 Released 6/15/10 Released 8/3/10 Released 6/8/10

35 BOOKS BOOKS More volumesalsoavailable! More volumesalsoavailable! 36 16+ •#9781598166149 Vol. 8 16+ •#MM1598166077 Vol. 1 unfortunately forKamishina,it’s him. only oneofthemisthetruepriest,and inauguration of...itsnewhighpriest.Clearly, Asian countrythathasjustcelebratedthe of theHighPriestDarashaal,atiny a normalboy, butheisthereincarnation Kamishina Fuutowouldliketothinkhe’s GENJU NOSEIZA 13+ •#9781569701430N/Apgs$12.95 Released 8/31/10 GARDEN SKY 17+ •#9781595825261 Vol. 12 17+ •#9781595825186224pgs$9.74 Vol. 11 17+ •#9781595824592224pgs$9.74 Vol. 10 17+ •#9781595824523232pgs$9.71 Vol. 9 17+ •#9781595823830224pgs$9.71 Vol. 8 17+ •#9781595823731224pgs$9.71 Vol. 7 17+ •#9781593079499224pgs$9.71 Vol. 1 of death. do withtheirlivesismakethemplaygames And whatthisorbcalled“”intendsto you dowithyournewlivesisuptome!” a nastymessage:“Your livesare over. What reanimated... bysomekindofalienorbwith still... alive?Orsemi-alive?Maybeit’s What awaste!Andyet,somehow, they’re while savingthelifeofadrunkenbum. was beingstruckdeadbyasubwaytrain, The lastthingKeiandMasaruremember GANTZ Released 8/3/10 Released 7/28/10 Released 5/26/10 books.rightstuf.com 800.338.6827 192 224 192 pgs•$9.74 pgs•$9.74 pgs•$4.99 MY DARLING!MISSBANCHO ALLIANCE CROSS of faith,FatherOliviertheValaria Order only as“G.”Afterexperiencingacrisis mysterious anddangerous islandknown to Earth,thedemonfoundrefuge onthe whose namecannotbespoken.Banished supremacy andcastoutthedemongod In thelegendarypast,godsbattledfor More volumesalsoavailable! 16+ •#9781421531632192pgs$7.49 Vol. 11 16+ •#VIZ1421511835182pgs$6.74 Vol. 1 “The Emperor.” who holdsherheart:ShizumasaTogu, aka members, especiallythoseofthepresident place amongthemanysecrets ofitselite She fi nds herselfstrugglingtofi council oftheexclusiveImperialAcademy. nd her an Otomiya,isappointedtothestudent the successfulOtomiyafamily. Haine,now their daughterHaineawayforadoptionto yen, theprestigious Kamiyafamilygave In returnforabusinessloanof50million GENTLEMEN’S RISTORANTE PARADISO GENTE SEE PICK SSTAFF P T I A C F K F the NewWorld forthefamilyshe’s never Young Naomileaves theFarEasttosearch GO WEST! More volumesalsoavailable! 13+ •#9781401211769192pgs$7.49 Vol. 9 13+ •#9781401211752192pgs$7.49 Vol. 8 13+ •#1401211682192pgs$7.49 Vol. 1 dollhouse inShirayuki’s bedroom. of hissubordinates setthemselvesupina observe herprogress, thePrinceandthree resolve anyunfi nished business.Inorder to Shirayuki 49daystorelive herlifeand newly deceasedarrival,thePrincegrants Hell’s fi rst dayonthejob.Smittenby a caraccidentonthenewPrinceof How aboutindeath?Shirayukidies Are there really secondchancesinlife? GO HEAVEN!! More volumesalsoavailable! 16+ •#9781421528175192pgs$7.49 Vol. 19 16+ •#9781421528168200pgs$7.49 Vol. 18 16+ •#9781421528151200pgs$7.49 Vol. 17 16+ •#9781421528144192pgs$7.49 Vol. 16 16+ •#9781421523996192pgs$7.49 Vol. 15 16+ •#VIZ1421513587216pgs$5.99 Vol. 1 wooden sword! return Japantoitsformerglory-allwitha from yakuzaanddishonorablealiens, meet. Hisgreatest wishistoprotect Japan who’ll takeonanyoddjobtomakeends “Gin” Gintokiisagoofyformersamurai guns, TVs,cars,andspaceships.Sakata must livealongsidealiens-nottomention Japan wrong samuraiinthisalternate turn: In theworldofGinTama, historytakesa GIN TAMA 16+ •#9781935429036320pgs$20.24 Vol. 2 16+ •#9781593078157176pgs$13.46 Vol. 1.5:Human-ErrorProcessor 16+ •#9781935429012352pgs$20.24 Vol. 1 the hackers’criminalends. humans tobecomepuppetscarryout machine interfaceandreprogramming who are capableofexploitingthehuman/ cybercriminals, including“ghosthackers,” craftiest andmostdangerous terrorists and Kusanagi ischargedtotrackdownthe tissue. CyborgsuperagentMajorMotoko and robots are upgradedwithhuman the enhancementofmechanicalimplants, been inexorablyblurred ashumansrely on The linebetweenmanandmachinehas GHOST IN THE SHELL 16+ •#9781421526973192pgs$7.49 Vol. 8 16+ •#9781421526966200pgs$7.49 Vol. 7 16+ •#9781421526959208pgs$7.49 Vol. 6 16+ •#9781421526942200pgs$7.49 Vol. 5 16+ •#9781421526935200pgs$7.49 Vol. 4 16+ •#9781421526928200pgs$6.74 Vol. 3 16+ •#9781421526911200pgs$6.74 Vol. 2 16+ •#9781421526904200pgs$6.74 Vol. 1 order, butbytheenemiesfrom Ohri’s past... shadowed notonlytheagentsofOlivier’s who cannotspeak.Astheytravel,are behind thelegendswithOhri,ayounggirl decides togoGandfi nd outthetruth Released 8/17/10 Released 6/15/10 Released 4/20/10 Released 8/3/10 Released 5/4/10 My Darling!MissBancho©2006MayuFujikata/, INC. Spaak, theoffi cial side-storyof Mobile Suit tale ofFereshte’s GundamMeister, Fon giving themsupport:Fereshte. Telling the operating initsshadow, too, discreetly Gundam. There’s anotherorganization all warsonEarthusingtheMobileWeapon intervene, withtheexpressed goalofending themselves “CelestialBeing”risesupto united one.Aprivateorganizationcalling The yearis2307,andtheworldnota 00F 13+ •#9781604962369190pgs$8.24 Season 2Vol. 1 13+ •#9781604961966180pgs$8.24 Season 1Vol. 3 13+ •#9781604961799180pgs$8.24 Season 1Vol. 2 13+ •#9781604961782160pgs$8.24 Season 1Vol. 1 intervention. theseGundams, itbeginsarmed With in possessionof“Gundam”mobilesuits. force. ItsnameisCelestialBeing,andit to theeliminationofwarthrough armed armed organizationappears,dedicated world ofnever-ending confl ict, aprivate only toahandfulofmajorpowers.Inthis the benefi ts ofthissystemare available solar powergenerationsystem.However, of energytointheformalarge-scale 2307. Humanityhasobtainedanewsource 00 GUNDAM, MOBILESUIT More volumesalsoavailable! 16+ •#9781427816573400pgs$11.24 Collection 5 16+ •#9781427816566400pgs$11.24 Collection 4 fi nd theirfutures inexorablyintertwined. desperate toprove hispotential,thetwo As ShuichiinsertshimselfintoYuki’s life, musician inhisplace,Shuichiiscrushed. his amateurishlyricsandputstheyoung him. WhenstoicnovelistYuki Eirioverhears high schoolstudentwithnoexperiencestop he’s notabouttoletthefactthathe’s a Shuichi isdeterminedtobearock star, and OMNIBUS EDITION GRAVITATION 16+ •#9781421532097464pgs$20.95 Hardcover school, thestudents’lives,andnature itself. malevolent spiritswhobringchaosintothe beingsvieforpowerwith the supernatural beings thatonlyhecansee.Intheother, teachers fortellingstoriesofsupernatural by hisclassmatesandreprimanded byhis worlds. Inoneworld,heisalonerridiculed Nine-year-old Yuki Tachibana livesintwo GOGO MONSTER More volumesalsoavailable! 13+ •#9781401221096194pgs$7.49 Vol. 4 13+ •#9781401220273194pgs$7.49 Vol. 1 convinced he’s herdad! she’s hissisterandthebountyhunteris a bountyhunter-andtheoutlawthinks interrupts aduelbetweenanoutlawand Things getmore twistedwhenNaomi possession willonlyruninthatdirection! the agitatedhorsethatcomesintoher the West -whichisagoodthing,because known. Hersearch takesherdeepinto Released 6/8/10 Released 4/21/10 PICK SSTAFF P T I A C F K F . friends andassociates,theymakeupthe hunters, andtogether, withsomeveryuseful two happentobeChicago’s topbounty They mightbeoddskillsforgirls,butthese shot andanexplosivesexpert,respectively. respectively. Andwhohappentobeacrack and mighthavedabbledinprostitution, American girlswhoownagunshop are tworegular Americangirls.Regular andMinnie-MayHopkins Rally Vincent BURST GUNSMITH CATS 13+ •#9781604961980180pgs$8.24 Vol. 3 13+ •#9781604961973180pgs$8.24 Vol. 2 13+ •#9781604961881170pgs$8.24 Vol. 1 Gundam 00startshere! Blood+: KowloonNights©Hirotaka KISARAGI2006and©2005Production I.G*AniplexMBS *Hakuhodo. 13+ •#9781427817303186pgs $8.24 Vol. 1 true happinesslurkjustaround thecorner? waitressing, asshe’s ahugeklutz. Butdoes outthatUruisnotexactlymeantfor turns she’s evermet!To makemattersworse,it Shindou, twoofthemostunsociableguys Café. There, shebefriendsIchirou and opportunity toworkpart-timeattheHappy Uru takeshermother’s remarriage asan 13+ •#9781569701577200pgs$12.95 Vol. 2 13+ •#9781569700853200pgs$12.95 Vol. 1 feel likepampered royalty! of makingeachandevery“sir”or“madam” Ivory, SilkandEveare chargedwiththetask cafe, andthecheerfulstaff ofShiva,Renjo, need. You see,LadyBraganzaisabutler servants attendtotheireachandevery in high-classlifestyle,where mannered for teaandcakebecomesanimmersion outing of LadyBraganza,anafternoon “Welcome home,Madam!”Forthepatrons HAPPY BOYS 16+ •#9781427816092 Vol. 2 16+ •#9781427816085212pgs$8.24 Vol. 1 folklore detective! appear before them!EnterDaisukeAsou- them tobetrue,theybecomesreality and at themomentwhensomeonebelieves But whatfewpeopleknowisthatjust Faced Fish”are supposedlyjustrumors. Man UndertheBed,”and“Human- come tolife!The“No-MouthWoman,” “The Japanese horror storiesandurbanlegends TERROR OF ALLEGORY HANAKO ANDTHE More volumesalsoavailable! 13+ •#9781604962321190pgs$8.24 Vol. 5 13+ •#9781604961911180pgs$8.24 Vol. 4 13+ •#9781604961577200pgs$8.24 Vol. 1 under theweightofagiantmonster! to havetheceilingcomecrashingdown gang tobreak through tothesurface,only Simon’s draggedintoaplotbythelocal Before hecangiveitasecondthought drill-bit andtheman-sizedmechitactivates. an extraordinary discovery:asmallglowing stifl ing littleworlduntilonedayhemakes toils daily, drillingholestoexpandhis ofavillageSimon In hissky-lesscavern More volumesalsoavailable! 16+ •#9781595824646216pgs$9.71 Vol. 5 16+ •#DHGN1593077505192pgs$8.21 Vol. 1 Released 4/17/10 Released 8/3/10 Released 4/21/10 192 pgs•$8.24 old orphanageowestoYakuza loansharks, of the mountainofdebther Hayate learns and fame.EnterKurogane Hayate.When the StarStealing,strivingtowin bothmoney compete inaschool-widebattleknownas Students attheall-girlsTenchi Academy HAYATE XBLADE More volumesalsoavailable! 16+ •#9781421527345192pgs$7.49 Vol. 15 16+ •#9781421526454200pgs$7.49 Vol. 14 16+ •#9781421523385200pgs$7.49 Vol. 13 16+ •#VIZ1421508516192pgs$7.49 Vol. 1 her back,Hayateagrees tobeherbutler. buys Hayatefrom theyakuza,andtopay daughter ofasuper-wealthy family. Negi love forher. outtobetheonly Sheturns Sanzenin, thinksthatheisconfessinghis someone andransomthem.Thegirl,Negi too crazyabout,sohedecidestokidnap donor totheyakuza-anideaHayateisn’t Hayate’s parents sellhimasanorgan COMBAT BUTLER HAYATE THE More volumesalsoavailable! 16+ •#9781421528007192pgs$7.49 Vol. 9 16+ •#9781421527994184pgs$7.49 Vol. 8 16+ •#9781421527987192pgs$7.49 Vol. 7 16+ •#9781421524870200pgs$7.49 Vol. 6 16+ •#VIZ142151771X216pgs$6.74 Vol. 1 guard her. the Hachiyou,tostandbyhersideand Akane isappointedeightmaleprotectors, todestroyhas sworn Kyou.To protect her, by Akram,theheadofOniClan,which Dragon God).However, eventsare clouded noMiko(Priestessofthe is theRyuujin the Heianperiod.Soon,shediscovers time toKyo,nowknownasKyoto,during Akane ismysteriouslytransportedbackin HARUKA 13+ •#9781427812070576pgs$12.74 Complete Collection Hana’s guaranteedtorelapse now! have toworkwiththeboyatadayspa! position, onlytolaterfi nd outthatshewill walks inonaboyandgirlcompromising things quicklyescalateintodisasterasshe boys! Butontheveryfi rst dayofschool, unfortunate condition:she’s allergictocute Osaka andhasfi nally overcome arather HanaYamadaViolinist justmovedfrom HARU HANA More volumesalsoavailable! ALL •#9781421527369192pgs$5.99 Vol. 5 ALL •#9781421527352192pgs$5.99 Vol. 4 ALL •#9781421526560200pgs$5.99 Vol. 1 won’t savehernow! Hoot theOwl’s homeroom quiz!Cuteness faces thehardest challengeofall:Professor the trees ofherforest home.Then,she fox andpeoplewhoare tryingtocutdown and thehumanworld.Shefi ghts abigbad uncovers thesecrets ofahauntedspring herflwho wouldn’t? With uffy friends,Clover with awholeforest toexplore andplayin, bunny isalwaysgettingintomischief.And Welcome toMikazukiForest, where alittle HAPPY CLOVER 13+ •#9781427817327 Vol. 3 13+ •#9781427817310192pgs$8.24 Vol. 2 Released 8/3/10 Released 5/4/10 Released 6/1/10 Released 6/29/10 Released 6/15/10 192 pgs•$8.24 Headstrong anddefi ant, Taitou isthe More volumesalsoavailable! 16+ •#9781595824981192pgs$10.46 Vol. 10 16+ •#DHGN159307056X208pgs$10.46 Vol. 1 a terrifyingvampire withdeadlyeffi ciency... strategy... nottomentiontheir“trump-card,” fast andquicklyare allpartsofHellsing’s art weaponsandtechnology, andstriking trained soldiers,possessingstate-of-the eradicate thisevil.Commandinghighly organization iscreated -Hellsingto terror takingplaceinEngland,aspecial asteepriseinhorrifying, supernatural With HELLSING More volumesalsoavailable! 16+ •#9780345508454176pgs$8.99 Vol. 6 16+ •#9780345497475208pgs$8.21 Vol. 1 your soul! damnation. Butyouwillhavetopayaprice: will appeartodragyourtormentoreternal enter thenameofyourenemy. TheHellGirl website thatappearsonlyatmidnight,and way togetit:simplygothestrange When youthirstforrevenge, there’s asurefi re HELL GIRL More volumesalsoavailable! 16+ •#9780765325457192pgs$10.99 Vol. 6 16+ •#9780765323927192pgs$9.99 Vol. 5 16+ •#9780765321817194pgs$9.99 Vol. 1 nothing todowithher! and thegirlHayatehashereyeonwants problem: sheneedsapartnertocompete, and wintheStarStealing.There’s justone she decidestobecomeasword-bearer Released 4/30/10 Released 4/28/10 800.338.6827 books.rightstuf.com BLOOD+: KOWLOONNIGHTS More volumesalsoavailable! 13+ •#9781421531298192pgs $7.49 Vol. 13 13+ •#9781421529226192pgs $7.49 Vol. 12 13+ •#VIZ1421514818192pgs$6.74 Vol. 1 Haruna hadbetternotfallforhim! to coachher. Yoh agrees withonecatch: her quest,sheenlistscuteYoh Komiyama having theromance ofalifetime.To helpin her energytowards gettingaboyfriend and to highschool,Harunadecidesputallof reading comics. Butnowthatshe’s going her lifeconsistedofplayingsoftballand When HarunaNagashimawasinjuniorhigh, HIGH SCHOOLDEBUT 16+ •#9780316085014176pgs$8.24 Vol. 3 16+ •#9780759531178176pgs$8.24 Vol. 2 16+ •#9780759531161192pgs$8.24 Vol. 1 destiny... the Kenkaranbuandtruthofhisown been setinmotion,asTaitou setsoff after making off withtheblade.Thestarshave to unsheatheit,amysteriousthiefappears, be drawnbyatruehero. AsTaitou struggles Kenkaranbu, anancientsword thatcanonly deemed worthy, heispresented withthe of-age ceremony. Whenheisfi last inhisvillagetocompletecoming- nally Released 6/30/10 PICK SSTAFF P T I A C F K F

37 BOOKS BOOKS More volumesalsoavailable! 38 ALL •#VIZ159116222X208pgs $5.96 Vol. 1 that mightbemutuallybenefi cial... help himattainhisgoal,apairing iscreated the game.Nowrelying onyoungHikaruto bound toearthuntilhecompletelymasters After hisunfortunatefate,hefi nds hissoul skilled andcunningplayerofthegameGo. ago amannamedFujiwaranoSaiwas communicates withaghost!Alongtime his age,exceptforonesmallthing-he Young ShindohHikaru islikemanyboys HIKARU NOGO 16+ •#9780316097666 Vol. 8 16+ •#9780316086110 Vol. 7 16+ •#9780759529885192pgs$8.24 Vol. 6 16+ •#9780759529878192pgs$8.24 Vol. 5 16+ •#9780759529830192pgs$8.24 Vol. 1 help unravelthemysteryofthesemurders. Keiichi isdrawnintoawebofintrigueto that nighteveryyearforthepastfouryears, annual festivalthatadeathhasoccurred on atthetown’suneasiness. Afterlearning any details,whichonlyaddstoKeiichi’s in thelittlevillage.Hisfriendswon’t givehim ofagrislymurderhe learns thattookplace friends andenjoyinghislife,untiloneday, seemingly peacefulnewtown.He’s making Keiichi Maebarahasjustmovedtoa CRYWHEN THEY HIGURASHI: Released 8/31/10 Released 6/30/10 books.rightstuf.com 800.338.6827 192 192 pgs•$8.99 pgs•$8.99 SAYONARA, ZETSUBOU-SENSEI 16+ •#VIZ1421515040184pgs $6.74 Vol. 1 true self. Takemoto setsouttodiscoverlifeandhis Morita, Mayama,Yamada, andHagumi, grown up. Along withhiscrazyfriends, he’s livingonhisown,Takemoto isfarfrom whether he’llgettoclassontime.Although when he’llbeabletoafford toeatand apartment, where hisgreatest worryis Takemoto livesinarundownstudent CLOVERHONEY AND 13+ •#9780759531789192pgs$8.24 Released 7/31/10 do withHimeyuka? What ishisstory, andwhatdoeshehaveto can’t remember ever seeing himbefore... attached toHimeyuka,eventhoughshe Rozione whois,forsomereason, incredibly offender outtobealittleboynamed turns in colorful,crazy, childishscribbles!The to seeherbuildingcompletelycovered apartment. Oneday, shereturnsfrom school living byherselfinanaverage,unremarkable Himeyuka, ahighschoolstudent,begins ROZIONE’S STORY HIMEYUKA AND More volumesalsoavailable! ALL •#9781421528250208pgs$7.49 Vol. 20 ALL •#9781421528243200pgs$7.49 Vol. 19 ALL •#9781421528236216pgs$7.49 Vol. 18 ALL •#9781421525853208pgs$7.49 Vol. 17 Released 8/3/10 Released 5/4/10 16+ •#9781421523514536pgs $13.49 Vol. 4 16+ •#9781421523507560pgs$13.49 Vol. 3 16+ •#9781421523491560pgs$13.49 Vol. 2 16+ •#9781421523484552pgs$13.49 Vol. 1 slave. Omnibus“Big”edition. Hatsumi’s secret onlyifshebecomeshis kid, promises nottotelltheworldabout whousedtobullyHatsumiasa Ryoki, sister Akaneislate,Mrs.Tachibana’s son, buy apregnancy testbecauseherpopular and lifebecomeshell.WhenHatsumihasto Tachibana. GetonTachibana’s badside, by therumor-mongering, self-righteousMrs. school girlHatsumiNaritalivesisruledover The apartmentcomplexinwhichhigh- BIG EDITION More volumesalsoavailable! 13+ •#9781421528311200pgs$7.49 Vol. 19 13+ •#9781421528304200pgs$7.49 Vol. 18 13+ •#9781421528298200pgs$7.49 Vol. 17 13+ •#9781421524054200pgs$7.49 Vol. 16 13+ •#VIZ1421513625208pgs$5.99 Vol. 1 hunt demonsbyademon? do youtrustwhenyou’vebeentrainedto human worldofimmortalsforever. Butwho away inasecret dimension,riddingthe mission: capture allSenninandsealthem to leadthemysteriousHoshinProject. Its trained byGenshiTenson, aSenninhimself, Dynasty. Seekingvengeance,Taikobo is Sennin race,takescontrol ofChina’s Yin Dakki, abeautifulmemberofthegod-like Taikobo’s tribeiswipedoutwhentheevil HOSHIN ENGI 16+ •#9781421535074192pgs$7.49 Vol. 5 16+ •#9781421531649192pgs$7.49 Vol. 4 16+ •#9781421527772192pgs$7.49 Vol. 3 16+ •#9781421525471192pgs$6.74 Vol. 2 16+ •#9781421523477192pgs$6.74 Vol. 1 timid wallfl ower! door toshowbizisnowfl ung openforthis declaration, heoffers torepresent her. The powerful talentscouthearsherimpassioned being broadcast liveonnationalTV!Whena her parents -andherheatedwords endup Yura’s frustrationexplodesinarantagainst pressure ofbeingthechildcelebrities, splitting up.Already accustomedtothedaily that Yura’s mega-famousparents are The mediaisabuzzwhenword getsout HONEY HUNT 16+ •#9781569700372200pgs$12.95 Released 5/26/10 puts themovesonanother! Tetsuo reveals hisanimalisticimpulsesand completely contentwithhisdailylifeuntil about stupidifyou’re cool,right?Asadais very cool...butalittlestupid.Whocares team, andhisloverTetsuo-sempai is athlete onKananUniversity’s basketball Asada’s lifeisrightontrack.He’s agifted HONEY/CHOCOLATE More volumesalsoavailable! 16+ •#9781421523828208pgs$7.49 Vol. 10 16+ •#9781421523811184pgs$7.49 Vol. 9 16+ •#9781421523804200pgs$7.49 Vol. 8 Released 8/3/10 Released 6/1/10 Released 6/1/10 16+ •#9781401213107192pgs $7.49 Vol. 1 than anyone! - buthe’s theonewhoKazuhahatesmore Sugimoto, whowantstobe partofherlife crush; willitbereciprocated? Thenthere’s meets Mizushima.Kazuhahasherfi rst real allows hersoftersidetoshow-untilshe is alsosomethingofatomboywhonever Very responsible andirresistibly cute,she Kazuha Akiyoshiistheeldestofsixchildren. MORE THANANYONE I HATE YOU 16+ •#9781421534244200pgs$7.49 Vol. 1 see anotherday? help, canShunpeisavehimselfandliveto Hyde’scomes alivetorescue him.With If thatweren’t enough,Hydesuddenly the targetofsorcerers allovertheworld. thatheis by curseddolls,Shunpeilearns King ofSorcerers. Afteramysteriousattack grandfather, AlsydCloser, whowas the teddy bear, Hyde,wasagiftfrom Shunpei’s doesn’t seemtobegoodatanything.His Shunpei Closerhaslowself-esteemand HYDE &CLOSER More volumesalsoavailable! 16+ •#9781421530680216pgs$7.49 Vol. 26 16+ •#VIZ1591167531184pgs$5.99 Vol. 1 dangerous rivals! with dangerous animals-andevenmore be huntersrunthrough aforest fi lled The adventure beginswhenthewould- vengeance, andmoney-hungryLeorio. wannabes: Kurapika,who’s motivatedby Gon quicklybefriendstwootherHunter he hastopassthedangerous Huntertest. treasures andwords ofmagic.Butfi rst, his footstepsandtrackdownmonsters, a famousHunter, heaspires tofollowin hisfather,When Gonlearns Ging,was HUNTER X 16+ •#9781569701379200pgs$12.95 Vol. 1 away from him... some reason Watanabe cannotbeartobe Mizuo isapotentiallydangerous partner, for position athissalon.Despitefeelingthat that heisavampire andoffers Watanabe a Mizuo tellsthenow-unemployedWatanabe resulting inhistermination.Themysterious his trouble waslateforhispart-timejob, with theensuingbloodtransfusion,andfor bloodstained body, wasforced tocooperate Watanabe gathered upMizuo’s battered and A VAMPIRE SEDUCE HOW TO 16+ •#9781421532103208pgs$9.74 Vol. 1 what theyseem. to suspectthatYaichi’s motivationsare not the gang’s sinisteractivities,Masabegins itself “FiveLeaves.”Althoughdisturbedby the charismaticleaderofagroup calling agrees tobecomeabodyguard forYaichi, employ him.Hungryanddesperate,he caused himtobeletgobythelords who naive, diffi dent nature hasmore thanonce is askilledandloyalswordsman, buthis Masterless samuraiAkitsuMasanosuke HOUSE OFFIVELEAVES Released 7/13/10 Released 5/18/10 Sayonara, Zetsubou-Sensei©2006KojiKumeta. PICK SSTAFF P T I A C F K F 800.338.6827 books.rightstuf.com

39 BOOKS BOOKS More volumesalsoavailable! 40 16+ •#9781569708286194pgs $12.95 Vol. 1 hopes torectify pretty quickly. difference betweenthetwothatTanizaki a penchantforartforgeryis justa“minor” can’t hurteither. ThefactthatTanizaki has graduated from thesameartschool-that 24-years-old -that’s agoodstart.Theyboth have incommon?Well, bothofthemare and young,naivefi lmmaker SoheiNakai What dogallery-ownerHideoTanizaki IN THEWALNUT 16+ •#9781421531663232pgs$9.74 Vol. 6 16+ •#9781421531656232pgs$9.74 Vol. 5 16+ •#9781421526812240pgs$9.74 Vol. 4 16+ •#9781421526805224pgs$9.74 Vol. 3 16+ •#9781421526799200pgs$9.74 Vol. 2 16+ •#9781421526782216pgs$9.74 Vol. 1 hours ofnotifi cation. different citizenwhowill bekilledwithin24 beginning today, wewillrandomlyselecta decided societyneedsawake-upcall.So, being taken.We,have yourgovernment, Well, you’llbehappytoknowmeasures are being donetostopthissystematicdecline?” probably askedyourself,“Whyisn’t anything apathetic, lazy, andunmotivated.You’ve the worldisatroubled place.Peopleare Dear Citizen:You’ve nodoubtnoticedthat THE ULTIMATE LIMIT IKIGAMI: 16+ •#9780759530713112pgs$8.24 Vol. 2 16+ •#9780759529250128pgs$8.24 Vol. 1 success tobe...ratherbumpy. the prep school,buttheyfi nd theroad to two friendsbeginanewlifeindormnear are forced toenroll inaprep school.The their failinggrades,NanakoandAkane only oneofthemmanagestopass!With take acollegeentranceexam.However, Konishi andherfriends,AkaneShino, soon-to-be-high schoolgradsNanako Excited forthebrightfutures aheadofthem, ICHIROH! 16+ •#9781421533650208pgs$9.74 Vol. 1 - butthat’s notenoughtostopShizuo! to becomeasuccessinthemangaindustry talent, discipline,oranyotherskillnecessary a publishedmangaartist.Sure, helacksthe random andnewcareer course:tobecome corporate ratraceandchartshimselfafairly 40-year-old Shizuobreaks free from the A completewasteofahumanlifeuntilnow, Shizuo Oguro islivinghisdreams... sortof. TOMORROW I’LL GIVEITMY ALL... 16+ •#9781401214081 Vol. 10 16+ •#9781401214074200pgs$7.49 Vol. 9 16+ •#9781401214067200pgs$7.49 Vol. 8 Released 5/18/10 Released 8/10/10 Released 5/11/10 Released 7/20/10 books.rightstuf.com 800.338.6827 prices, studiosales&more! extra 10%OFFoureveryday Got Animememberssavean 192 pgs•$7.49 ability andhasbeenforsaken byhisfamily. tamers, heseemstolack the necessary the descendentofalongline ofInukami- appearance. ThoughKawahira Keitais Inukami: asacred beingwithadog-like INUKAMI More volumesalsoavailable! 16+ •#9781421531670216pgs$7.49 Vol. 16 16+ •#9781421529288216pgs$7.49 Vol. 15 16+ •#9781421526676228pgs$7.49 Vol. 14 16+ •#VIZ1421511495192pgs$7.49 Vol. 1 adventures incanineanticshavejustbegun! at thepetstore Teppei manages.Her wayward wooing,Sugurioffers towork puppies. To makeup forhermongrel’s shattering hisdream ofalitterpurebred dog whileitsowner, Teppei, isn’t looking, Suguri’s dog,Lupin, “courts”another CRAZY FORDOGS INUBAKA: 16+ •#9781421532837568pgs$13.49 Vol. 4 16+ •#9781421532820568pgs$13.49 Vol. 3 16+ •#9781421532813568pgs$13.49 Vol. 2 16+ •#9781421532806576pgs$13.49 Vol. 1 omnibus “Big”editions. Same astheaboveexceptcollectedinto BIG EDITION More volumesalsoavailable! 16+ •#9781421530017192pgs$7.49 Vol. 51 16+ •#9781421530000192pgs$7.49 Vol. 50 16+ •#9781421529998192pgs$7.49 Vol. 49 16+ •#9781421529981192pgs$7.49 Vol. 48 16+ •#9781421529974192pgs$7.49 Vol. 47 16+ •#9781421529967192pgs$7.49 Vol. 46 16+ •#9781421529950192pgs$7.49 Vol. 45 16+ •#9781421529943192pgs$7.49 Vol. 44 16+ •#9781421528939192pgs$7.49 Vol. 43 16+ •#9781421528922192pgs$7.49 Vol. 42 16+ •#VIZ1569319472192pgs$6.71 Vol. 1(2ndEdition, Small Format) the present andpast! Shikon Jewelagainstthedemonicforces of dog-boy, andthecaretaker ofthemagical of Inu-Yasha, ahot-tempered half-demon of afeudalvillage,themasterandfriend Japan. There shebecomestheprotector she fallsbackintimetosixteenth-century a boarded-up wellwithinanancientshrine, When schoolgirlKagomestumblesthrough REGULAR EDITION INU YASHA 16+ •#9781569701270200pgs$12.95 Vol. 2 Released 8/10/10 Released 5/11/10 Released 7/13/10 Released 8/10/10 Released 7/13/10 Released 6/8/10 Released 5/11/10 loveable girl-next-doortype- ifthegirlnext Sequel totheoriginalseries. Karin’s your CHU 17+ •#9781421532189192pgs$9.74 Vol. 4 17+ •#9781421532172192pgs$9.74 Vol. 3 17+ •#9781421532165192pgs$9.74 Vol. 2 17+ •#9781421532158192pgs$9.74 Vol. 1 Hekmatyar andherbandofmercenaries. the serviceofhigh-fl ying armsdealerKoko employs bothextremely wellanddoessoin Jonah’s hatred ofweaponsandviolence,he armsdealers.Despite Death” -international supplied bytheso-called“Merchants of his familylosttoawarfueledbyweapons chaotic confl icts thatrageacross Africa, Jonah wasachildsoldier, inthe born More volumesalsoavailable! 16+ •#9781421524085208pgs$7.49 Vol. 15 16+ •#9781421524078192pgs$7.49 Vol. 14 16+ •#9781421524061192pgs$7.49 Vol. 13 Stand UserswaitstokillJojoandhisfriends. But theroad islong,andanarmyofevil vampire thirstsforthebloodofhisfamily. to Cairo, Egypt,where ahundred-year-old his darkforces andtravelaround theworld To savehismother’s life,Jotaro musttame ADVENTURE JOJO’S BIZARRE 16+ •#9781401222253232pgs$7.49 Vol. 3 16+ •#9781401221065226pgs$7.49 Vol. 2 16+ •#9781401221058194pgs$7.49 Vol. 1 accidentally runshimover! Tristram savesAoi,butTristram’s buddyDis goes wrong, apistol-packingpadre named act asacourier. Afteraroutine delivery where supposedlynothingcansurvive,to to travelthrough theJihai(wasteland), searches forrevenge, Aoiuseshisability year tolivelookingforthekiller!Ashe 17-year-old cloneAoispendshislast When hischildhoodfriendismurdered, JIHAI 13+ •#9781569701713 Vol. 3 13+ •#9781569701362300pgs$16.95 Vol. 2 13+ •#9781569701317300pgs$16.95 Vol. 1 be togethereveryday...?! circumstance forces NaokiandKotokoto outright refuses it,butthenachangein to present himwithaloveletter, Naoki When Kotokifi nally mustersupthecourage class inschool,whereas she’s inClassF. he’s amemberofClassA,thetopranking Unfortunately, he’s popularandsosmart a crushonNaokiIriesincefreshman year. High schoolseniorKotokoAiharahashad ITAZURA NAKISS More volumesalsoavailable! 16+ •#9780765324115192pgs$10.99 Vol. 5 16+ •#9780765323910192pgs$9.99 Vol. 4 16+ •#9780765321466194pgs$9.99 Vol. 1 one haseverbeenabletocontrol. is awildandmischievousInukamithatno contract withher, KeitadiscoversthatYoko obedient, andbeautiful...butuponforginga Yoko, who,atfi rst glance,looksgraceful, One day, hemeetsacuteInukaminamed Released 7/21/10 Released 8/10/10 Released 5/11/10 Released 8/3/10 300 pgs•$16.95 Yukimura, isalsoakekkaishi,buttheir old neighborandchildhood friend,Tokine grandfather! Yoshimori’s pretty 16-year- to sweetsandaseriously crotchety some otherdemonstobattle: anaddiction around his prey. Byday, Yoshimori’s got who specializesincreating magicalbarriers Sumimura isa“”-demon-hunter By night,juniorhighstudentYoshimori KEKKAISHI More volumesalsoavailable! 16+ •#9781421528038192pgs$7.49 Vol. 18 16+ •#9781421528021200pgs$7.49 Vol. 17 16+ •#9781421528014200pgs$7.49 Vol. 16 16+ •#9781421524184200pgs$7.49 Vol. 15 16+ •#VIZ1421501899200pgs$6.71 Vol. 1 girl namedTominaga Sei indisguise! one suspectsisthatSeizaburo isactuallya his wrongfully murdered family. Butwhatno to bothaidtheMibu-Roshiandavenge experience, possessesafi ery enthusiasm warrior who,thoughlackingincombat Kamiya Seizaburo isayoungwould-be 16+ •#9781934876763480pgs$14.99 Collection 2 16+ •#9781934876701496pgs$14.99 Collection 1 him/her! childhood friendandthegirlwhorejected a lovetrianglebetweentwogirls-his parents alwayswantedwhiledealingwith howtobethegirlhis Hazumu mustlearn his body... butasthewrong gender!Now space ship.Feelingguilty, thealienrebuilds gets lostandispromptly squashedbya Shunned bythegirlofhisdreams, Hazumu OMNIBUS EDITION ~ GIRLMEETS KASHIMASHI 13+ •#9781427814098208pgs$8.24 Vol. 3 13+ •#9781427814081192pgs$8.24 Vol. 2 13+ •#9781427814074192pgs$8.24 Vol. 1 adventure! a human,where eventhesimplestuff isan out todiscoverthetruemeaningoflifeas new group offriendsintow, Odettesets to enroll herinhighschool.Thus,witha to behuman,sheconvincestheProfessor Yoshizawa. Curioustofi nd outwhatit’s like Odette isalovelyandroid builtbyProfessor KARAKURI ODETTE More volumesalsoavailable! 13+ •#9780345510358176pgs$8.21 Vol. 7 13+ •#9780345510341176pgs$8.21 Vol. 6 13+ •#9780345504036208pgs$8.21 Vol. 1 easy tobeagoddessandgirlinlove. with Kazune,theboyofherdreams. It’s not most, though,istolivehappilyeverafter to doanythingshe’dlike.Whatlike has amagicringthatgivesherthepower door alsohappenstobeagoddess!Karin Released 6/8/10 Released 8/3/10 Released 5/4/10 PICK SSTAFF P T I A C F K F about tomakesomeenemies,too! sure tomakemore thanjustthat-she’s popular boyinclass,befriendsher, she’s make friends.ButwhenKazehaya,themost Shy andpure ofheart,shejustwantsto facade isaverymisunderstoodteenager. Unbeknownst tobutafew, behindherscary often mistakenforTheRing’s Sadako. sinister smile,andsilentdemeanor, she’s herjet-blackhair,for ahorror movie.With Sawako Kuronuma istheperfectheroine... More volumesalsoavailable! 13+ •#9781421530697192pgs$7.49 Vol. 22 13+ •#9781421527857208pgs$7.49 Vol. 21 13+ •#9781421527840192pgs$7.49 Vol. 20 13+ •#9781421526126192pgs$7.49 Vol. 19 13+ •#VIZ1591169682192pgs$7.49 Vol. 1 practitioner” oftheart. families are feudingoverwhoisthe“true How toSeduceaVampire ©NIMOSAKUSHIMADA2007. 16+ •#9781427815828192pgs$8.24 Vol. 2 16+ •#9781427815811208pgs$8.24 Vol. 1 won’t graduatethatway! school nothavingkissedagirl,hesure sure thateventhoughKouichientered high help. AndthusbeginsMao’s questtomake while Kouichi...Well... Hecouldusealittle has noproblem attractingtheoppositesex, trajectories. Maoisanoutgoingbabe,who their socialliveshavetakenvastlydifferent as theyenterhighschool,discoverthat Kouichi andMaoare childhoodfriends.But KIMIKISS 13+ •#9781421527871192pgs$7.49 Vol. 5 13+ •#9781421527864208pgs$7.49 Vol. 4 13+ •#9781421527574216pgs$7.49 Vol. 3 13+ •#9781421527567192pgs$7.49 Vol. 2 13+ •#9781421527550216pgs$6.74 Vol. 1 Released 8/3/10 Released 5/4/10 Released 8/10/10 Released 5/11/10 HOW TOSEDUCEAVAMPIRE 16+ •#9781569705698200pgs$9.95 Vol. 2 16+ •#9781569705681200pgs$9.95 Vol. 1 taboo of“deicide.” and ahumbleknightwhorisksbreaking the story ofafatefulgirlcaptured asawitch inwitchhunts.Thisisanepiclove burned clergy inGod’s name,thesewitchesare devil-worshippers. Judgedguiltybythe disgraced Godtoliveinsteadashated rampant, havingabandonedfaithand In thekingdomofExkuld,witchesrun KNIGHTS 16+ •#9781421533629208pgs$9.74 Vol. 1 people fi nd theirdreams. Kingyo UsedBooks,aplacethathelps magazine. Discoverallthisandmore at his trueselfinthepagesofamanga rediscovers romance. Ateenagerdiscovers An archer hitsabull’s-eye. Ahomemaker to tell.Anartstudentfi nds inspiration. Every bookstore hasathousandstories KINGYO USEDBOOKS More volumesalsoavailable! 13+ •#9781401214197200pgs$7.49 Vol. 9 13+ •#9781401214180192pgs$7.49 Vol. 8 13+ •#9781401213121208pgs$7.49 Vol. 1 dreams, offering heradviceonhowtowin. Sahgan himselfbeginstovisitManamiinher player isouttowinthecard from her. But rarest card inthegame.Noweveryother contains “Sahgan,TheMightySorcerer,” the a beginner’s setonlytodiscoverthatit moreto learn aboutit,shepurchases very popularatManami’s school.Trying “Chaos” isatradingcard gamethatis KING OFCARDS 16+ •#9781427817532 Vol. 5 16+ •#9781427817525224pgs$8.24 Vol. 4 16+ •#9781427815835192pgs$8.24 Vol. 3 Released 8/31/10 Released 4/20/10 Released 8/3/10 Released 5/4/10 192 pgs•$8.24 More volumesalsoavailable! 17+ •#9781595825285 Vol. 11 17+ •#9781595824462216pgs$8.21 Vol. 10 17+ •#DHGN1593075553208pgs$8.21 Vol. 1 free yoursoul! carry yourbodywherever itneedstogo suicide, murder, accident,orillness,they’ll “ CorpseDeliveryService”:whether and can’t moveon.Thefi ve formthe dead whoare stilltrappedintheirbodies - givesthemadirect linetothedead- stuff theyknow-channeling,dowsing,ESP university studentsfi nd allthat“useless” Your bodyistheirbusiness!Fiveyoung DELIVERY SERVICE KUROSAGI CORPSE More volumesalsoavailable! 16+ •#9781421528366216pgs$7.49 Vol. 14 16+ •#VIZ1421513668184pgs$5.99 Vol. 1 gunfi ghter namedZero... with thiscurse,Kurohime meetsaskilled she isinlove.After10yearsofliving regain hertrueformandpowerswhen named Himeko,andnowshecanonly curse changedKurohime intoalittlegirl for herfoolishness,shewascursed!The mistake ofchallengingthegods...and control magicalguns,oncemadethe Kurohime, awitchwiththepowerto KUROHIME 13+ •#9780316085410 Vol. 3 13+ •#9780316085403192pgs$8.24 Vol. 2 13+ •#9780316085366192pgs$8.24 Vol. 1 to help(read: nagandcritique)her... Yikes! cute bluedogwithaseriouslybadattitude, todo?Well, shehasIoryogi-san,a each person’s heartisdifferent. Sowhat’s how tomendhearts...especiallysince she hasrelieved. ButKobatohasnoclue fi ll upamagicalbottlewiththesuffering and the peopleshemeetsonherjourney she hastomendthewoundedheartsof a wishshewantsgranted.To dothis, Hanato Kobatoisonamission:shehas KOBATO More volumesalsoavailable! 13+ •#9781421524122216pgs$7.49 Vol. 28 survive hismatchwiththebrutalCassios! who musttrainharder thaneverifheisto outtobeyoungSeiya, the earth.Itturns Greece: aman-sizedmeteoritecrashesto of Athena!Flashforward tomodern-day and protected thegoddess:Knights a group ofyouthsthatalwayssurrounded very earth,andonthebattlefi eld, there was with bloodthirstygodsandgiantsshookthe infullarmor.of Zeus,wasborn Herbattles In Greek mythology, Athena,thedaughter KNIGHTS OF THE ZODIAC Released 8/31/10 Released 5/31/10 Released 5/31/10 Released 7/28/10 SEE BLACKBUTLER KUROSHITSUJI 232 192 pgs•$8.24 pgs•$8.24 PICK SSTAFF P T I A C F K F 800.338.6827 books.rightstuf.com More volumesalsoavailable! 16+ •#9781427816665192pgs $9.74 one another? will ItaruandKoukievertruly understand their ownpersonalitiesto contend with, company fullofquirkycharactersand roommates and co-workers.Butwitha cable station,andsoonthetwoendup cameraman Kouki,whoworksforalocal heap. Hismiseryisdocumentedbyprickly passed outonaneighborhoodtrash crisis, haplessItaruwindsupdrunkand After fl eeing Tokyo toescapeapersonal LIBERTY LIBERTY! More volumesalsoavailable! ALL •#9781421526522192pgs$5.99 Vol. 4 ALL •#9781421526492192pgs$5.99 Vol. 1 of “helping”isn’t quiteintouchwithreality. him! Theonlyproblem isthatPET’s sense mission: topayNoborubackforrecycling come backtolifeasPET, arobot witha does heknowthatthebottleisaboutto thing andrecycles aplasticbottle.Butlittle Nine-year-old Noborudoestheresponsible LEAVE IT TO PET! 17+ •#9780345521583 Vol. 8 17+ •#0345496221 Vol. 1 Chevalier d’Eon! can saveParisfrom chaosandterror: the the bloodoftheirvictims.Onlyoneman has promised themFranceinreturnfor young womentoademonicforce that A mysteriouscultissacrifi cing beautiful LE CHEVALIER D’EON More volumesalsoavailable! 13+ •#9781427804624192pgs$8.24 Vol. 6 13+ •#MM1595323597192pgs$7.49 Vol. 1 them secret, orriskdeath! names onlytheyknow... andmustkeep over thefi ght. BothYen andJinhavesecret Once youknowthename,gaincontrol game ofguessingyouropponent’s “name.” the battlewithspiritscomesdowntoa craft ofdefeatingevilspirits.Inthisworld, school andsuccessorstotheRagunfamily Yen andJinare brothers inelementary LAGOON ENGINE More volumesalsoavailable! 13+ •#9781421533070192pgs$7.49 Vol. 12 13+ •#VIZ1421505835184pgs$6.74 Vol. 1 rivalry ruletheday? shewinloveandfame,orwillbitter Will competition withfi ve veryattractiveboys. to participateintheschool’s music and before sheknowsit,she’s nominated The fairygrantsKahokoamagicviolin, of anelusivefairywholivesoncampus. that changeswhenshecatchesaglimpse Kahoko hasabsolutelynomusicalskill,but LA CORDA D’ORO More volumesalsoavailable! 13+ •#9781427816351192pgs$8.24 Vol. 6 13+ •#9781427816344192pgs$8.24 Vol. 5 13+ •#9781427810991192pgs$7.49 Vol. 1 he’s engaged-toaman! against allofhumanity. Andtotopitalloff, race thatexpectshimtoleadthemwar fi nds himselfKingoftheMazoku,anew transported toanotherworld-where he his headisdunkedinatoilet.Thenhe’s Yuri Shibuyajustcan’t catchabreak. First, KYO KARAMAOH! Released 7/27/10 Released 5/4/10 Released 6/1/10 208 192 pgs•$8.21 pgs•$8.99

41 BOOKS BOOKS 42 standing nexttoAtsushi,theshortestguy. last thingshewantsisthehumiliationof Risa isthetallestgirlinclass,and LOVE*COM ALL •#9781401220549192pgs$7.49 Vol. 2 ALL •#9781401220532200pgs$7.49 Vol. 1 a lizard! himinto spell Siennahasbeenunderturns between CanaryandSienna-butthena The planbackfi res whenchemistryignites fi rst date,convincedhe’lldriveheraway. his brother Siennatoposeashimontheir to disruptthependingnuptials.Hegets about thisideaeither, sohehatchesaplan Heath ofGazaria.ThePrinceisn’t crazy unwillingly betrothed byherfathertoPrince Canary, princessofLinaria,hasbeen LIZARD PRINCE 16+ •#9781421534886200pgs$7.49 Vol. 1 to beabitofnightmare. fi nally arecruit, she’s fi nding herdream job when shewasyounger. Butnowthatshe’s book from beingconfi scated inabookstore its soldierssteppedintoprotect herfavorite the LibraryDefenseForce eversinceoneof Forces! IkuKasaharahasdreamed ofjoining group todefendthemselves:theLibrary protect theircollectionsandformamilitary it deemsunsuitable.Thelibrariesvowto creates acommitteetoridsocietyofbooks In thenearfuture, thefederalgovernment LOVE & WAR LIBRARY WARS: Released 6/1/10 books.rightstuf.com 800.338.6827 bitter-sweet, toughbutshystraight-man knowledge ofallsubjects;Kagami,the living exampleofmoewithanencyclopedic culture; Miyuki,thecute,bespectacled anime toexcelinanythingbutotaku too dedicatedtoherfavoriteprimetime Meet Konata,anathleticandintelligentgirl LUCKY STAR 16+ •#9781427802781192pgs$9.74 delectable boys’lovecollection. a humanoidrobot! Hilarityandchaosfi ll this airheaded girlisabductedandreplaced by crime lords! Andanadorablebutslightly use theirmagicalpowerstofi ght mystical other againinTokyo astheyteamupand Two estrangedchildhoodfriendsfi nd each young friendsuspectshimoffoulplay! corpse ofhisex-lover-whosehandsome A respected teacherstumblesuponthe AISHIATTERU FUTARI LOVE HURTS: More volumesalsoavailable! 13+ •#9781421532349208pgs$7.49 Vol. 17 13+ •#9781421523835192pgs$7.49 Vol. 16 13+ •#9781421523736192pgs$7.49 Vol. 15 13+ •#VIZ1421513439192pgs$6.74 Vol. 1 something more complex? love, willtheirbuddingfriendshipbecome objects oftheiraffection. Butinthequestfor and Atsushijoinforces topursuethetrue duo. Ratherthanbowtotheinevitable,Risa unwilling starsofabizarre romantic comedy But thetwofi nd themselvescastasthe INUKAMI will shedowhenthesexiest boyinschool to attractmore femalestudents.Butwhat an attempttomaketheschool presentable man-hating Misakireally socksitto‘em in male andstuckintheirslovenlyhabits,so Unfortunately, mostofthestudentsare still Seika HighSchool,formerlyaboys’school. is thePresident oftheStudentCouncilat Brilliant andoverachieving,MisakiAyuzawa MAID SAMA! More volumesalsoavailable! 16+ •#9781421521701200pgs$7.49 Vol. 9 16+ •#9781421521695200pgs$7.49 Vol. 8 16+ •#9781421521688200pgs$7.49 Vol. 7 16+ •#9781421521671200pgs$7.49 Vol. 6 16+ •#9781421521664200pgs$7.49 Vol. 5 16+ •#9781421516714208pgs$6.74 Vol. 1 other girls-especiallyhertwinsisterSaya! by herowninsecurityandtheschemingof Chiaki’s attractiontoYosuke isthwarted the hottestguyatherschool!Unfortunately, a backthathappenstobelongYosuke, in loveatfi rst sightwithagorgeousback- otherwise anormal,quietgirl,untilshefalls Research Societyclub,ChiakiTogu is The starofherhighschool’s Massage MAGIC TOUCH 16+ •#9781427816009176pgs$8.24 Vol. 3 16+ •#9781427815996192pgs$8.24 Vol. 2 16+ •#9781427815989192pgs$8.24 Vol. 1 back home! toavoidbeingdragged and cleverness ensues... Butit’s goingtotakealotofluck to retrieve him,andamadlovechase furious, sendsaclumsytrioofdemons marriage hewantsnopartof!Kaito’s dad, has escapedtothehumanworldavoida Kaito, theprinceofdemonrealm, who The problem isontheinside:Kujoureally happiness inhisschool’s hallowedhalls. be youraverageteen,pursuingloveand On theoutside,KujouYamato appearsto MAD LOVE CHASE 13+ •#9781604961157150pgs$8.24 Vol. 5 13+ •#9781604961164150pgs$8.24 Vol. 4 13+ •#9781604961140150pgs$8.24 Vol. 3 13+ •#9781604961133150pgs$8.24 Vol. 2 13+ •#9781604961126150pgs$8.24 Vol. 1 questioning theordinary! as ourheroines explore theunexplored in thisstudyinthehumancondition Witness Tsukasa, akindbutair-headed klutz. twinsister,and heryoungerfraternal to Konata’s constantteasingandpranks; Released 5/4/10 Released 5/19/10 Released 8/3/10 Released 6/1/10 anything damagedwhenitgetstome.”-JonathanN. “You packagethingswithsuchcareIneverhave PICK SSTAFF P T I A C F K F More volumesalsoavailable! at AcademyofPerforming ArtsSchool. Everybody knowsTatsuki isastarperformer MIDNIGHT BLOOM 16+ •#9780316089524 Vol. 6 16+ •#9780316086059192pgs$8.24 Vol. 5 16+ •#9780759529472192pgs$8.24 Vol. 4 16+ •#9780759529441208pgs$8.24 Vol. 1 ready tojoin theSOSBrigade? fellow classmateHaruhiSuzumiya!Are you get adoseofthesuperfantasticthanksto he knowthathishumdrumlifeisaboutto day atanordinary highschool.Littledoes It’s averageschoolboyKyon’s typicalfi rst HARUHI SUZUMIYA MELANCHOLY OF More volumesalsoavailable! 13+ •#9781427818287208pgs$8.24 Vol. 11 13+ •#9781427817143192pgs$8.24 Vol. 10 13+ •#MM1427800715216pgs$7.49 Vol. 1 to liveunderoneroof! upside down,asthey’reis turned allforced discovers shehas4half-brothers, herworld When Sakura,a14-year-old orphanedgirl, ME AND MYBROTHERS 16+ •#9781427817822 Vol. 4 16+ •#9781427816733192pgs$8.24 Vol. 3 16+ •#9781427816726192pgs$8.24 Vol. 2 16+ •#9781427816719192pgs$8.24 Vol. 1 sadistic boy!Canthingsgetanyworse?! ideal matehappenstobeacross-dressing outthatherseemingly her criteria,itturns captivating freshman namedMariyawhofi ts fi nd heronetruelove.Whenshemeetsa men, Kanakoenrolls inanall-girlsschoolto would beeasy!Becauseofherphobia Nobody eversaidfi nding asoulmate 16+ •#9781421534299200pgs$7.49 Vol. 2 16+ •#9781421534282200pgs$7.49 Vol. 1 something farmore disturbing. but theeventsAndowitnessespointat man Inukai,portraysitselfasacivicgroup, by thecharismaticandmysteriousyoung his gift.Agroup called“Grasshopper,” led efforts toactnormalhe’s forced toreawaken tosuppresslearned it,butnowdespiteallhis others tovocalizehisthoughts.Asachildhe schooler whopossestheabilitytoforce actually adevilindisguise?Andoishigh What doyouwhenthecity’s savioris MAOH: JUVENILEREMIX 13+ •#9781427816894 Vol. 5 13+ •#9781427814067208pgs$8.24 Vol. 4 13+ •#9781427814050192pgs$8.24 Vol. 3 13+ •#9781427814043192pgs$8.24 Vol. 2 13+ •#9781427814036192pgs$8.24 Vol. 1 a maidcafe?! fi nds outthatafterschool,Misakiworksin Released 6/30/10 Released 6/29/10 Released 8/10/10 Released 5/11/10 Released 6/29/10 Inukami ©MamizuArisawa/MariMatsuzawa 2006. 192 192 192 pgs•$8.24 pgs•$8.24 pgs•$8.24 will Neokeeptimeonherside? Sayadependingonher,great concert.With dreams mayvanishiftheycan’t putonone half ofanultimatesingingduo.Butallher teamed upwiththehandsomeSayaas to sinkorsing!Before sheknowsit,she’s time-travels tothe21stcentury, it’s time her short,shortskirts.Whensheaccidently boundaries of23rd centurymodestywith Neolovestosingandteststhe Vivacious MIKANSEI NO. 1 16+ •#9781569700891200pgs$12.95 Released 6/23/10 ending thistime? his personality. Tatsuki Will getshishappy new; someonewhochangeshislifeand Now severalyearslater, hemeetssomeone butthat’sa crash-and-burn, allinthepast. He oncehadacrushthatendedupbeing especially whenitcomestohisrelationships. complete opposite-shyandintroverted, full ofenergy... butoff thestagehe’s the When heisonstage,he’s expressive and Neko Ramen©KENJISONISHI/MAGGarden. the ogres from theirislandhome.Now Mythical Japanesehero Momotaro banished MOMO TAMA More volumesalsoavailable! 13+ •#9781421532356208pgs$7.49 Vol. 8 13+ •#9781421531991200pgs$7.49 Vol. 7 13+ •#9781421519821192pgs$7.49 Vol. 6 13+ •#9781421519678208pgs$6.74 Vol. 1 reach theircuisine dreams! star-crossed gourmandsdotheirbestto High SchoolCookingDepartment,asthese chef! It’s loveandleftovers intheOikawa Hyuga, andallhewantstodoisbeapastry Hyuga isthesonofprestigious Sushi wants todoisbeasushichef.Hayato celebrated PatisserieAshitaba,butallshe Hanayu Ashitabaisthedaughterof MIXED VEGETABLES More volumesalsoavailable! 13+ •#9780345510723192pgs$8.99 Vol. 4 13+ •#9780345501820192pgs$8.21 Vol. 1 meant tobe! her potentialandbecomethegirlshewas friend andconfi dant, Ame’s sure tounlock Nikoriasherbest a mindofherown.With a cutestuffed animal;shecantalkandhad Nikori -willchangeherlife.Nikori’s notjust with hertoycollection.Butonenew- anyfriends,shespendsallhertime Without Ame isaquietandshyhighschoolgirl. MINIMA! 16+ •#9781569700952200pgs$12.95 Vol. 4 16+ •#9781569700945200pgs$12.95 Vol. 3 16+ •#9781569700938200pgs$12.95 Vol. 2 16+ •#9781569700921200pgs$12.95 Vol. 1 grand fashion! Minori’s fi rst kissaskshertomarryhimin my FirstLady?”Now, theguywhostole yoube Minister hasselectedher!“Will that veryeveningtheJapanesePrime opponent inavideogameandlearns at thelocalarcade whenshedefeatsan of hereverydaylife.Thatis,untiloneday bored todeathwiththemundaneaspects Minori Nagashimaisahighschoolstudent PRIME MINISTER MILLENNIUM 13+ •#9781427816030208pgs$8.24 Vol. 2 13+ •#9781427816023192pgs$8.24 Vol. 1 Released 7/6/10 13+ •#9781421528373232pgs $7.49 Vol. 15 13+ •#9781421524283192pgs $7.49 Vol. 14 13+ •#VIZ1421513765208pgs$5.99 Vol. 1 Serving justicetoevilspiritsistheirspecialty. need MuhyoandRoji,expertsinmagiclaw. up andaway?Iftheanswerisyes,thanyou possession? Isthere aghostyouneedsent Are youthe victimofunwantedspirit INVESTIGATION OF SUPERNATURAL MUHYO &ROJI’S BUREAU 13+ •#9781427818508400pgs$11.24 Complete SeriesOmnibus her newfeline“friend”onadventures. two beginlivingtogether, andYayoi takes they developaninteresting relationship: the Yayoi’s powerwhenhegetsthechance, though Uradoesn’t hidehisdesire to“eat” the devilintoablackkitten.Now, even fi ght withthedevilUra,Yayoi’s powerturns these powerstoprotect people.Duringa inherited spiritualpowers,andsheuses Yayoi, aspunkyhighschoolgirl,has MUGEN SPIRAL 16+ •#9780345514738240pgs$8.21 Vol. 2 16+ •#9780345514721240pgs$8.21 Vol. 1 atmosphere hesodesires? Tadayasu everfi experiments ofhisfellowstudents,will nd thecoolcollege microbial worldandthedoomedagricultural determined tounlockthepowerof the machinationsofaneccentricprofessor see germswiththenakedeye.Between student hidingabizarre secret: hecan Tadayasu isanew, fresh-faced university MOYASIMON More volumesalsoavailable! 13+ •#9781421526690200pgs$7.49 Vol. 8 13+ •#VIZ1421515180192pgs$6.74 Vol. 1 reminds herofababymonkey! even meetsaboynamedMasaruwho then theygetbacktogetheragain.Haruna everyone isinaclique,theyallfi ght, and life islikebeingonamonkeymountain- scandal, Harunaisconvincedthatschool After herpoliticianfatherisdisgracedin MONKEY HIGH 13+ •#9781427815644192pgs$8.24 Vol. 3 13+ •#9781427815637192pgs$8.24 Vol. 2 13+ •#9781427815620192pgs$8.24 Vol. 1 to applyalittledemontherapy! demons tobreak thecurse,heonlyneeds discovers thathedoesn’t havetokillthe 18.Buthe curse, he’lldiethedayheturns previous life!Andifhedoesn’t break the worse, hewascursedbydemonsinhis Momotaro from Japanesefolklore. What’s that heisactuallythereincarnationof disaster-attracting youngstudent,istold After transferringtoanewschool,Yuki, a MOMOGUMI PLUSSENKI More volumesalsoavailable! 13+ •#9781427815491192pgs$8.24 Vol. 4 13+ •#9781427811097192pgs$7.49 Vol. 1 military schoolfordemonexterminators. intoa the island-whichhasbeenturned precocious pipsqueaksetsouttoreconquer his adorableface,andenormousego,the Armed onlywithhisdubiousexorcist powers, determined toreclaim hisfamily’s birthright! descendant,KokonoseMutsu,is modern Released 5/25/10 Released 5/4/10 More volumesalsoavailable! 16+ •#9780345505606624pgs$18.74 Vol. 8-10Omnibus 16+ •#9780345496218240pgs$9.71 Vol. 1 those plaguedbymushi...perhaps. smile, hastheknowledgeandskilltosave today. Ginko,ayoungmanwithsardonic being, andtheywreak havocintheworld deadly creatures, mushi,cameintoterrifying emerged from theprimordial ooze,these simply drivemenmad.Shortlyafterlife your eyelids.Somethoughtlesslykill. Some liveinthedeepdarknessbehind MUSHI-SHI More volumesalsoavailable! 13+ •#9781401217617192pgs$7.49 Vol. 17 13+ •#1401205402208pgs$7.49 Vol. 1 And NumberNineisoneofthem. the abilitytochangecourseofhistory. - thoughit’s whispered thattheypossess Even lessisknownaboutitsfi eld operatives of defenseagainstterrorists andcriminals. “Universal Blue”exceptthatit’s thelastline to fi ghting injustice.Littleisknownabout fi eld operativeforanorganizationcommitted Exotic, smart,andlethal,NumberNineisa MUSASHI NUMBERNINE More volumesalsoavailable! 13+ •#9781421528403192pgs$7.49 Vol. 18 13+ •#9781421528397200pgs$7.49 Vol. 17 13+ •#9781421528380192pgs$7.49 Vol. 16 Released 5/11/10 Released 8/3/10 Released 6/1/10 Released 7/27/10 800.338.6827 books.rightstuf.com “fujoshi,” hetellsherit’s fi ne outofsheer when sheaskshimifit’s okaythatshe’s a his courageandaskYuiko outondate.And Everything goeswell,prompting himtosteel he takesthejob,noquestionsasked. sign outsideanoffi ce andahotgirlinside, girlfriend. Whenhespiesa“helpwanted” Taiga justwantsapart-timejobandcute MY GIRLFRIEND’S A GEEK 13+ •#9781401220563 Vol. 2 13+ •#9781401220556192pgs$7.49 Vol. 1 the newbossoncampus! down infront ofeveryone,Soukabecomes the schoolleader. Butwhenshetakeshim welcomes Soukawithopenarms,including only girlaround! Unfortunately, noteveryone tech academy. outshe’s Butitturns the idea ofstartingoverandenrolls inthelocal no oneknowsthem.Soukaembracesthe start, sotheymovetoanewplacewhere Souka andhermotherare lookingforafresh MISS BANCHO MY DARLING! 17+ •#9781934287729592pgs$14.96 Paperback MW hascreated. from Garai’s responsibility tostopthekiller MW. NowYuki’s salvationcanonlycome of anexperimentalpsychoticdrugcalled village rumored tohavebeenthehidingplace witnessed thechemicaldecimationofa murder, andlove.Fifteenyearsagothey accidental partnersintheft,kidnapping, priest whoatonesforYuki’s sins.Theyare but devoidofallmorality. GaraiisaChristian Yuki isayoungbankemployee,charismatic, MW Released 7/13/10 NEKO RAMEN 200 pgs•$7.49

43 BOOKS BOOKS 44 16+ •#9781401215996208pgs$7.49 Vol. 4 16+ •#9781401215989200pgs$7.49 Vol. 3 16+ •#9781401215972192pgs$7.49 Vol. 2 16+ •#9781401215965192pgs$7.49 Vol. 1 grow intosomethingmore? theirmutualaffectionher presence. Will dedication eventuallyleadshimtoaccept this emotionalyoungwoman,butChouko’s who doesn’t quiteknowhowtodealwith the fl ower garden. Kei’s asolitaryperson named Keiandfi nds solaceintendingto she settlesinwithahandsomeyoungwriter After stayingwithseveraldifferent relatives, 18-year-old Choukolosesherwilltolive. Devastated bythelossofherparents, NAME OF THE FLOWER 13+ •#9781401223854192pgs$7.49 Vol. 1 Reobeabletomakethegrade? camp. Will club isnothingshortofamilitary-styleboot precedes themandherfi rst monthinthe male! Theirreputation forbeinghardcore of herlifetofi nd outallofthemembersare on herdomesticside,butgetstheshock in theHomeEconomicsClubtobrushup take mattersintoherownhands.Sheenrolls not beingfeminineenough,Reodecidesto After gettingdumpedbyherboyfriendfor NADESHIKO CLUB 16+ •#9780759530784 Vol. 4 16+ •#9780759530652192pgs$8.24 Vol. 3 16+ •#9780759530362192pgs$8.24 Vol. 2 16+ •#9780759530034192pgs$8.24 Vol. 1 protect himself. teaches thewayofninja,inorder to join hisschool’s NindoClub,aclubthat over it.Againsthiswill,Miharuismadeto him, andeveryninjaisinvolvedinthefi ght to control theentire world,ishiddeninside known asShinraBanshou,withthepower his destinyhadotherplans.Thesecret art caring aboutanything,butunfortunately, Miharu Rokujowascontenttolivelifewithout NABARI NOOU 16+ •#9780759531734192pgs$8.24 Vol. 1 what he’s justgottenhimselfinto! excitement. ButpoorTaiga hasnoidea Released 4/20/10 Released 6/9/10 Released 7/31/10 Released 5/31/10 books.rightstuf.com 800.338.6827 192 pgs•$8.24 enslaving themtohercapriciouswhim.Now demons andspiritsinher“BookofFriends,” Natsume’s age,she bound thenamesof When hisgrandmotherReikowas BOOK OFFRIENDS NATSUME’S More volumesalsoavailable! 13+ •#9781421534749192pgs$7.49 Vol. 48 13+ •#9781421533056192pgs$7.49 Vol. 47 13+ •#9781421525822N/Apgs$131.24 Box Set(Vols. 1-27) within himisaterrifyingforce... unknown toNarutoandhisclassmates, goal: tobecomethenextHokage.But to graduatefrom theNinjaAcademy. His orphan namedUzumakiNarutoisstruggling peace hasreturned,andatroublemaking the Hokage,villagechampion.Today, tailed foxdemonwhichclaimedthelifeof Konohagakure wasattackedbyanine- ninja intheworld.Buttwelveyearsago village ofKonohagakure livethestealthiest Ninja are theultimatepower-andin NARUTO More volumesalsoavailable! 17+ •#9781421533087192pgs$7.49 Vol. 21 17+ •#9781421530758192pgs$7.49 Vol. 20 17+ •#9781421526713192pgs$7.49 Vol. 19 17+ •#VIZ1421501082192pgs$6.74 Vol. 1 and all-nightparties. world explodingwithmusic,fashion,gossip become bestfriends.TheworldofNanaisa backgrounds, theysomehowmeetand they comefrom completelydifferent who share thesamename.Eventhough This isthestoryoftwo20-year-old women NANA Released 6/8/10 Released 7/6/10 PICK SSTAFF P T I A C F K F KURASHINA SENSEI’S PASSION More volumesalsoavailable! More volumesalsoavailable! 13+ •#9781427817792143pgs$8.24 Vol. 1 Soup Nazi-there’s anewcatintown! customers are dissatisfi ed! Sostepaside, his noodles...andiseasilyangered when as hismentor. NowTaishou takespridein a kindramenshopownerwholaterserved the streets untilthedayhewassavedby away from homeandhadahard lifeon Taishou wasaformerkittenmodelwhoran NEKO RAMEN 16+ •#9780345520593 Vol. 6 16+ •#9780345517913208pgs$8.21 Vol. 5 16+ •#9780345517906208pgs$8.21 Vol. 4 16+ •#9780345509987208pgs$8.21 Vol. 1 the anime. A retelling oftheoriginalseriesbasedon NEO 16+ •#9780345521590 Vol. 27 16+ •#9780345521118192pgs$8.21 Vol. 26 16+ •#9780345518828192pgs$8.21 Vol. 25 16+ •#9780345514271192pgs$8.21 Vol. 24 16+ •#034547046X208pgs$8.21 Vol. 1 conjuring sometimesmakesthingsworse! them tohelpothers-eventhoughhis magic powers,Negijustcan’t resist using under strictinstructionsnottodisplayhis an all-girlshighschool.Andalthoughhe’s being senttoJapanteachEnglish...at from aBritishschoolforwizards andis Ten-year-old NegiSpringfi eld justgraduated ORIGINAL SERIES MAGISTER NEGI MAGI NEGIMA! ALL •#9781421532455200pgs$7.49 Vol. 3 ALL •#9781421532448208pgs$7.49 Vol. 2 ALL •#9781421532431208pgs$7.49 Vol. 1 names back. the creatures willdoanythingtogettheir Natsume istheownerofbook,and Released 6/8/10 Released 8/31/10 Released 4/27/10 Released 7/6/10 Released 7/27/10 Released 5/25/10 192 192 pgs•$8.21 pgs•$8.21 off ofacatstatue,he’s cursedwithaspell When Junpeiaccidentallyknocks thehead NYANKOI 16+ •#9781421532202320pgs$11.21 Ian’s experiencesinanovel:NotSimple. narrative ofJim,areporter driventocapture story unfoldsbackwards through theframing and reuniting withhisbelovedsister. His America inthehopeofrealizing hisdreams history, travelsfrom AustraliatoEngland Ian, ayoungmanwithfractured family NOT SIMPLE More volumesalsoavailable! 16+ •#9781421521886208pgs$7.49 Vol. 9 16+ •#9781421519029200pgs$7.49 Vol. 8 16+ •#9781421518954208pgs$5.99 Vol. 1 ever thoughtpossible! morelearn from the“real world”thanhe the waysofunderworld...andNorawill Kazuma Makkari.isabouttolearn of servitudewithcool-as-icestarstudent to liveamongmortalsandentersabond the sakeofhis“education,”Noraissent Demon Sovereign onetoomanytimes.For Nora, anunrulydemon,hasdefi ed the DEVILDOM CHRONICLE OF NORA:LAST THE 16+ •#9780345512444208pgs$8.21 Vol. 3 16+ •#9780345512437208pgs$8.21 Vol. 2 16+ •#9780345512420208pgs$8.21 Vol. 1 gorgeous, andsuper-cool ninjawarriors! to hisninjaservants,agroup ofglamorous, him regain histhrone... andintroduces him swears herloyaltytohim,promises tohelp last livingdescendantoftheroyal family!She beautiful femaleninjawhotellshimhe’s the a completeoutcast.Butthenhemeets onhisforehead,a strangehorn Raizois have nohopeofbecominganinja.With Raizo isjustthesortofboywhoseemsto NINJA GIRLS 16+ •#9780345516305208pgs$8.21 Vol. 2 16+ •#9780345516251208pgs$8.21 Vol. 1 plague thatthreatens theentire world! vision ofanevengreater threat: adeadly from theinstitution,Naoyahasapsychic center. Butaftertheymakeadaringescape imprisoned inanexploitativeresearch Their parents castthemoutandhad powers thatsetthemapartfrom humanity. Naoya, brothers withamazingpsychic The worldisalonelyplaceforNaotoand NIGHTHEAD GENESIS 13+ •#9781427816931 Vol. 6 13+ •#9781427816924208pgs$8.24 Vol. 5 13+ •#9781427814487192pgs$8.24 Vol. 4 13+ •#9781427814470192pgs$8.24 Vol. 3 13+ •#9781427814463192pgs$8.24 Vol. 2 13+ •#9781427814456192pgs$8.24 Vol. 1 best malefriendisnowacutegirl?! She’s nowamiddleschoolboy-whilehis he does.AndKeidai’s wifefrom thepast? they don’t quiteremember thingstheway him are allalsoreincarnated-although the Italianwarrior, Sirix.Hisfriendsaround remembers hispastlifeinPompeii,livingas Keidai Saekiisahighschoolstudentwho NG LIFE Released 6/22/10 Released 5/25/10 Released 6/29/10 Released 5/4/10 Kurashina Sensei’s Passion©NatsuhoShino2004. 192 pgs•$8.24 to fi nd asmanyO-Partstheycan. be herbodyguard, andtogethertheysetout doesn’t believeinfriendship,heagrees to hunter likeherfamousfather. ThoughJio Ruby whowantstobecomeatreasure incredible ferocity. Hemeetsagirlnamed suspect thatinsidehimsleepsademonof only trustsonething:money. Littledoeshe Jio isayoungboywithtragicpastwho O-PARTS HUNTER 13+ •#9781401224448 Vol. 1 curse isreally ablessingindisguise! outthatthe a crushon.Itmayjustturn Mizuno, thatis.She’s thecutegirlhe’s had they allthinkhe’s gonecrazy. Allexcept shares thisinformationwithhisclassmates, now understandwhatcatssay. Whenhe with hismission.Ontheotherhand,hecan he’s allergictothemisn’t goingtohelphim hundred gooddeedsforcats.Thefactthat The onlywaytoavoidthecurseisdoa that transformshimintoanactualfeline! 12+ •#9781595823861192pgs $8.21 Vol. 13(2ndEd) 12+ •#DHGN1593073879192pgs •$8.21 Vol. 1(2ndEd) the MaterialWorld! inevitable clashoftheSpiritualPlaneand and hisgoddess-out-of-wateradjusttothe hilarious headacheafteranotherasKeiichi him forever, hegetshiswish,andone When hejokinglyaskshertostaywith literal goddessBelldandy... andonewish. Helpline, he’s delivered theliving,breathing, accidentally dialstheGoddessTechnical When collegestudentKeiichiMorisato OH! MYGODDESS 16+ •#9781401216092 Vol. 3 16+ •#9781401216085192pgs$7.49 Vol. 2 16+ •#9781401216078192pgs$7.49 Vol. 1 spirit ofherdeceasedbrother! fi nds herselfsharingher ownbodywiththe after -tohershockandconfusionMasago gets hitbyanoncomingtruck.Nottoolong Shiro sacrifi ces hisownlifeforMasagoand brother. Thenoneday, tragedystrikeswhen her verypopularandcharismaticolder but whoalsohastoliveintheshadowof who notonlydoesn’t standoutinacrowd, Masago isanaveragehighschoolstudent OH! MYBROTHER 17+ •#9781934287989448pgs$11.21 Part 2(Paperback) 17+ •#9781934287972384pgs$11.21 Part 1(Paperback) contracts theMonmowdiseasehimself. remote villageinthemountains,where he auspices ofresearch, Kirihitoissenttoa his hospital’s research intoit.Underthe becomes anunknowingguineapigfor pathology ofthediseaseKirihitohimself the metamorphosis.Whilestudying beasts andkillsthemwithinamonthof which transformshumansintodog-like been introduced totheMonmowdisease, Kirihito Osanaiisayoungdoctorwho’s just KIRIHITO ODE TO 16+ •#9781569700341200pgs$12.95 realize thechangethathascomeoverhim? ever closertohistemptingteammate,willhe where Yasunari plays.AsWakamiya draws he joinsKanonUniversity’s basketballteam, fi ve years!Inorder togetcloserYasunari, Wakamiya hasbeenchasingYasunari for MY AFFECTION OBJECT OF More volumesalsoavailable! 16+ •#9781421525679192pgs$7.49 Vol. 19 16+ •#VIZ1421508559192pgs$7.49 Vol. 1 Released 7/13/10 Released 8/31/10 200 160 pgs•$7.49 pgs•$7.49 13+ •#9781421534558208pgs $7.49 Vol. 39 13+ •#9781421534541208pgs $7.49 Vol. 38 13+ •#9781421534534232pgs$7.49 Vol. 37 13+ •#9781421534527216pgs$7.49 Vol. 36 13+ •#9781421534510192pgs$7.49 Vol. 35 13+ •#9781421534503232pgs$7.49 Vol. 34 13+ •#9781421534497232pgs$7.49 Vol. 33 13+ •#9781421534480216pgs$7.49 Vol. 32 13+ •#9781421534473208pgs$7.49 Vol. 31 13+ •#9781421534466208pgs$7.49 Vol. 30 13+ •#9781421534459232pgs$7.49 Vol. 29 13+ •#9781421534442192pgs$7.49 Vol. 28 13+ •#9781421534435192pgs$7.49 Vol. 27 13+ •#9781421534428200pgs$7.49 Vol. 26 13+ •#9781421528465208pgs$7.49 Vol. 25 13+ •#9781421528458216pgs$7.49 Vol. 24 13+ •#9781421528441232pgs$5.96 Vol. 23 13+ •#VIZ1569319014208pgs$5.96 Vol. 1 Piece,” thegreatest treasure intheworld! Now grown, Luffy setsoutinsearch of“One tales ofthebuccaneer“Red-Haired” Shanks. child, Luffy wasinspired bylisteningtothe eating thecursedGum-GumFruit!Asa D. Luffy, whogainedstrangepowersfrom become thegreatest ofthemall:Monkey In aworldofpirates,onemanwantsto ONE PIECE 16+ •#9780759531796192pgs$8.24 Vol. 1 and ademonspirittoboot! protectoras asworn oftheAmakawafamily real, verysharpsword, shereveals herself his friendsfrom ademonspiritwithvery her identity. AndwhenshesavesYuuto and he’sup onemorning, leftwonderingabout beautiful girlwhomakesthoseallergiesact fi nds himselfsuddenlyfacetowitha has terriblecatallergies.Sowhenhe Sixteen-year-old orphanYuuto Amakawa More volumesalsoavailable! 13+ •#9781421521459276pgs$9.74 Vol. 7:Izakaya -PubFood 13+ •#9781421521442268pgs$9.74 Vol. 6:TheJoyofRice 13+ •#9781421521398272pgs$9.74 Vol. 1:JapaneseCuisine and amasterfultouchinthekitchen. encyclopedic knowledgeoffoodanddrink, don’t: palate,an anexquisitelydiscerning he possessesqualitieshisothercolleagues newspaper’s 100thanniversary?Because with the“UltimateMenu”tocelebrate given theimportantjobofcomingup all-around slacker. Sowhyhashebeen blunt, under-ambitious, andgenerallyan Yamaoka hasareputation forbeingover- Around theoffi ces ofTozai News,Shiro A LACARTE More volumesalsoavailable! 12+ •#9781595825094160pgs$8.21 Vol. 35 12+ •#9781595824486144pgs$8.21 Vol. 34 12+ •#9781595825247192pgs$8.21 Vol. 15(2ndEd) 12+ •#9781595824554192pgs$8.21 Vol. 14(2ndEd) Released 6/30/10 Released 4/28/10 Released 6/30/10 fi rst timeever-withherdreamy classmate, a secret lovetriangle!Rui’s inloveforthe 13. It’s evenharder whenyou’re partof It’s hard enoughbeinginlovewhen you’re PLANET 17+ •#9781421531694232pgs$9.74 Vol. 4 17+ •#9781421527499232pgs$9.74 Vol. 3 17+ •#9781421527482200pgs$9.74 Vol. 2 17+ •#9781421527475216pgs$9.74 Vol. 1 to serveintheShogun’s InnerChamber... And themostbeautifulofmenare sent providers oflife,are carefully protected. that oftheShogun.Themen,precious roles traditionallygrantedtomen,even percent. Women have taken onallofthe male populationhasfallenbyseventy-fi ve eighty yearsofthefi rst outbreak, the to prey onthecountry’s men.Within disease calledtheRedPoxhasbegun In EdoperiodJapan,astrangenew THE INNERCHAMBERS OOKU: 13+ •#9780345514646208pgs$8.21 dream cometruecanbeanightmare! choose yourwishcarefully -sometimesa the deadtobebrought backtolife.But those whohavewronged you,orevenfor to fallinlovewithyou,forrevenge against - butonlyone!You canwishforyourcrush dark angelwillappeartograntyouawish Just sendatexttocertainaddress anda ONLY ONE WISH 16+ •#9780316081191176pgs$8.24 Vol. 3 16+ •#9780316081146176pgs$8.24 Vol. 2 16+ •#9780759530348192pgs$8.24 Vol. 1 unexpected opponent? Nanami stepsuptodefendheragainstan But willTomotaka’s allegiancesshiftwhen to ridtheworldofNanami’s presence! a swordswoman whowillstopatnothing being pursuedbyTomotaka Onigoroshi, through herveins,whichiswhyshe’s that there’s anancientpowerrunning new schoolyear. Littledoessheknow - gettingclosertohercrushduringthe Nanami isexcitedaboutonlyonething ONINAGI More volumesalsoavailable! 13+ •#9781421534701208pgs$7.49 Vol. 54 13+ •#9781421534695216pgs$7.49 Vol. 53 13+ •#9781421534688216pgs$7.49 Vol. 52 13+ •#9781421534671232pgs$7.49 Vol. 51 13+ •#9781421534664208pgs$7.49 Vol. 50 13+ •#9781421534657232pgs$7.49 Vol. 49 13+ •#9781421534640232pgs$7.49 Vol. 48 13+ •#9781421534633216pgs$7.49 Vol. 47 13+ •#9781421534626200pgs$7.49 Vol. 46 13+ •#9781421534619216pgs$7.49 Vol. 45 13+ •#9781421534602232pgs$7.49 Vol. 44 13+ •#9781421534596224pgs$7.49 Vol. 43 13+ •#9781421534589208pgs$7.49 Vol. 42 13+ •#9781421534572232pgs$7.49 Vol. 41 13+ •#9781421534565232pgs$7.49 Vol. 40 Released 8/17/10 Released 4/20/10 Released 5/31/10 Released 7/6/10 Released 6/1/10 Released 6/1/10 Released 6/1/10 Released 6/1/10 Released 6/1/10 Released 5/10/10 Released 5/10/10 Released 5/10/10 Released 5/10/10 Released 5/10/10 800.338.6827 books.rightstuf.com One day, Haruhi, ascholarshipstudentat HOST CLUB OURAN HIGHSCHOOL 16+ •#9781569701287200pgs$12.95 if thisloveisworthbreaking hisvowover. himself suffer heartbreak again,hewonders beauty. DespiteRaoul’s vownevertolet and Raoulfi nds himselfcaptivatedbyAsif’s The princeismore radiant thanthesun, meets thehandsomeArabianprince,Asif! following adevastatingheartbreak, Raoul Sequel totheoriginalseries.Duringatrip ARABIAN NIGHTS More volumesalsoavailable! 13+ •#9781421532363200pgs$7.49 Vol. 7 13+ •#9781421529301200pgs$7.49 Vol. 6 13+ •#9781421527376192pgs$7.49 Vol. 5 13+ •#9781421525372200pgs$7.49 Vol. 4 13+ •#9781421521862208pgs$6.74 Vol. 1 anyone, muchlesstothegirlhe’s fallingfor? men! CanAsukaevershowhistrueselfto butshelikes only themanliestof to Ryo, to saveherlife.Asukafi nds himselfdrawn hand, isagirlwhocan’t seworbakeacake Miyakozuka, ontheother jock instead.Ryo hobbies andplaythepartofamasculine to actmanly, Asukamusthidehisbeloved But inaworldwhere boysare expected stuffed animalsandreading shojocomics. things -sewing,knitting,makingcute Asuka Masamuneisaguywholovesgirly OTOMEN 16+ •#9781569700877200pgs$12.95 Vol. 1 the non-stopscreaming ofthedead? mysterious cases...butcanKanamehandle police departmenttotakeonunsolvedand Yasuhide, Kanamecollaborateswiththe as aprivateinvestigator. hispartner, With Investigation, Otonashiresigned towork detective specializinginSoundEngineering Though heonceworkedasatop-notch even hearvoicesfrom the“otherside.” hearing ability, somuchthathecan Kaname Otonashiisgiftedwithasuper- VOICE FROM THE DEAD OTODAMA: More volumesalsoavailable! 17+ •#9781401214326282pgs$9.74 Vol. 8 17+ •#9781401214319282pgs$9.74 Vol. 7 17+ •#9781401214258192pgs$9.74 Vol. 1 an armytovictory! theshockingtruth,butshemustlead learns the princessiscaptured. Fana notonly cut shortwhenGranzaattacksCordia and twins. Afriendshipquicklydevelopsbutis strong resemblance thattheycouldbe surprise ofbothgirls,theyshare sucha his daughter, thePrincessOrfi na. To the her underhiscare andintroduces herto There sheencounterstheking,whotakes homeland, shefl ees tonearbyCordia. When theforces ofGranzaattackFana’s ORFINA 13+ •#9780345513403176pgs$8.21 Vol. 3 13+ •#9780345513397192pgs$8.21 Vol. 2 13+ •#9780345513380208pgs$8.21 Vol. 1 assistant movesinwithher! to makemattersworse,herhotteaching friend, theadorableboynextdoor. Then, else’s majorsecret crush,herownbest Kaoru. ButRui’s thetargetofsomeone Released 8/3/10 Released 5/4/10 Released 5/26/10 Released 9/28/10

45 BOOKS BOOKSBOOOKO S 46 books.rightstuf.combook 800.338.6827 s.ri ghts tuf. com 80 0.33 33 8.68 27 Tegami Bachi©2006by Hiroyuki Asada/SHUEISHA Inc. so muchshe’lldoanything tokeepher Hana lovesbeingthecenter ofattention, little sister, Ageha, isjustashytomboy. Hana istheultimateteenqueen, buther most populargirlinschool! The ultra-glam even harder whenyouroldersisteristhe It’s nofunbeingahighschooloutcast.It’s PAPILLON 13+ •#9780345514622 Vol. 2 13+ •#9780345514639208pgs$8.21 Vol. 1 inherit themissionoftheirancestors. problem again, MitsukiandKakerumust thedemonsbecominga demons. With of priestswhosealedawaydisorderly discovers theyare thedescendants demon sealstheirfateforever: thepair However, astrangeencounterwith growing up,andstilldon’t asteenagers. the sonofapriest.Theynevergotalong grew upacross thestreet from Kakeru, Mitsuki, anonlychildataShintoshrine, PANIC XPANIC 16+ •#9780316076081192pgs$8.24 Vol. 2 16+ •#9780316076074192pgs$8.24 Vol. 1 shadowy cabalcalledPandora! him before fallingintotheclutchesof he mustunravelthemysteriessurrounding deeper downtheproverbial rabbithole, black rabbitcalledAlice.AsOzplunges - andperhapshissanityare savedbya in aprisonknownastheAbyss,Oz’s life Oz forthesinsofapastlife.Incarcerated birthday, and dark forces risetopunish is acarefree teen.Thatis,untilhisfi fteenth Heir toanaristocraticfamily, OzVessalius More volumesalsoavailable! 15+ •#9781421535654192pgs$7.49 Vol. 14 15+ •#9781421526737200pgs$7.49 Vol. 13 15+ •#VIZ1591169151184pgs$6.74 Vol. 1 are from everyoneelse. there shediscoversjusthowdifferent they she’s forced toworkfortheclub,andit’s super-rich guys.To paybackthedamages, Club,” amysteriousgroup consistingofsix an $80,000vasethatbelongstothe“Host the exclusiveOuranHighSchool,breaks OYAYUBI KARAROMANCE Released 8/31/10 Released 5/31/10 Released 7/6/10 SEE MAGICTOUCH 208 pgs•$8.21 smoke-fi lled alleyharborsCountD’s pet in thisfollow-uptotheoriginal series.A Count Dhasmovedhispetshop toJapan TOKYO PET SHOPOFHORRORS 17+ •#9781934287835 Vol. 1 underworld’s doing! go inthefi rst place?Answer:it’s allthe fi nd whathewaslookingfor, whydidhe about thisdarkside?Andifhedoesn’t of Tokyo? Howcouldhenothaveknown comics. Where ishisanimatedversion crack-ups ofhisfavoritecartoonsand hustlers andhoesinsteadofthecosplaying in theheartofTokyo, he isshockedtosee When teenagedotakuMiltonfi rst setsfoot PEEPO CHOO 16+ •#9781427814180192pgs$8.24 Vol. 3 16+ •#9781427814173192pgs$8.24 Vol. 2 16+ •#9781427814166192pgs$8.24 Vol. 1 defeat thisnewterror onthehorizon. going totakemore thanmere swords to threat totheShinsengumiarises,andit’s no rest forthepeaceful.Anunexpected premium peacekeepingforce. Butthere is now-offi cial police,intohistoryasKyoto’s - andpropelled theShinsengumi,Kyoto’s that crushedtheanti-shogunaterebellion have passedsincetheIkedayaIncident Sequel totheoriginalseries.Three months KUROGANE PEACEMAKER More volumesalsoavailable! 13+ •#9780345512345192pgs$8.21 Vol. 4 13+ •#9780345505194192pgs$8.21 Vol. 1 back forever. no one,notevenHana,canholdAgeha a planthatwillchangeherlife.Because little sisterinhershadow. ButAgehahas TEGAMI BACHI:LETTERBEE Released 7/13/10 256 pgs•$9.71 PICK SSTAFF P T I A C F K F 16+ •#9781421532677200pgs $9.74 Vol. 7 16+ •#9781421527215200pgs $9.74 Vol. 6 16+ •#9781421519180200pgs$9.74 Vol. 1 that hehimselfisoneoftheseventargets. robot serial murders -theonlycatchis assigned toinvestigatethesemysterious Europol’s topdetective,Gesicht, is the sevengreat robots oftheworld. someone orsomethingisouttodestroy humanoid robots passforhuman, In adistantfuture, where sentient URASAWA X TEZUKA : 13+ •#9780345514691 Vol. 2 13+ •#9780345514684176pgs$8.21 Vol. 1 totally cluelessaboutlove! someone pleasegivemesomeadvice?I’m what are wesupposedtoactuallydo?Can supersmart. Butnowthatwe’re goingout, and he’s handsome and talented my fi rst boyfriend.HisnameisRenji-kun, Hello, Kokonahere. So,Ijuststarteddating PINK INNOCENT More volumesalsoavailable! 13+ •#9781427807670384pgs$14.99 Vol. 5 13+ •#MM1598168193192pgs$7.49 Vol. 1 with andrelease trappedspirits! Riku hasthemagicalabilitytocommunicate working parttimeatthestore isabore -but other businessesintown.You mightthink he helpsthefamilybusinesscompetewith part-time jobatthefamily’s shop.There, in themythicallandYamato, hetakesa When Rikujoinshiswackylong-lostfamily PICK OF THE LITTER 13+ •#9781401224097 Vol. 1 Kazuha andhowtheybecamefriends. Senko andMakihaveahearttoabout - andafterwards, Saki’s nuptuals!Then success! Theexpoisrifewithsurprises The hairshowhasarrived,andit’s ahuge with romantic relationships forthefi rst time. her youngersiblings-fi nds herselfdealing free timeisalwaysfi lled with takingcare of Kazuha Akiyoshi-aresponsible girlwhose PHANTOM GUESTHOUSE More volumesalsoavailable! 16+ •#9781427810939192pgs$8.24 Vol. 5 16+ •#9781427810922192pgs$8.24 Vol. 4 16+ •#9781427810892192pgs$7.49 Vol. 1 tortured humansouls. the onedestinedtoexorcise demonsoutof possessed byademon,heawakens-as So whenAsahi’s friendisfoundouttobe with whomhehasadeep,emotionalbond. strength from hischildhoodfriend,Asahi, as asummoner, Tamaki hasalwaysfound threaten mankind.Burdened byhisduty summoners taskedtobattleevilforces that Tamaki Otoyaisthelastinalineofancient More volumesalsoavailable! 16+ •#9781427817112192pgs$8.24 Vol. 6 16+ •#MM1427806071192pgs$7.49 Vol. 1 held accountable! the contractisbroken theCountcannotbe exclusive contract.Butbuyersbeware: if of magicalcreatures thatcomewithan on sellingloveanddreams intheform every-day variety. TheCountprideshimself shop, where thepetssoldaren’t your Released 8/31/10 Released 5/4/10 Released 8/3/10 176 192 pgs•$8.21 pgs•$7.49 800.338.6827 books.rightstuf.com Ryoma hasproven hisskillsbywinningfour Ryoma of themostcompetitiveteams inJapan. Gakuen tennisteam,known forbeingone EchizenjustjoinedtheSeishun Ryoma PRINCE OF TENNIS 13+ •#9781427817259192pgs$8.24 Vol. 2 13+ •#9781427817242198pgs$8.24 Vol. 1 schooler wants:normalcy? their desires andachievewhateverhigh strange bedfellowsfi gure outhowtocurb musing onhisownbeauty. Canthesetwo refl ection sendshimintoapassionate troubled -themere glimpse ofhisown sweetly formore! Natsuhikoisequally movement againstherhasbegging has astrangeproblem -asingle,violent Mitsuru isbeautifulandgraceful,butshe PORTRAIT OFM&N 16+ •#9781401224646162pgs$7.49 Vol. 1 prove tobemore than he canhandle! help hecanget,butthisfeistyspiritmay later forgotabout.Phoron coulduseallthe summons aspirithemetinchildhoodbut student namedPhoron accidentally which bindsthespiritstothem.Astruggling create magicalsoundswiththeirmusic, spirits livesidebyside.Young musicians In aplacecalledPolyphonica,humansand CARDINAL CRIMSON POLYPHONICA: ALL •#9781421532783172pgs$8.99 Color full-color fi lm framestonarratethestory. this newPokémonisfullofsurprises!Uses Dawn andBrock, whosoondiscoverthat far from home,ShayminisfoundbyAsh, Pokémon GiratinaandDialga.Whiskedaway drawn intoabattlebetweentheLegendary But oneday, Shayminisaccidentally living happilyinforests andfi elds offl owers. Shaymin isapeacefulGratitudePokémon, ANI-MANGA GIRATINA &THESKYWARRIOR More volumesalsoavailable! ALL •#9781421534916200pgs$5.99 Vol. 7 ALL •#9781421531700192pgs$5.99 Vol. 6 ALL •#9781421522869192pgs$5.99 Vol. 1 stop theirevilplans? Hareta andPiplupdefeatTeam Galacticand Galactic ishuntingforDialgatoo.Can of thelegendarypokémonDialga.ButTeam his newfriendMitsumi,hesetsoff insearch Along withhisfi rst pokémon,Piplup,and decides tobecomeapokémontrainer. Recruited byProfessor Rowan,Hareta DIAMOND &PEARLADVENTURE More volumesalsoavailable! ALL •#9781421530611200pgs$5.99 Vol. 8 ALL •#9781421530604224pgs$5.99 Vol. 7 ALL •#9781421530598208pgs$5.99 Vol. 6 ALL •#9781421530581208pgs$5.99 Vol. 5 ALL •#9781421530574216pgs$5.99 Vol. 4 ALL •#9781421530543200pgs$5.99 Vol. 1 Pikachu won’t besoeasytowinover! and Poliwhirlseemgame,butindependent he wantstobetheirfriend,too.Bulbasaur Red doesn’t justwanttotrainPokémon, ADVENTURES POKEMON More volumesalsoavailable! 16+ •#9781421533438256pgs$9.74 Vol. 8 Released 6/8/10 Released 5/18/10 Released 7/6/10 Released 8/3/10 Released 6/1/10

47 BOOKS BOOKS 48 17+ •#9781401224110194pgs $9.74 Vol. 2 17+ •#9781401224103202pgs $9.74 Vol. 1 that couldcosthimhissoul! powerful soldierinthearmy, butataprice Zhang isabouttobecomethemost give himthepowertoresist allwounds. a cliff. Heis rescued bytwowizards who little girl,anarrow tohisneckthrows himoff some ofhisown.Ashesavesthelifea Zhang missesmostofthataction,hehas an invasionofawalledcity, andalthough ’s fi rst dutyinthearmyisto repel RAMPAGE 17+ •#9781427816740 Vol. 1 silver-haired boyforthebattleoftheirlives! wishes, Oribeteamsupwithamysterious artifact thatholdsthepowertogrant by aQwaserseekingRomanovfamily to becomecenteroftheconfl ict! Attacked the elements.HighschoolerOribeisabout “humans” created bytheChurch tocontrol waged betweenQwasers,supernatural In thenearfuture, adarkwarisbeing QWASER OFSTIGMATA N/R •#9781894937870224pgs$19.95 maturation asastorywriter. of theJapaneseeverymanbutTatsumi’s Tokyo, exposingnotonly theseedydealings delve intotheurbanunderbellyof1960s Abandon TheOldInTokyo continuesto Following ThePushManandOtherStories, cartooning legendYoshihiro Tatsumi. collects theshortstoriesofJapanese The secondinathree-volume seriesthat ABANDON THEOLDINTOKYO N/R •#9781896597850224pgs$19.95 sexual lifeoftheindividual. society andthetroubled emotionaland overwhelming, bustling,crowded, modern commenting ontheinterplaybetweenan haunting, disturbing,anddarklyhumorous, life. Tatsumi’s storiesare simultaneously Tatsumi’s shortstoriesaboutJapaneseurban debut volumeinanewseriesthatcollects The PushManandOtherStoriesisthe ORIGINAL STORY STORIES PUSH MAN&OTHER More volumesalsoavailable! 16+ •#9780345514288224pgs$8.99 Vol. 7 16+ •#0345496647224pgs$8.99 Vol. 1 creature ofdarknessshecan’t takedown! servant andasuper-cute robot, there’s no thehelpofher her toraisethedead.With look great, butshehaspowersthatallow chainsaw andasmile.Notonlydoesshe an awesomewarriorwhofi ghts evilwitha the samething:beautifulPrincessHime, all oftheseferocious creatures are afraidof Werewolves, demons,monsters,vampires - RESURRECTION PRINCESS More volumesalsoavailable! ALL •#9781421528502192pgs$7.49 Vol. 38 ALL •#9781421528496192pgs$7.49 Vol. 37 ALL •#9781421528489176pgs$7.49 Vol. 36 ALL •#9781421528472192pgs$7.49 Vol. 35 ALL •#9781421524351184pgs$7.49 Vol. 34 ALL •#VIZ1591164354192pgs$5.96 Vol. 1 untilsummer.tournaments Seishun Gakuenthatfreshmen don’t playin challengesaruleof hisskills,Ryoma With titles. straight Americanjuniortournament Released 6/23/10 Released 8/3/10 Released 7/6/10 Released 5/4/10 books.rightstuf.com 800.338.6827 192 pgs•$9.74 are unable tosaythethingstheyneed relationship andatwork,Ichiro andSachiko to arrangeamarriageforher. Bothintheir from his comics,Sachiko’s parents are eager others. WhileIchiro attemptstomakealiving sleeping -usuallytogetherandattimeswith drinking, smoking,daydreaming, and revolutionaries; theirspare timeisspent hope forsomethingbetter, butthey’re no The early1970s.Ichiro andSachiko RED COLOREDELEGY More volumesalsoavailable! 13+ •#9781421529028264pgs$7.49 Vol. 9 13+ •#9781421529011208pgs$7.49 Vol. 8 13+ •#9781421522296200pgs$7.49 Vol. 7 13+ •#VIZ1421517736200pgs$7.49 Vol. 1 search forhisqueentothisday. relentless vampires, Akabara continuesto true location.Despitebeingpursuedby so thatthekingwouldneverfi nd her her away, erecting thousandsof fakeseals were unabletokillthequeen,theysealed kingdom andhisqueen.Sincehumans Akabara Rosered Strausslostbothhis Thousands ofyearsago,Vampire King FALLEN VAMPIRE RECORD OF A More volumesalsoavailable! 16+ •#9781421528571192pgs$7.49 Vol. 16 16+ •#9781421528564200pgs$7.49 Vol. 15 16+ •#9781421528557200pgs$7.49 Vol. 14 16+ •#VIZ1421506718192pgs$5.99 Vol. 1 mafiboss! a to groom Tsuna forhisfuture lifeasabig wassenttoJapan at hishouse.Reborn claims tobeanItalianhitman,showsup a fedora-wearing,gun-totingtoddlerwho everything changesforTsuna whenReborn, failure atschool,sports,andsociallife.But Tsuna, atimidjuniorhighstudent,is REBORN! More volumesalsoavailable! 16+ •#9781421530710216pgs$9.74 Vol. 8 16+ •#9781421530703224pgs$9.74 Vol. 7 16+ •#9781421519944216pgs$9.74 Vol. 6 16+ •#9781421519890224pgs$9.74 Vol. 1 fast breaks... onwheels. become paralyzed.Drama,tragedy, and gets intoanaccidentthatcausesagirlto upsidedownwhenhe whose lifeisturned Nomiya isatoughguyandb-ballnut connected through basketball.Tomomi different issuesinvolvingparaplegia-are Three youngmen-allstrugglingwith REAL 16+ •#9781427817457200pgs$8.24 Vol. 1 mother’s experiments! true bytrickinghimintoparticipatinginher she’s abouttomakehisdreams come Mirea Mizushima.Littledoesheknowthat heroes, whichheshares withhisclassmate that keepshimgoingishisloveforsuper and can’t winanyfi ghts. Theonething gets teasedallthetimeforhisheight super hero, Mr. Thunder, butinsteadhe a break. Hewantstoemulatehisfavorite Shuto Katsuragiisashrimpwhocan’t catch RATMAN Released 5/4/10 Released 4/20/10 Released 5/4/10 Released 7/6/10 SEE YURARA RASETSU not sopleasant.Olgahasnevertoldher Nicoletta warmly, butOlga’s reception is staff ofbespectacledgentlemenwelcomes restaurant ownedbyOlga’s husband.The her atCasettadell’Orso,acharminglittle abandoned herlongago.Nicolettafi nds Rome tofi nd hermother, Olga,who At theageof21,Nicolettatravelsto ORIGINAL SERIES RISTORANTE PARADISO 16+ •#9781421536217192pgs$7.49 Vol. 4 16+ •#9781421534879200pgs$7.49 Vol. 3 16+ •#9781421534862192pgs$7.49 Vol. 2 16+ •#9781421534855176pgs$7.49 Vol. 1 between lifeanddeath! herself followinghimintotheamazingworld Rinne Rokudoshowsup,Sakurafi nds her alone!Whenmysteriousclassmate she justwishestheghostswouldleave power toseeghosts.Nowinhighschool, was achild,SakuraMamiyahashadthe Ever sinceastrangeencounterwhenshe RIN-NE N/R •#9781897299869240pgs$24.95 prevail atthecenterofthesetenderstories. fundamental emotionsofthehumanheart faded intomemoryandmyth,theuniversal farmers. Whiletheworldtheyinhabithas and thediffi cult lifeofmanuallaborers and life, strugglingtosurvivetheharshseasons hold swayoverapeopleinthefullvigorof magical worldwhere ancestraltraditions of SusumuKatsumata’s youth,aslightly It isthepre-modernJapanesecountryside RED SNOW More volumesalsoavailable! 16+ •#9781421522548200pgs$7.49 Vol. 28 16+ •#VIZ159116429X192pgs$7.46 Vol. 1 queen’s palace! captured byarmedtroops andtakentothe somewhere intheMiddleEast.Sheisthen has beentransportedtoanancientvillage into thewater. Sheemergestofi nd thatshe out ofapuddleonthestreet anddragher boyfriend, Himuro. Onenight,handsappear her handsomechildhoodfriend-turned- Yuri isecstaticafterherfi rst kisswith 16+ •#9781427817211 Vol. 2 16+ •#9781427817204175pgs$8.24 Vol. 1 before bitingaspicypepperfi rst! Kokaku willtakeabiteoutofcrime-butnot friend Entoandcutie-piegirlofactionRan, thehelpofhisbespectacled bad guys!With pepper ishelpinghisfatherkickthebuttof Kokaku likesbetterthaneatingahotchili Scratch that-helovesthem.Theonlything Samurai KokakuSentolikespeppers. RED HOTCHILISAMURAI N/R •#9781897299401240pgs$24.95 their bodylanguageaswithwords. say, ultimatelycommunicatingasmuchwith Released 8/3/10 Released 7/20/10 Released 4/20/10 available onlineandbyphone! More volumesandmoreseries 192 pgs•$8.24 13+ •#VIZ1421513757208pgs$6.74 Vol. 1 guy whomadehersuffer herfi rst defeat. group justfortheopportunitytotrounce the match. Now, at15,shejoinsaspecial Hikari losttoKeiinanimpromptu wrestling takes tobeatthisguy... somehow!Atage6, and Hikariisdeterminedtodowhateverit Takishima. Healways comes outontop, consumed withthedesire tobeatrivalKei Her wholelife,HikariHanazonohasbeen S.A More volumesalsoavailable! 16+ •#9781421520810776pgs$13.49 Vol. 9 16+ •#9781421520803608pgs$13.49 Vol. 8 16+ •#VIZ1421520737584pgs$13.49 Vol. 1 those inneed.Omnibus“Big”edition. for hispast,defendtheoppressed, andaid reverse-bladed sword and fi ghts torepent swordsmanship, HimuraKenshinwieldsa changing times.Usinganelitestyleof up theirswords, butafewstillresist the ended. Bylaw, thesamuraimustgive system separatingtheclasseshas It istheMeijiRestoration,andfeudal BIG EDITION RUROUNI KENSHIN More volumesalsoavailable! 16+ •#9781421531373184pgs$7.49 Season 2Vol. 2 16+ •#9781421531366184pgs$7.49 Season 2Vol. 1 16+ •#9781421523552208pgs$7.49 Season 1Vol. 10 16+ •#9781421519036192pgs$5.99 Season 1Vol. 1 gets homefrom MonsterHigh! going tohaveoneheckofahickeywhenhe those herteethonhisnecktoo...?Tuskune’s her armsaround hisneck!Wait asec-are the cutestgirloncampuscan’t waittofl ing the studentbodyisn’t averageatall,and school saveone.Onhisfi rst dayhefi nds Tsukune can’t getacceptedtoanyhigh ROSARIO+VAMPIRE 16+ •#9780316073288 Omnibus enemy lines? Is there anyhopeforalovethatcrosses enemy,with hersworn sheisconfl icted. cruelty. AsJulietfi nds herselffallinginlove that heissimilarlydisturbedbyhisfather’s the sonofLord Montague,shediscovers survived themassacre. Whenshemeets hope forthesuffering citizens:JulietCapulet Neo-Verona withaniron fi st. Butthere is Fourteen yearslater, Lord Montaguerules Montague ledacoup,wipingthemout. the Capuletfamily, buttherivalhouseof Neo-Verona wasoncepeacefullyruledby ROMEO XJULIET 16+ •#9781421532516176pgs$9.74 Vol. 1 The continuationoftheoriginalseries. GENTE 16+ •#9781421532509176pgs$9.74 he mustneverknow. husband thatsheeverhadchildren -and Released 7/20/10 Released 7/31/10 Released 8/3/10 384 pgs•$14.24 More volumesalsoavailable! 13+ •#9781421533100216pgs$7.49 Vol. 16 13+ •#9781421531717200pgs$7.49 Vol. 15 13+ •#9781421527895200pgs$7.49 Vol. 14 13+ •#9781421526751200pgs$7.49 Vol. 13 Butterfl ies, Flowers©2006Yuki YOSHIHARA/Shogakukan. 16+ •#9780759531833 Vol. 2 16+ •#9780759531826192pgs$8.24 Vol. 1 get himbackonthefi eld... ornot. blonde girls,andothereventsofthisnature friends, chanceencounterswithgorgeous soccer forgood,butreunions withchildhood High School.Rakuichithinkshe’s quit and nowattendingChikubushimaPublic soccer whiz,backfrom three yearsinItaly Rakuichi Nagahama,age16isaformer SASAMEKE More volumesalsoavailable! 16+ •#9781421528069192pgs$7.49 Vol. 8 16+ •#9781421528052192pgs$7.49 Vol. 7 16+ •#VIZ142151477X192pgs$6.74 Vol. 1 she needsthatkindness. tragedy strikes,Anndiscovershowmuch mother’s hometown.Butwhenpersonal overbearing kindnessofthepeopleinher city living,Anncan’t getusedtothealmost Shimane. Accustomedtotheanonymityof and hermothermovefrom Tokyo torural After herparents getdivorced, AnnUekusa 17+ •#9781427816207 Vol. 5 17+ •#9781427816191192pgs$9.74 Vol. 4 17+ •#9781427816184192pgs$9.74 Vol. 3 17+ •#9781427816177192pgs$9.74 Vol. 2 17+ •#9781427816160192pgs$9.74 Vol. 1 the hijinksbegin! concentration more diffi cult thanever!Let newly awakenedlibidoisgoingtomake sisters! He’s there totrain,butYoichi’s staying atadojorunbyfourbabelicious continue histraining,onlytofi nd himself a great samurai.Heheadstothecity small mountainvillagelookingtobecome Yoichi Karasumaisayoungmanfrom a ASU NO YOICHI SAMURAI HAREM: More volumesalsoavailable! 16+ •#9780345521552416pgs$11.21 Vols. 37-38Omnibus 16+ •#9780345520265416pgs$11.21 Vols. 35-36Omnibus inhabiting onebody. Kyoshiro andKyo:twovastlydifferent spirits the legendarykillerofathousandmen. and transformsintoDemonEyesKyo, the peacefulKyoshiro drawshissword Eyes Kyo.WhenKyoshiro iscornered, for thelegendarywantedmanDemon a travelingmedicineseller, MibuKyoshiro, Shiina, abeautifulbountyhunter, mistakes Sekigahara, Japan’s greatest civilwar. Yuya It is1604,fouryearsaftertheBattleof SAMURAI DEEPERKYO Released 9/30/10 Released 5/31/10 Released 5/4/10 Released 6/29/10 Released 7/6/10 SEE KNIGHTSOF THE ZODIAC Released 6/22/10 192 192 pgs•$8.24 pgs•$9.74 More volumesalsoavailable! More volumesalsoavailable! More volumesalsoavailable! him stops-thesurrounding people are everything changeswhenthe worldaround be anotherboringyearof school.But Yuji Sakai isbeginningwhathethinkswill SHAKUGAN NOSHANA 13+ •#9781427817839 Vol. 19 13+ •#9781427817099192pgs$8.24 Vol. 18 13+ •#MM1591827035188pgs$7.49 Vol. 1 share ofthehouseholdchores! domination? Hehastokeepupwithhis standing inhiswayfrom completeglobal plans fortakingoverEarth.Theonlything household, where hesecretly devisesnew Now hehastakencoverintheHinatafamily communications withtherest ofhisplatoon. world. To makematters worse,he’s lost like alienhasbeencutoff from hishome problem. Afterblowinghiscover, thisfrog- Keron’s invasionforce onEarth,hasalittle Sgt. Keroro, commanding offi cer ofPlanet SGT. FROG 16+ •#9781569700662N/Apgs$12.95 Released 8/31/10 MONDAY -SUNDAY SEVEN DAYS: 13+ •#9780345508232 Vols. 14-16Omnibus 13+ •#0345491475208pgs$8.21 Vol. 1 over-the-top comedy! Rumble portrayshighschoolasitreally is: anxieties, andraginghormones-School foul-ups, grandschemes,deep-seated feels. Life-changingobsessions,colossal crush, andnowhemusttellherhow a shockingrealization: he’s gotahuge delinquent andhe’s suddenlycometo He istheschool’s mostnotoriousjuvenile the boyshelikeseverreally noticeher? with asingleall-consumingquestion:will She isasecond-yearhighschoolstudent SCHOOL RUMBLE 16+ •#9780345518132 Vol. 7 16+ •#9780345518125176pgs$8.21 Vol. 6 16+ •#9780345516367176pgs$8.21 Vol. 5 16+ •#9780345510259176pgs$8.21 Vol. 4 16+ •#9780345508935192pgs$8.21 Vol. 1 perfect placetodie? Zetsubou-sensei, whojustwantstofi nd the their lives.ButisthatteacherItoshiki,a.k.a. teacher canhavealastingpositiveeffect on own way. It’s aspecialtime,whentheright of uniquestudents,eachcharminginher also thebelovedschoolteacherofaclass depressed. He’s certifi ably suicidal,buthe’s Nozomu Itoshikiisdepressed. Very ZETSUBOU-SENSEI SAYONARA, 13+ •#9781421533643192pgs$9.74 Vol. 1 Apartments. into theliving-room dioramasoftheSaturn Mitsu’s jobtreats himtoanoutsider’s view struggles withthetransitiontoworkinglife, take onhisfather’s occupation.Ashe after hisfatherdisappeared, Mitsumust has justgraduatedjuniorhigh.Fiveyears Mitsu, thelowlysonofawindowwasher, higher thefl oor, thegreater thestatus. of theRingSystemishighlystratifi ed: the structure thatringstheearth.Thesociety Far inthefuture, humansreside inagigantic Released 7/27/10 Released 4/27/10 Released 5/18/10 Released 6/29/10 Released 7/27/10 192 624 176 pgs•$8.24 pgs•$14.96 pgs•$8.21 More volumesalsoavailable! 13+ •#9781421521824192pgs $7.49 Vol. 29 13+ •#9781421521817192pgs $7.49 Vol. 28 13+ •#9781421521800200pgs$7.49 Vol. 27 13+ •#9781421521794200pgs$7.49 Vol. 26 13+ •#9781421521787192pgs$7.49 Vol. 25 13+ •#VIZ1569319022208pgs$5.96 Vol. 1 or whatisthe“ShamanKing”? challenges bothreal andghostly... butwho friends MantaandAmidamaru,hefaces all ofwhomonlyhecansee.Together with business, haunts,revenants, andspecters, Tokyo isfullofghosts,spirits withunfi nished few whocancontacttheotherworld-and Yoh Asakuraisashaman,oneofthegifted More volumesalsoavailable! 16+ •#9781421530390200pgs$7.49 Vol. 5 16+ •#VIZ1421511959200pgs$7.49 Vol. 1 Shana, calledFlameHaze. world: theCrimsonDenizensandgirl between thesecreatures from another saves him.Yuji isdrawnintothestruggle redheaded girlwithasword appearsand Before Yuji suffers thesamefate,ayoung doll-like creature begins suckingthemup! engulfed inbluefl ames, andafreakish Released 7/6/10 Released 5/4/10 800.338.6827 books.rightstuf.com know thatthisBeniisnotthe real princess... to protecting PrincessBeni.Littledoes he traveled intothefuture todevotehislife encounters aKagetora,ninja who’s time- arrogant father!Butoneday, shesuddenly death willresult inembarrassingher care ifshelivesordiesaslongher Energetic andstrong-willed, Benidoesn’t SHINOBI LIFE More volumesalsoavailable! 13+ •#9780345514295208pgs$8.99 Vol. 6 13+ •#9780345499257208pgs$8.21 Vol. 1 Akira -andtheentire universe! there are evilforces intentondestroying warrior, toprotect whoissworn him,for also meetsthebeautifulKoyomi,another magical powertocontrol theseasons.He destiny: he’s ashikitsukai,warriorwiththe 14,Akiradiscovershis On thedayheturns TSUKAI BUTTERFLIES, FLOWERS PICK SSTAFF P T I A C F K F

49 BOOKS BOOKS More volumesalsoavailable! 50 piece togethercluestoashockingpuzzle on theisland,marshalsare forced to an intensehurricanebearsrelentlessly down insane. Astheirinvestigationdeepensand like federalinstitutionforthecriminally escaped from Ashcliffe Hospital,afortress- Island tofi nd amassmurderer whohas his partner, ChuckAule,are senttoShutter In 1954,U.S.MarshalTeddy Danielsand SHUTTER ISLAND 13+ •#9780345520821 Vol. 9 13+ •#9780345514318208pgs$8.21 Vol. 8 13+ •#9780345497451208pgs$8.21 Vol. 1 her thepowertobesomeonenew. Guardian Character, abeingwhocangive three strangelittleeggs.Eachcontainsa Amufitake alittlemagic!Onemorning, nds take more thanwishesanddreams -it’ll be herself.ChangingAmu’s lifeisgoingto who wishesshehadthecouragetotruly nobody knowsthereal Amu,ashygirl stylish andsuper-cool Amuhasitall-but Everybody atSeiyoElementarythinksthat SHUGO CHARA! 13+ •#9781401226091 Vol. 1 relieved tohaveNaooutoftheirlives? effort togetherbackorwilltheyjustbe herstepparents makeevery kidnapping! Will with adaringscheme:she’llfakeherown parents, Naoteststheirlevelofcommitment aboutherstandingwithnew Concerned stepfather remarries ayoungerwoman. unexpectedly passesawayandher Nao’s bleakwhenhermother lifeturns SHISSO HOLIDAY 13+ •#9781427815392192pgs$8.24 Vol. 4 13+ •#9781427811622192pgs$8.24 Vol. 3 13+ •#9781427811127192pgs$8.24 Vol. 2 13+ •#9781427811110192pgs$7.49 Vol. 1 world? modern Can trueloveandhonorsurviveinacrazy Released 7/27/10 Released 7/27/10 books.rightstuf.com 800.338.6827 176 192 pgs•$8.21 pgs•$7.49 13+ •#9781421528632196pgs$7.49 Vol. 8 13+ •#9781421528625188pgs$7.49 Vol. 7 13+ •#9781421506791208pgs$5.99 Vol. 1 basketball, hislifeischangedforever... When sheintroduces himtothegameof Haruko, andshe’s actuallynotafraidofhim! when hemeetsthegirlofhisdreams, always comingoutontop.Allthatchanges for throwing downatamoment’s noticeand - noneatall!Itdoesn’t helpthathe’s known Hanamichi Sakuragi’s gotnogamewithgirls More volumesalsoavailable! 13+ •#9781421532707200pgs$7.49 Vol. 21 13+ •#9781421530727192pgs$7.49 Vol. 20 13+ •#VIZ1421505851184pgs$6.74 Vol. 1 beating Shoinshowbiz! - she’s goingtogethersweetrevenge by he’s famous!Kyokowon’t suffer insilence as anidol.Buthe’s castingheroutnowthat Tokyo tosupporthimwhilehemadeitbig Kyoko MogamifollowedhertrueloveShoto SKIP BEAT! More volumesalsoavailable! 13+ •#9781427809704192pgs$8.24 Vol. 6 13+ •#9781427809698192pgs$8.24 Vol. 5 13+ •#9781427809650192pgs$7.49 Vol. 1 on protecting atallcosts! may beaspecialprincewhoChigusainsists each other-includingthefactthatRakan Together, thesetwouncoversecrets about mysteriously onedayoutofnowhere. Chigusa ishissurpriseguest,whoarrives unusual attractiontofl owers andplants. Rakan isalonelyorphanedteenwithan SILVER DIAMOND 16+ •#9780061968570128pgs$16.49 Color hidden withinShutterIsland. Released 6/8/10 Released 8/3/10 ONE PIECE More volumesalsoavailable! Momoka Sendou(nicknamed “Dragon ST. DRAGON GIRL 13+ •#9780759529199 Vol. 12 13+ •#9780759529182192pgs$8.24 Vol. 11 13+ •#9780759529175192pgs$8.24 Vol. 10 13+ •#9780759529168192pgs$8.24 Vol. 9 13+ •#9780759523418192pgs$8.24 Vol. 1 prime suspectinamurder athisschool. the mysterywhenheismistakenfor tenth-grader becomesfurtherembroiled in his youngerbrother, Ayumu. Thecheeky sudden disappearancecontinuetohaunt Kiyotaka Narumi’s last words priortohis ‘Blade Children.’” World-class detective “I’m goingtouncoverthemysteryof BONDS OFREASONING SPIRAL: 17+ •#9780316102322 Vol. 2 17+ •#9780316073394192pgs$8.24 Vol. 1 oppressive, monotheisticChurch. Holo andthreatens herovertothe toturn when acompetingorganizationcaptures kingdom ofTrenni, buttheirplansgoawry the depreciating silvercurrency ofthe they discoverauniqueopportunitytoexploit and thetwobegintravelingtogether. Soon meets Holo,thewolf-godofharvest, years. Hislifechangesforever whenhe path oftheitinerantmerchant forseven Kraft Lawrence hasbeenwalkingthelonely SPICE ANDWOLF 16+ •#9780759530655192pgs$8.24 Vol. 3 16+ •#9780759530485192pgs$8.24 Vol. 2 16+ •#9780759530010192pgs$8.24 Vol. 1 of theunderworld. against thebizarre anddangerous minions to mastertheirweaponsastheyfaceoff witch, Makaandherfellowmeistersstrive the taintedsoulsof99humansand1 with thetaskofcollectinganddevouring ultimate weaponofDeathhimself!Charged Eater, intoapowerfuldeathscythe-the herpartner,turn alivingscythenamedSoul Maka isaweaponmeister, determinedto SOUL EATER 13+ •#9781427817976208pgs$9.74 Released 5/4/10 ultimate lovethrives. side storytoTsubasa: ThosewithWings, tobeaman...Andin boy triestolearn tries tofi nd hisownvoice...An18-year-old loved her... Thesonofamusicalgenius girl wondersifherdeceasedfatherever only womanwhotouchedhisheart...A Basket, apopbandvocalistmeetsthe In thesetalesfrom thecreator ofFruits FRUITS BASKET THE CREATOR OF SMILE: STORIESFROM MAKE YOUSONGS TO More volumesalsoavailable! 13+ •#9781421528663196pgs$7.49 Vol. 11 13+ •#9781421528656196pgs$7.49 Vol. 10 13+ •#9781421528649200pgs$7.49 Vol. 9 Released 7/31/10 Released 7/31/10 Released 4/30/10 Released 7/31/10 Released 4/30/10 Released 8/3/10 Released 6/1/10 SPECIAL A SEE S.A 192 192 pgs•$8.24 pgs•$9.74 In 1993,inasmallNepalese store, Makoto only afewhundred metres from thesummit. during theirascent,having beensighted Irvine, disappeared ontheNorth-Eastridge Mallory andhisclimbingpartner, Andrew On histhird expeditioninJune1924, SUMMIT OF THE GODS 16+ •#9781897376591128pgs$12.95 Vol. 1(Color) to fi ght withthebest! world warriorsproves they’vegottheskills drag-out actionasthenewestgenerationof and Akuma!Expectplentyofknock-down, Fighter mainstayslikeSakura,Dan,Charlie, Fu fi ghter Rufuscross pathswithStreet spygal CrimsonViper, andchunkyKung Abel, Mexicanwrestler ElFuerte,sexy New challengerslikemixedmartialartist STREET FIGHTERIV More volumesalsoavailable! 16+ •#9781421528717192pgs$7.49 Vol. 13 16+ •#9781421528700200pgs$7.49 Vol. 12 16+ •#9781421528694200pgs$7.49 Vol. 11 16+ •#VIZ1421513714192pgs$5.99 Vol. 1 identity isamystery! a movie,andwiththefemmefatalewhose image, whichhe’s sure wouldbeperfectin falls inloveinstantly-bothwiththemagical beautiful girlinstrawberry-printpanties,he When hecatchesatantalizingglimpseof Junpei’s goalinlifeisto becomeafi lmmaker. STRAWBERRY 100% 13+ •#9781401220525192pgs$7.49 Vol. 2 13+ •#9781401220518192pgs$7.49 Vol. 1 products toyoungercustomers. as partofgrandma’s bigplantomarkether going tohavestartmodelingkimonos make upforruiningtheoutfi t, Shinobu’s grandmother, whorunsakimonoshop.To kimono, ofallthings.ItbelongstoKoguma’s outthatthebagcontainsanancient turns bag, youcanbetshe’s pretty scared. It Shinobu accidentallyspillsmilkonhis most intimidatingguyatschool.Sowhen Everyone’s afraidofKoguma-thebiggest, STOLEN HEARTS 16+ •#9781421531830192pgs$7.49 Vol. 2 16+ •#9781421531823200pgs$7.49 Vol. 1 proper lady? off foolinghighsocietyintothinkingshe’s a she agrees tomarryhim.ButcanSumipull with themoneyshesodesperatelyneedsif with abizarre proposition -he’llprovide her dire, wealthySoichiro Ashidaentersherlife when Sumi’s fi nancial problems become barely afford theirownbasicneeds!Just for hertotakecare ofeventhoughtheycan brother Eisukekeepsbringinghomeorphans Poor SumiKitamura.Herirresponsible older STEPPING ONROSES More volumesalsoavailable! 13+ •#9781421520162200pgs$7.49 Vol. 7 13+ •#9781421520155208pgs$7.49 Vol. 6 13+ •#9781421520148200pgs$7.49 Vol. 5 13+ •#9781421520100200pgs$6.74 Vol. 1 fi ght demonstogether! instead. Nowthetwomustuniteforces to possess him,butthespiritentersMomoka callsonthespiritofadragonto Ryuga demons. Inorder toincrease hispower, a Chinesemagicmasterwhobanishes is Momoka isamartialartist,andRyuga Kouare childhoodfriends. Girl”) andRyuga Released 5/25/10 Released 7/6/10 Released 6/1/10 Released 7/6/10 One Piece©1997byEiichiro Oda/SHUEISHAInc. Yokaiden ©2008NinaMatsumoto. 17+ •#9780316077323208pgs $9.74 Vol. 6 17+ •#9780759528505208pgs $9.74 Vol. 1 makes him(understandably)freak out. a special“request” ofHideo,onewhich alone intheclubclassroom, Kurumimakes wants tojoinup.Whenthetwoare left a girlnamedKurumiSahanashowsupand existence pretty tiresome untilonedaywhen one HideoAiba.Infact,hefi nds hisentire practically enslaved,hasbecomeboringfor interested intheocculttowhichhe’s The “RomanClub,”aschoolgroup SUNDOME 16+ •#9780316073141 Vol. 5 16+ •#9780759531147208pgs$8.24 Vol. 4 16+ •#9780759530898208pgs$8.24 Vol. 3 16+ •#9780759530454192pgs$8.24 Vol. 2 16+ •#9780759530041192pgs$8.24 Vol. 1 enthusiastic tofulfi ll! an heir-adutywhichMomokoisonlytoo by weddingtheirchildren andproducing have cookedupaschemetobringpeace of Koushi’s family’s rivalfaction.Theirfathers Kuzuryu, thepint-sizedbutpowerfulheiress criminals inthenation.EnterMomoko prosecutingto beanattorney thebiggest Koushi, however, wantsnothingmore that the heirtoanancientfamilyofmartialartists. Koushi Inuzukamaynotbeaninja,butheis SUMOMOMO MOMOMO N/R •#9788492444328328pgs$24.99 Vol. 2 N/R •#9788496427877328pgs$24.99 Vol. 1 Mallory andIrvinemadeittothesummit? camera? Doesitholdthesecret ofwhether across anoldcamera.CoulditbeMallory’s expedition toconquerMtEverest, stumbles Fukamachi, photographerforaJapanese Released 8/31/10 Released 6/30/10 208 pgs•$8.24 More volumesalsoavailable! More volumesalsoavailable! 17+ •#0345486315208pgs$10.46 Vol. 1 the smartest,andmostintimidating! Yamato’s evermet-she’s alsothecoolest, and-fi eld star. She’s notjustthecutestgirl his neighborSuzuka,abeautifultrack- even more nerve-wracking whenhemeets it’s anall-girlshousingcomplex!Thingsget he can’t refuse. There’s justonetinycatch: him tostayinherboarding house,it’s anoffer better thanTokyo? Sowhenhisauntinvites Yamato isready forafresh start,andwhere SUZUKA 17+ •#9781427804686 Vol. 4 17+ •#MM1427803145 Vol. 1 and love-forthefi rst time. her advertisingjobandexperienceslife- old, ambitiousMinamithrows herselfinto everything elseinherlife.Now, at27years her, Minamirealizes she’s shutout After herboyfriendofsevenyearsdumps SUPPLI More volumesalsoavailable! 13+ •#9780316081122112pgs$8.24 Vol. 4 13+ •#9780759528994112pgs$8.24 Vol. 1 otaku andtheprincipalisjust...weird. Yuno’s homeroom teacherisacosplay quirks. Eccentricityclearlyrulesthisschool; fellow students,andeachhasherown neighbors -Sae,Hiro, andMiya-are all doesn’t endwiththeschoolbell!Her routine, shequicklydiscoversthatcreativity complex. Justafewdaysintohernew arts, Yuno movesintoanearbyapartment Accepted toaschoolspecializinginthe SUNSHINE SKETCH 17+ •#9780316102353 Vol. 7 Released 6/29/10 Released 8/31/10 YOKAIDEN 384 208 192 pgs•$14.99 pgs•$9.74 pgs•$7.49 More volumesalsoavailable! of Light,Water, andEarthcometogether, Mogara.” Itissaidthatwhen thespirits sword hidden andsealedin“Jagara- There is alegendthatspeaksofpowerful THE DEVIL SUSANOH SWORD OF TAKERU: OPERA 16+ •#9781569701355200pgs$9.95 Vol. 2 16+ •#9781569701348200pgs$9.95 Vol. 1 be toomuchforAkamushitohandle! seems theseminionsoftheunderworldmay demons, sheseeksAkamushi’s help.Butit is suddenlypursuedandattackedbyunholy netherworld. Whencareer womanMegumi spider, hecombatsthedemonsof thepowersofagiant Spider Exorcist. With Akamushi, theshamanknownasRed living andthetwilightworldofdeadis Traveling in-betweentheworldof SPIDER EXORCIST TAIMASHIN:RED THE More volumesalsoavailable! 13+ •#9781427802002192pgs$8.24 Vol. 8 13+ •#MM1598169602192pgs$7.49 Vol. 1 eating tengu! the helpofHaruka,legendarydemon- the problems ofghostsanddemons...with up, hemoonlightsasanexorcist solving spirits. ButnowthatKantarou’s allgrown he hasbeenabletoseeandtalkvarious the Taisho period.Eversincehewasachild, Meet Kantarou, afolklore scholarlivingin TACTICS 16+ •#9781401226879 Vol. 1 put thembackwhere theybelong! against hiswilltocapture thesebeingsand world. NowSatsukifi nds himselfrecruited and returnedbefore itwreaks havocinthe and themissingsymbolmustbecaptured She saysshe’s thetrueownerofbook is nowmissing,amysteriousgirlburstsin. notices oneofthesymbolsfrom thecards hears amysterious,disembodiedvoiceand illustrations from asetoftarot cards. Afterhe Satsuki discoversabookcontaining TABLEAU GATE More volumesalsoavailable! 16+ •#9781421532714192pgs$7.49 Vol. 13 16+ •#9781421529318184pgs$7.49 Vol. 12 16+ •#9781421529240184pgs$7.49 Vol. 11 16+ •#VIZ1421517647184pgs$7.49 Vol. 1 very longdaysattheoffi ce. jurisdiction war, andpoorKaiisinforsome dragon speed.Addstreet violenceanda the distributionofadangerous newdrug: Kai isassignedtotrackdownandstop with hisstoicpartnerHalKurabayashi, alter egoandadangerous past.Together Division’s newinvestigatorhidesaviolent but theGreater KantoNarcotics Control Kai Etomaylooklikeasqueaky-cleankid, More volumesalsoavailable! ALL •#9781401222307200pgs$7.49 Vol. 15 strives tobecomeagreat ballerina. Kyoko’s best-sellingclassicaboutagirlwho manga everpublished,SwanisAriyoshi One ofthemostfamousandlaudedshojo SWAN 17+ •#9780345508362 Vols. 13-15Omnibus Released 8/17/10 Released 8/31/10 200 592 pgs•$7.49 pgs•$16.44 800.338.6827 books.rightstuf.com he fi nds himselfface-to-face withahaughty world around him!Ashecontemplates this, and hearmusicalnotescoming from the Kyousuke Hibikifi nds himselfabletosee from aserious accident,musicteacher Discharged from thehospitalafterrecovering TENA ONS-STRING 13+ •#9781421529509200pgs$7.49 Vol. 2 13+ •#9781421529134200pgs$5.96 Vol. 1 Amberground connected. risk theirlivesinorder tokeeptheheartsof Letter Bees,abravecorpsofmessengers, extremely dangerous. Butthankfullythe travel betweenthecitiesofAmberground with metalexoskeletons.TheGaichuumake is infestedwithGaichuu-colossalinsects over theland.Thepitch-blackwilderness man-made starcastsonlyadimlight Amberground islockedindarkness. A LETTER BEE TEGAMI BACHI: More volumesalsoavailable! 13+ •#9781401215255200pgs$7.49 Vol. 7 13+ •#9781401215194192pgs$7.49 Vol. 1 secrets thatare tearing themapart? and Kanzakihelpeachothergetoverthe suffered theirownseparatetrauma.CanKei between twostudentswhohaveeach This strangeconnectionbeginsafriendship something shelostthere twotenantsago. a fellowclassmate.She’s searching for getting intotheapartmentofKanzaki, Freshman Keihasonethingonhermind: TEARS OF A LAMB ALL •#9781401216061192pgs$7.49 Vol. 3 ALL •#9781401216054200pgs$7.49 Vol. 2 ALL •#9781401216047192pgs$7.49 Vol. 1 young princeisnottheogre sheimagined? maids inReynol’s castle.Coulditbethatthe assumes therole of“Marie,”onethe the weddingplansinprocess). Soshe guy really isfi rst (andmaybeevensabotage Rosemarie isdeterminedtoknowwhothis mysterious princeoftheothercountry. But so hepromises herhandtoReynol,the with abiggerandwealthierneighbor, kingdom. Herbrother wantsanalliance Rosemarie istheprincessofahumble UNKNOWN COUNTRY TALE OF AN 13+ •#9781427815736192pgs$8.24 Vol. 4 13+ •#9781427815729192pgs$8.24 Vol. 3 13+ •#9781427815712192pgs$8.24 Vol. 2 13+ •#9781427815705192pgs$8.24 Vol. 1 who are destinedtofi nd it... the sword ofSusanoh, includingthesethree a darknessthatenvelopsanyoneseeking at thenationofJagara,where theyconfront sword, Izumo,Kumaso, andOgunaarrive sword ofSusanoh. Uponpursuingthe the sword willbe immortalized. Thisisthe the sealofthissword willbebroken, and Released 6/23/10 PICK SSTAFF P T I A C F K F

51 BOOKS BOOKS 52 in thewoodsoffers forthayounggirl teenage angstwhenamysteriouslight Takeru are strugglingthrough andRyo BEAUTIFUL WORLD THIS UGLY YET More volumesalsoavailable! 16+ •#9781401221157192pgs$7.49 Vol. 7 16+ •#9781401221140192pgs$7.49 Vol. 6 16+ •#9781401217389200pgs$7.49 Vol. 1 outtobenoneotherthanSaizou! turns exchange studentcomestotheschool,it Private ImperialAcademy. Butwhenamale Now 16,Shinobu’s enjoyinglifeattheTokyo he couldsomedaycomeandprotect her. told herfriendSaizoutogrow upstrong so school inthebigcity, six-year-old Shinobu Before sheleftherruralvillagetogo TERU TERU XSHONEN More volumesalsoavailable! 16+ •#9781401224325184pgs$7.49 Vol. 19 16+ •#1401205607176pgs$7.49 Vol. 1 Juken Club! the proud, thepowerful:membersof in thisuntamedoutpost.Theseare thefew, students servetostemthetideofviolence the baddestteamaround! Onlyahandfulof chaos intheclassrooms, allvyingtobe clubs wreak havocinthehallwaysand takes abackseattobrawlingaswarring In oneunusualTokyo highschool,education 16+ •#9780316081238 Vol. 4 16+ •#9780316081221 Vol. 3 16+ •#9780316081207 Vol. 2 13+ •#9780759530331192pgs$8.24 Vol. 1 the littleprincess’s tune?! Kyousuke havenochoicebuttodance him andorders himtobeherservant,will clothing. Andwhenshesuddenlypointsat young girldeckedoutinfrillyGothicLolita Released 5/25/10 Released 9/30/10 Released 6/30/10 Released 6/9/10 books.rightstuf.com 800.338.6827 176 176 176 pgs•$8.24 pgs•$8.24 pgs•$8.24 16+ •#9781569700969200pgs$12.95 Vol. 1 a strangegroup... Not onlyare theybeautiful,butthey’re also and seesthattheyare allsparklingbeauties! he meetshisco-workersforthefi rst time attendants. Hefi nds thisoutquicklywhen policy tohire onlythemosthandsomeof Asahi isunaware, though,oftheMinami’s at MinamiKitazawaStation.Thenaive dream ofworkingasatrainstationattendant Asahi Sarutahasworkedhard torealize his TRAIN*TRAIN 13+ •#9781421535098208pgs$7.49 Vol. 1 eight-legged alligatorthesizeofatank? hands. Buthashemethismatchwithan and mostdangerous animalswithhisbare hunter, tracksanddefeatsthetastiest the world’s bestrestaurants. Asagourmet down theferocious ingredients thatsupply of gourmetfood!AndonlyToriko canhunt Gourmet HunterToriko! Thisisthegreat era TORIKO More volumesalsoavailable! 16+ •#9781427815859192pgs$8.24 Vol. 5 16+ •#9781427815842192pgs$8.24 Vol. 4 16+ •#9781427811899192pgs$8.24 Vol. 1 be inforthefi ght ofhislife! he fi nds victory, death,orevenlove,hewill freedom ifhecanwinthegame.Whether in jailformurder. He’s givenachanceat the underworldrulesday, Akiraisplaced Toshima. Inapost-apocalypticJapanwhere players staketheirlivesintheruinedcityof The Igura:adeadlybattlegamewhere TOGAINU NOCHI 17+ •#9781427814272 Vol. 3 17+ •#9781427814265192pgs$9.74 Vol. 2 17+ •#9781427814258192pgs$8.24 Vol. 1 strangest adventure intheirlives. looking monster... andsobeginsthe are promptly attackedbyastrangealien- practically outofTakeru’s dreams. They Released 6/1/10 Released 8/3/10 192 pgs•$9.74 More volumesalsoavailable! criminal pastinexchangeforanhonest Kotobuki isanex-thieftryingtogiveupher THOSE WITHWINGS TSUBASA: 15+ •#9780345520715 Vol. 27 15+ •#9780345520708208pgs$8.21 Vol. 26 15+ •#9780345517166192pgs$8.21 Vol. 25 15+ •#9780345517159208pgs$8.21 Vol. 24 15+ •#9780345512307208pgs$8.21 Vol. 23 15+ •#0345470575208pgs$8.21 Vol. 1 expect canhappen,anddoes... is anotherreality, where whateveryouleast story iswhatyouthinkitis.Becausethis faces maybefamiliar, butnothingaboutthis that costhimhisfather. Theirnamesand friend andleaderofthearchaeological dig change theworld.Syaoranisherchildhood possessor ofamysteriouspowerthatcan Sakura istheprincessofClowand RESERVOIR CHRONICLE TSUBASA, More volumesalsoavailable! 16+ •#9781427817969192pgs$8.24 Vol. 12 16+ •#MM1598166743192pgs$7.49 Vol. 1 group ofvampire extremists. and thisgoalistheRosenkreuz Order, a species; however, standingbetweenthem peaceful co-existencebetweenthetwo the NewHumanEmpire. Manydesire a between twofactions:theVatican and and vampires continuesasastruggle by Armageddon.Thewarbetweenhumans world afterthedestructionbrought about It isthedistantfuture; apostapocalyptic TRINITY BLOOD 16+ •#9781569700983200pgs$12.95 Vol. 3 16+ •#9781569700976200pgs$12.95 Vol. 2 Released 7/27/10 Released 4/27/10 PEEPO CHOO 192 pgs•$8.21 TWIN SPICA called theDMPistrashing the earth.Kid bulge through! Agangofevilwrestlers threatens thegalaxy, theKid’s truemuscles wrestler KingMuscleandwhen evil But heisthesonoflegendary intergalactic Kid Muscleisn’t anybody’s ideaof a hero. ULTIMATE MUSCLE 13+ •#9780759531758 Vol. 1 lose weightbutit’s arecipe fordisaster! her returntocuteroots byhelpingher his fi ve hotmaleneighborsdecidetohelp Hitomi movesintoherbrother’s apartment, Until hersweettoothtookover. When sorts ofprizesatchildren’s beauty contests. case! Whenshewasyounger, shewonall no elegantswan.Butthatwasn’t alwaysthe out ishersize.Weighing inat220lbs,she’s looks... theonlythingthatmakesherstand she’s anaveragestudent, hasaverage Everything ispretty averageaboutHitomi: LOVE REVOLUTION UGLY DUCKLING’S More volumesalsoavailable! 13+ •#9781401226107192pgs$7.49 Vol. 6 13+ •#9781401222260192pgs$7.49 Vol. 5 13+ •#9781401215262192pgs$7.49 Vol. 1 her tattoos! her suitors,andaslovegrows, sodo her todecide.Eachonerepresents oneof tattoos onbothofShakuya’s handswillhelp marry themanshelovesmost.Magic step aside.SoShakuyawillwaitayear, then returned, butthenewguy’s notaboutto The fi rst vanishedyearsagoandhasnow into areal dragon.Shealsohastwofi ancés! Dragon Clan-andshecanactuallyturn Teenage Shakuyaisthenextheadof DRAGONFOR THE TWO FLOWERS 13+ •#9781934287866 Vol. 2 13+ •#9781934287842192pgs$8.21 Vol. 1 and galaxiesasifhetheywere home. beside her. Hespeaksoftheconstellations young manwearingalion’s maskisalways she canremember. Butsheisnotalone.A profoundly changedherlifeforaslong the veryconceptofspaceexplorationhas However, asadnesssurrounds Asumi,as of soonattendingspaceacademy. young girlstudiesdeligentlywithambitions In aTokyo inthenottoodistantfuture, a 16+ •#9781427814302400pgs$11.24 Vol. 3 16+ •#9781427814296400pgs$11.24 Vol. 2 16+ •#9781427814289380pgs$11.24 Vol. 1 skills todoso! - andwantstouseKotobukiRaimon’s Everyone istryingtoclaimitastheirown wants, neverstopcausingthemtrouble. that grantsitsbeholderanywishsheorhe seeking theTsubasa, alegendaryobject of fi nding a“normal”job.Butpeople toward theexcitingbutsimpleadventures herillegalways Raimon, shehasturned life. Joinedbyformermilitarycommander Released 7/31/10 Released 4/27/10 Released 7/4/10 Released 5/4/10 Peepo Choo©FelipeSmith/Morning. 192 200 pgs•$8.24 pgs•$8.21 PICK SSTAFF P T I A C F K F More volumesalsoavailable! Vice fromVice wreaking more havoc. The otherisUltimo,intentontryingtostop seems tobeasevilhisnameimplies. the haplesscity. Onefi gure who isVice, them, destructionanddevastationfallson strange? Asthebattleensuesbetween monolithic robots, orsomethingmuchmore two fl oating fi gures. Are theyhumanboys, stunned bythesuddenappearanceof High aboveFarmlessCity, citizensare ULTIMO More volumesalsoavailable! 16+ •#9781421528793232pgs$7.49 Vol. 26 16+ •#9781421528786232pgs$7.49 Vol. 25 16+ •#9781421524443232pgs$7.49 Vol. 24 wrestling gangtodestroy theDMP. Muscle hasonlyonechoice:organizea Zero to guard theAcademy’s secret. Yuki of Cross Academyandnowworksalongside ago. Shewasadoptedbythe headmaster being savedfrom avampire attack10years Yuki Cross hasnomemoryofherpastprior to More volumesalsoavailable! 16+ •#9781569707906240pgs$13.95 Vol. 5 16+ •#9781569707890240pgs$13.95 Vol. 4 16+ •#9781569708279200pgs$12.95 Vol. 1 danger: avampire hunter. have tobattlethisdangerisadifferent kind them oftheirundyingnightmare. Allthey fear, hopingandprayingforasaviortorid weak withnoremorse. cowerin Villagers of vampires, havespawned.Theyrulethe the darknessoffallout,Nobility, arace the ashesofwaranddestruction.From left ofhumanityhasfi nally crawledoutfrom The yearis12,090A.D.,andwhatlittle VAMPIRE HUNTERD More volumesalsoavailable! 17+ •#9781421522821624pgs$14.99 Vol. 8 17+ •#9781421522814640pgs$14.99 Vol. 7 17+ •#9781421522807584pgs$14.99 Vol. 6 17+ •#9781421522470624pgs$14.99 Vol. 5 17+ •#9781421520544728pgs$14.99 Vol. 1 his way!Omnibus“Big”edition. prepared toslayanyonewhomightgetin enlightenment bythewayofsword, seekingspiritual sets outonajourney disarray. Amidsttheturmoil,ayoungman has justtakenpowerandthelandisin Tokugawa EraJapan:anewgovernment BIG EDITION 13+ •#9781427809278 Vol. 9 13+ •#9781427807090192pgs$8.24 Vol. 8 13+ •#9781427803368192pgs$8.24 Vol. 7 13+ •#MM1427803307192pgs$7.49 Vol. 1 fashionable Velvet BlueRose. And thusbeginsAgeha’s adventures atthe hurts hishandshejumpsrightintohelp! so whenoneofhersister’s dressmakers making handbagsandotheraccessories, her sister’s weddingdress. Agehaloves Ageha getsthejobofalifetime:making V.B. ROSE 16+ •#9781421531328216pgs$7.49 Vol. 1 Released 6/23/10 Released 7/20/10 Released 4/20/10 Released 8/3/10 Released 5/4/10 Released 7/6/10 192 pgs•$8.24 8+ •#9780763647384208pgs$7.49 Vol. 2:CalloftheWingedPanther 8+ •#9780763645540208pgs$7.49 Vol. 1:QuestfortheSilverTiger four heroes. ancient prophecy foretelling thearrivalof fi nd alandwhosevillagers’ onlyhopeisan guided bythemagicalsquelpSatorin,they Realm. Asherfriendsrushtosaveher, and imprisonedinaworldcalledtheTurtle everything changeswhenMeliskidnapped skateboarders atUnionMiddleSchool.But from any of theother12-year-old garage band-don’t seemthatdifferent and Doug-friendsobsessedwiththeir On adistantBlueStar, Mel,Jim,Naomi, VERMONIA More volumesalsoavailable! 16+ •#9781934876718192pgs$10.99 Vol. 8 16+ •#9781934876633192pgs$10.99 Vol. 7 16+ •#9781933164489192pgs$9.99 Vol. 1 anyone else. beforehunt downViruses theycanhurt the mysteriouseyepatch-wearingLuciato weak, Sumire decidestojoinforces with preyon thesidelineswhileViruses onthe hire, LuciaNahashia.Notcontenttostay with agothic-lolita-cladmonsterkillerfor Her lifehitsacrossroads afterarun-in malevolent ghostsknownas“Viruses.” school girlcursedwiththeabilitytosee Sumire Takahana isaseeminglynormal VENUS VERSUSVIRUS More volumesalsoavailable! 13+ •#9781401226138208pgs$7.49 Vol. 9 13+ •#9781401221003192pgs$7.49 Vol. 8 13+ •#9781401213459212pgs$7.49 Vol. 1 some unexpectedcompetition. about todiscoverthatlovecancomewith information regarding Eichi...Suzuna’s But anotherfriendhassomeinteresting player andfriendofherneighbor, Eichi. a crushonFukumi,charismatictennis hopefully gettingaboyfriend!Shedevelops to makingfriends,joiningaclub,and own forthefi rst time.She’s lookingforward Suzuna, acollegefreshman, islivingonher VENUS INLOVE 10+ •#9781401226121 Vol. 5 10+ •#9781401226114192pgs$7.49 Vol. 4 10+ •#9781401220631208pgs$7.49 Vol. 3 10+ •#9781401220624200pgs$7.49 Vol. 2 10+ •#9781401220617200pgs$7.49 Vol. 1 something more thanfriendship? their longtimeconnectionfi into nally turn would-be boyfrienddumpsher. Nowwill Takami toAkirawhenyetanother turns he’s aguy. Bestfriendssincechildhood, more effeminate thanTakami, eventhough a quiet,musicalprodigy whoseemsmuch Takami istall,attractiveandfunny. Akira’s VENUS CAPRICCIO More volumesalsoavailable! 16+ •#9781421535692208pgs$7.49 Vol. 10 16+ •#9781421531724200pgs$7.49 Vol. 9 16+ •#9781421530734208pgs$7.49 Vol. 8 16+ •#VIZ1421508222200pgs$6.74 Vol. 1 different ideas... coexist peacefully, butherpartnerhas believes thatvampires andhumanscan Released 6/30/10 Released 8/24/10 Released 5/11/10 Released 6/1/10 200 pgs•$7.49 16+ •#9781421532219208pgs $9.74 Vol. 1 precious, wastedandcelebrated. ridiculous andsublime, terrible and lifecanbethe waysinwhichmodern intersecting vignettes,InioAsanoexplores in thefaceofreality. thisseriesof With track. Theabsurdity ofdeath.Laughter A dream recaptured. Alifeon a new WONDERFUL WORLD WHAT A 16+ •#9780316081139128pgs$8.24 Vol. 2 16+ •#9780759530355128pgs$8.24 Vol. 1 Kentarou tothebrinkofinsanity! girls whoaren’t Karen andinsistonpushing luckless Kentarou isstuckinadormfullof out she’s onaleaveof absence! Nowpoor, her, hishopes are crushedwhenitturns in Karen’s highschooljusttobecloser his dreams. Whenhespontaneouslyenrolls to gethimcloserKaren Toguin, thegirlof Sawai can’t evencountonbeginner’s luck In thethroes ofhisfi rst love,Kentarou WAKABA-SOH WELCOME TO More volumesalsoavailable! 13+ •#9781421520285192pgs$7.49 Vol. 11 13+ •#9781421520278192pgs$7.49 Vol. 10 13+ •#9781421520261200pgs$7.49 Vol. 9 13+ •#9781421520254200pgs$7.49 Vol. 8 13+ •#9781421520247200pgs$7.49 Vol. 7 13+ •#9781421520186200pgs$6.74 Vol. 1 before. grieving forhisgirlfriend,whodiedtheyear For Nanami,it’s fi rst love,butYano isstill the mostpopular, carefree boyinclass. Nanami Takahashi fallsforMotoharuYano, WE WERETHERE 13+ •#9781421527413208pgs$7.49 Vol. 4 13+ •#9781421527406200pgs$7.49 Vol. 3 13+ •#9781421527390200pgs$7.49 Vol. 2 13+ •#9781421527383192pgs$5.99 Vol. 1 hope atsurvivalinaworldoverrunbymetal. Now acyborg,Shioisthehumanrace’s last machines thatcanmeldtothehumanbody. to mergewiththeGoujin-zou,araceof boy namedShiosacrifi ces hishumanity to defeatthemisjointhem.Ayoung The machineshaveattacked!onlyway WAQWAQ 16+ •#9781427818058 Vol. 3 16+ •#BLU1427804354 Vol. 2 16+ •#BLU1427804346 Vol. 1 them apart? and Shin-chanclosertogether, orwillittear But willthatknowledgebringNarusawa beloved dogFrappy, aswell. tolearn yearns animals andShin-chan,forthesakeofhis College professor Narusawacanspeakto VOICE ORNOISE 8+ •#9780763647858208pgs$7.49 Vol. 3 Released 5/4/10 Released 8/3/10 Released 8/24/10 Released 7/6/10 Released 5/4/10 - PaulD. “Your ismagnificent.” department customerservice 192 192 192 pgs•$11.24 pgs•$9.74 pgs•$7.49 800.338.6827 books.rightstuf.com More volumesalsoavailable! 13+ •#9780316077347 Vol. 7 13+ •#9780316077330528pgs $11.24 Vol. 6 13+ •#9780759523562528pgs$11.24 Vol. 1 autism andthetrialsofraisinghim. the overwhelmingdiscoveryofherchild’s tale, ayoungmothertriestocopewithboth heartwarmingandbittersweet alternately is slightlydifferent from otherchildren. Inthis “light.” Buthismothernoticesthatherson named theirsonHikaru,whichmeans duringthesunrise,Azumas’ Born LIGHT WITH THE 17+ •#9781604961904400pgs$14.99 Omnibus Collection becomes itsbearer! andunwittingly discovers theWitchblade when demonsattacktheconvent,Takeru not understandingwhattheymean.But has nightmares abouttheWitchblade, -apowerful artifact.Takeruthe Witchblade holds adarksecret: alockedboxcontaining and isbeingraisedbynuns.Buttheconvent Takeru isayounggirlwho livesinaconvent TAKERU WITCHBLADE More volumesalsoavailable! 13+ •#9781421533537200pgs$7.49 Vol. 10 13+ •#9781421532394200pgs$7.49 Vol. 9 13+ •#VIZ1421515881200pgs$6.74 Vol. 1 new protector. is partofhergrandfather’s gangandher one ofthemostpopularguysinschool, life, butshecan’t runfarsinceRakuto, Sachie triestocontinuelivinghernormal Grandpa istheheadofayakuzagang! take care ofher. Theonlyproblem isthat her estrangedgrandfatherhasshownupto Sachie Wakamura justlosthermother, and WILD ONES More volumesalsoavailable! ALL •#9781421524474208pgs$7.49 Vol. 24 ALL •#VIZ1591166853208pgs$5.96 Vol. 1 come true. work twiceashard tomakehisdreams disgrace. Now, thespunkyteenagermust revealed, Shodrops outofschoolintotal a hotshotsoccerplayer. Whenthetruthis he ismistakenlyintroduced toeveryoneas doesn’t helpthiswannabe.Oncampus, schools! Butevenachangeinscenery there’s onlyonethinglefttodo:switch being tooshort,ShoKazamatsuridecides Banned from hisschool’s soccerteamfor WHISTLE 16+ •#9781569700525200pgs$12.95 Released 5/26/10 there’s somethingmore tothesketch. random drawing...buthecan’t stopthinking silly fl uke andthedrawingwasnothingbuta known hisbrother andthatthiswasjusta himself thatKumoicouldn’t havepossibly Kumoi’s notebookpages.Takagi tells who resembles hisdeadbrother between Takagi isstunnedtofi nd asketchofman with tallandintellectualKumoi.Oneday, Takagi, aratherinnocentguy, isbestfriends HEAVENS SMILE WHEN THE 16+ •#9781421532226208pgs$9.74 Vol. 2 Released 9/30/10 Released 6/1/10 528 pgs•$11.24

53 BOOKS BOOKS YAKITATE!! JAPAN 54 16+ •#9781421529035200pgs $7.49 Vol. 21 16+ •#9781421522371192pgs $7.49 Vol. 20 16+ •#VIZ1421507196200pgs$7.49 Vol. 1 nation-changing, freshly bakedgoal. let anythingprevent himfrom achievinghis the competitionisfi erce, butKazumawon’t of therisingsun!Thestakesare highand create Ja-pan, thenationalbread oftheland baking powers,hastakenituponhimselfto a 16-year-old boyblessedwithotherworldly answer wasno...untilnow!KazumaAzuma, that Japancanclaimasitsown?The Is there not adoughy, gastronomic delight More volumesalsoavailable! 17+ •#9780345504234224pgs$10.46 Vol. 7 17+ •#9780345501189208pgs$10.46 Vol. 1 toseekrevenge...sworn slaughtered. Nowthesurvivingnunshave and mostofthenunslocalconvent leaving twenty-onebravewarriorsdead Aizu territoryhasbeenbrutallycrushed, 17th centuryJapan.Arebellion inthe CLAN REVENGE OF THE HORI YAGYU NINJASCROLLS: More volumesalsoavailable! 13+ •#9780345521125208pgs$8.21 Vol. 15 13+ •#9780345518439208pgs$8.21 Vol. 14 13+ •#0345470583208pgs$8.21 Vol. 1 in need. her shopwhere wishesare grantedtothose his debt,Watanuki mustworkforYuuko in torment him...foraprice.Now, topayoff who offers tohelpvanquishthespiritsthat he isdrawntothemysteriouswitchYuuko, Watanuki Kimihiro ishauntedbyvisionsuntil XXXHOLIC ALL •#9781401224493162pgs$7.49 Vol. 1 student body! multidimensional worldwithaveryspecial other aspiringProjectionists. Stepintothis that, ofcourse,isatahighschoolfi lled with projecting abilities.Thebestplacetodo image andbeabletohoneperfectyour have thepowertocastafour-dimensional you wanttobecomeone,fi rst youneedto money andfame,butonlyifyou’re good.If Being a“Projectionist” canbringlotsof WORLD ICREATE 13+ •#9781569700808200pgs$12.95 Released 7/21/10 missing brother? Could Koyukibeholdingakeytofi nding his missing fordaysandhehastofi nd him. be specifi c. Kyonosuke’s brother hasbeen member ofInugami,theWolf Godtribe,to out thathe’s nothuman,he’s awolf- boy, andwhatishetalkingabout?Itturns “Have youseenmybrother?” Whoisthis suddenly asksherthestrangestquestion: Kyonosuke sniffs Koyukilikeadogand WOLF GOD books.rightstuf.com 800.338.6827 PICK SSTAFF P T I A C F K F More volumesalsoavailable! More volumesalsoavailable! 13+ •#9781421524504192pgs $7.49 Vol. 19 13+ •#VIZ1569319049208pgs $5.96 Vol. 1 Tokyo’s toughestteenageghost! of acartosavelittlekid’s life,hebecomes stupor. Butwhenhethrows himselfinfront in timetowakehismomfrom herdrunken with hisrivalKuwabara,andheadforhome at noon,getkickedoutbytheteacher, fi ght It wasatypicaldayforYusuke: go toschool HAKUSHO YU 13+ •#9781427818652 Vol. 6 13+ •#9781427815385192pgs$8.24 Vol. 5 13+ •#MM1427805229192pgs$7.49 Vol. 1 personalities! Cantheykeepasecret? and NanakoAkiraenduptrading grandfather comesupwithacrazyinvention dull nobodynoticeshim.Oneday, Nanako’s looks andbrains,buthispersonalityisso tomboy! Meanwhile,AkiraUeharahasthe dreams are shattered becausesheisatotal she showshertrueself,however, guys’ just aslongshestaysquiet.Once Nanako Momoiisthebelleofherschool... YOUR &MYSECRET More volumesalsoavailable! ALL •#9780316073271208pgs$8.24 Vol. 8 ALL •#9780316073257208pgs$8.24 Vol. 7 ALL •#9780316073875240pgs$8.24 Vol. 1 everyday intotheextraordinary! the curiosity andenthusiasmquicklyturn unremarkable encounters,Yotsuba’s big personality!Eveninthemosttrivial, Yotsuba isastrangelittlegirlwith YOTSUBA&! 13+ •#9780345512413208pgs$8.21 Vol. 4 13+ •#9780345512406208pgs$8.21 Vol. 3 13+ •#9780345512390224pgs$8.21 Vol. 2 13+ •#9780345512383208pgs$8.21 Vol. 1 yokai butalsotocure theirstrangeillnesses! has theabilitynotonlytocommunicatewith something extra.He’s a“yokaidoctor,” and to havethesametalent...andalittle meets Kuro, ashylonerwhojusthappens be more popularatschool.Butthenshe from Japanesefolklore -asagreat wayto relationship spirits withyokai-supernatural professional exorcists, andseesherspecial Kotoko isdescendedfrom afamilyof YOKAI DOCTOR 16+ •#9781569701461200pgs$13.95 Vol. 2 16+ •#9781569701454200pgs$13.95 Vol. 1 formidable foes’darkplansforthecity. Setsura andMephistotouncovertheirnew to seizecontrol ofShinjuku.Itisupto China, fourimmortaldemonshavecome that overrunTokyo. From darkestpartsof surgery. Together, theybattletheevilforces Mephisto, awizard ofphysicalandspiritual allies himselfwithfriendandrivalDoctor the best“manhunter”inbusiness.He Setsura Aki,undercover P.I., isconsidered DEMON PRINCESS YASHAKIDEN: THE More volumesalsoavailable! 16+ •#9781421529059192pgs$7.49 Vol. 23 16+ •#9781421529042192pgs$7.49 Vol. 22 Released 8/3/10 Released 4/30/10 Released 6/22/10 Released 5/26/10 Released 7/13/10 192 pgs•$8.24 More volumesalsoavailable! ALL •#9781421523347192pgs $5.99 Vol. 8:TheMinishCap ALL •#9781421523279200pgs$5.99 Vol. 1:OcarinaofTime Part 1 courage todefeatevil. perilous, andLinkwillneedallhisskill willbelongand of Hyrule.Thejourney the forest, to Zelda,Princessoftheland deliver theEmerald,spiritualstoneof A boynamedLinksetsoutonaquestto whoever holdsthemwillcontrol theworld. stones holdthekeytoTriforce, and In themysticallandofHyrule,three spiritual ZELDA, LEGENDOF 16+ •#9781421527543200pgs$7.49 Vol. 5 16+ •#9781421527536208pgs$7.49 Vol. 4 16+ •#9781421527529208pgs$7.49 Vol. 3 16+ •#9781421527512192pgs$6.74 Vol. 2 16+ •#9781421527505192pgs$6.74 Vol. 1 forever. her truelovebythatdate,shewillbehis claim herashisown.Unlessshecanfi nd vowed toreturn onher20thbirthdayand caught theattentionofapowerfulspiritwho 20th birthday. Just three yearsago,Rasetsu hopes itwillkeephermindoff herfateful banish spirits,sheworksasanexorcist and theabilityto your typical18yearold.With Spin-off ofYurara. RasetsuHyugaisn’t RASETSU YURARA More volumesalsoavailable! ALL •#9781421531731216pgs$7.49 Vol. 4 ALL •#VIZ1421513781224pgs$5.98 Vol. 1 Blue dormhangontotheirwinninghand? deck? OrwillthechampionsinObelisk low-level dorm,SliferRed,tothetopof his markintheDuelWorld. Canhebringhis battles teachersandstudentsaliketomake Considered aslackerbyhispeers,Jaden GX 13+ •#9781421530109296pgs$7.49 Vol. 5 13+ •#9781421530093200pgs$7.49 Vol. 4 13+ •#9781421530086216pgs$7.49 Vol. 3 13+ •#9781421530079200pgs$7.49 Vol. 2 13+ •#9781421530062216pgs$7.49 Vol. 1 than mere revenge... Yako’s trueplanforAnzuismuchworse the world’s mostdangerous gamers!But Kaibacorp building,guarded bydozensof Mazaki andtakeshertotheheartof To drawYugi out,Yako kidnapsAnzu forgiven Yugi forhismaster’s horriblefate. Yako Tenma, Pegasus’protege, hasnever R YUGIOH! More volumesalsoavailable! 17+ •#9781427818669384pgs$14.99 Vol. 8 17+ •#MM159816290X216pgs$7.49 Vol. 1 love withhim,thingsgetabitoutofcontrol! friend Hidariconfessthatsheisactuallyin Yoshinori, dressed asYuki, hearschildhood to beawoman-andman.Butwhen agreatlearning dealaboutwhatitmeans cross-dressing, andthatbydoingso,heis Now he’s discovered thathehasalikingfor older sisterasamodelforbridalgown. wound uphavingtofi ll inforhisbeautiful Through aseriesofcoincidences,Yoshinori YUBISAKI MILK TEA Released 6/1/10 Released 6/1/10 in common...untilachance encounter ina seem asthoughJayandJ. havenothing than heletson.Onthesurface, itwould foreigner, withmore inhisbackground making art.J.Maxisatall,debonair determined toprove she’s serious about Jay Jinnisaheadstrong teenager 100% PERFECTGIRL 13+ •#9780759529977192pgs$8.24 Vol. 4 13+ •#9780759529960192pgs$8.24 Vol. 3 13+ •#9780759529953192pgs$8.24 Vol. 2 13+ •#9780759529946192pgs$8.24 Vol. 1 for love? the luckynumberinthisschoolgirl’s quest end ofthelineforHee-So?Orwill13be after allthat,shestillgotdumped!Isthisthe confessed herfeelingsonliveTV!Buteven fi nally theboyshe’dbeenwaitingfor, soshe to fi nd “theone.”ShethoughtWon-Jun was Hee-So’s gonethrough 12boyfriendstrying 13TH BOY 16+ •#9781427816405 Vol. 4 16+ •#9781427816061192pgs$8.24 Vol. 3 16+ •#9781427816054192pgs$8.24 Vol. 2 16+ •#9781427816047192pgs$8.24 Vol. 1 uncover itssecret. exorcist, maybetheonlyoneswhocan two youngstudents,ademonandan 00” seemstobebehindthechanges,and ways. Amysteriousdrugknownas“Zone- to losecontrol andgobacktotheirviolent happening andsomedemonsare starting of fi ghting. However, somethingoddis demons liveinafragilepeaceafteryears Tokyo isnowadarkcitywhere humansand ZONE-00 More volumesalsoavailable! 16+ •#9780759530980176pgs$8.24 Vol. 9 16+ •#9780759530973176pgs$8.24 Vol. 8 16+ •#9780759530959192pgs$8.24 Vol. 7 16+ •#9780759523531208pgs$8.24 Vol. 1 debt... of dealandgarneredthemselvesaheavy the boyshavealready madeadifferent kind lives, sheapproaches them,butitseems can dosomethingtosaveherclassmates’ impending death.Thinkingthatperhapsshe of see theserings,knowsthattheywarn ago. Michiru,possessingtherare abilityto survived ahorribleaccidentsixmonths classmates -twoboyswhomiraculously markings around thenecksoftwoher One day, MichiruKitanoticesmysterious ZOMBIE-LOAN OTHER ASIAN Released 6/30/10 Released 6/29/10 Released 6/30/10 MANGA 192 pgs •$8.24 PICK SSTAFF P T I A C F K F 800.338.6827 books.rightstuf.com

55 BOOKS BOOKS More volumesalsoavailable! 56 More volumesalsoavailable! 13+ •#9780759531659176pgs $8.24 Vol. 10 13+ •#9780759531642176pgs $8.24 Vol. 9 13+ •#8952744551180pgs$8.21 Vol. 1 bittersweet experiences. owners, providing extremely vividand these itemsbegintoinfl uence theirnew their purchasers themselves.Inexplicably, sells unusualantiquesthatseemtopick and handsomeassistant,Bun-nyu’s store rationally explained.Assistedbyasecretive no mysteryleftinthisworldthatcannotbe nyu, awomanwhobelievesthatthere is The AntiqueGiftShopisownedbyBun- GIFTSHOP ANTIQUE 13+ •#9780316096331 Vol. 12 13+ •#9780316086097176pgs$8.21 Vol. 11 13+ •#9780316077682176pgs$8.21 Vol. 10 13+ •#8952744675180pgs$8.21 Vol. 1 to makesure thataweddinghappens. searching highandlowontheearthtrying of theGodsfrom HeavenandHellare world disguisedasaschoolboy!Nowall to runaway. Herplanistojointhehuman King, sherealizes thatheronlychoiceis Unable toacceptherfuture withtheDemon betrothed totheEmperor oftheUnderworld. The onlyAngelPrincessofHeavenis ANGEL DIARY More volumesalsoavailable! 16+ •#9781600092251200pgs$7.49 Vol. 10 16+ •#1600092160200pgs$7.49 Vol. 1 hotel lobbysparksamysteriousattraction. Released 7/31/10 books.rightstuf.com 800.338.6827 176 pgs•$8.21 More volumesalsoavailable! people intheirquietcountry village.Butas Ehwa andhermotherfrom therest ofthe single lifestyle.Theirsocial status isolates strangers -lookdownonher motherforher their customers-bothneighbors and watchingas mother runthelocaltavern, Ehwa grows uphelpingherwidowed COLOR OFEARTH More volumesalsoavailable! 12+ •#9781595824455184pgs$7.46 Vol. 5 12+ •#9781593078492184pgs$7.46 Vol. 1 exciting newlifeawaitsher! a guestinhismagicalkingdom,where an Soah isrescued byhimandwelcomedas a longdrought. Butinsteadofbeingkilled, sacrifi ce hertothewatergodHabaekend Soah’s impoverished village decidesto WATER GOD BRIDE OF THE 16+ •#9780316102278 Vol. 10 16+ •#9780316097659 Vol. 9 16+ •#9780759530942208pgs$8.24 Vol. 8 16+ •#9780759530935192pgs$8.24 Vol. 7 16+ •#9780759523494224pgs$8.24 Vol. 1 life hasbecomemuchmore complicated. raiding hisrefrigerator reveals onlythathis apartment! Buthow?Askingthestrangegirl Awakening later, hefi nds himselfbackinhis attacked, Keitagetscaughtinthecrossfi re. the coexistenceequilibrium.Whenshe’s him, isaMototsumitama,guardian of to amanicgirlwho,unbeknownst moocher KeitaIbukisurrenders hismeal One eveningataramenstand,master Released 5/31/10 Released 8/31/10 BIZENGHAST 208 208 pgs•$8.99 pgs•$8.99 13+ •#9780759531512192pgs $8.24 Vol. 7 13+ •#895274487X200pgs$8.21 Vol. 1 total bastard! to marrytheprince-whoapparently isa family, andhighschoolgirlChe-Kyung has to aworldwhere Korea stillhastheroyal were actually fi lled withpeople?Welcome palaces, whichare nowonlyhistoricalrelics, monarchism? Whatifallthebeautiful but whatifthecountryhadcontinued Monarchy endedlongagoinKorea, GOONG More volumesalsoavailable! 13+ •#9781597961783176pgs$7.46 Vol. 6 13+ •#9781597961738176pgs$7.46 Vol. 1 in lovewithCai-Sheng’s maleform! complicated whenthereincarnatedgirlfalls to matchmakethepair. Butthingsget to repay herdebttothembytrying the reincarnatedboyandgirldecides Two hundred yearslater, Cai-Shengmeets when theysaveherfrom adogattack. One day, shebefriendsalittleboyandgirl being raisedbyabevyofwildfoxdemons. Cai-Sheng isayoungcelestialfoxdemon DIVINE MELODY More volumesalsoavailable! 13+ •#9780759531420192pgs$8.24 Vol. 9 13+ •#8952744578180pgs$8.21 Vol. 1 getting themback. and there isnothingmore satisfyingthan endures torture andhardship from thegirls, her outofjealousy. Everysingleday, she in herschoollovesher, andeverygirlhates center ofeveryone’s attention.Everyboy Hwang Hyeminhas.Naturally, she’s the and asincere personality:that’s what The mostbeautifulface,theperfectbody, CYNICAL ORANGE More volumesalsoavailable! 13+ •#9780759529632192pgs$8.24 Vol. 6 13+ •#9780759529052200pgs$8.24 Vol. 1 Zone. Ho, hehashisfi rst experienceintheDeath day asanassistantformanhwaartistGo- realize hispoweryet.Ashestartsfi rst them. Theonlyproblem isthathedoesn’t They are calledCroquis, andDa-Ilisoneof make thestoriesofdeadintoartwork. with theabilitytostepintothatzoneand can see.Butthere are afewspecialpeople The “DeathZone”isaplaceonlythedead CROQUIS POP More volumesalsoavailable! 13+ •#9780759530140192pgs$8.24 Vol. 8 13+ •#8952746074200pgs$8.21 Vol. 1 for her. of hermanhwaidols-whohasasurprise she alsogetsthechancetoworkwithone only doesshehaveherstorypublished,but winner inthehistoryofcontest!Not creator talentsearch. She’s theyoungest placed third inCakeMagazine’s High schoolstudentHae-Won Songhasjust COMIC N/R •#9781596434608320pgs$16.99 Vol. 3:TheColorofHeaven N/R •#9781596434592320pgs$16.95 Vol. 2:TheColorofWater N/R •#9781596434585320pgs$16.95 Vol. 1:TheColorofEarth to thepossibilityofloveinherlife. love again,Ehwaslowlybeginstoopenup she getsolderandseeshermotherfallin More volumesalsoavailable! More volumesalsoavailable! More volumesalsoavailable! a littlemousewithbigsweet tooth,mixin Take onefussydog,arain-lovingcat,and ONE FINEDAY 13+ •#9780316102230 Vol. 8 13+ •#9780316077781192pgs$8.24 Vol. 7 13+ •#895274604X200pgs$8.21 Vol. 1 shared pastatall! doesn’t remember athingaboutherortheir reunited with Yu-Da. Theproblem is,he years passandMyung-Eeisunexpectedly hunted bythe“foxtribe”ofmoon!Five the twoofthemare “earthrabbits”being Da Lee,shediscoversastartlingsecret: After pickingafi ght withherclassmateYu- your average,albeitboy-crazy, 5thgrader. redturns whenthemoonrises,Myung-Eeis Apart from thefactthatcolorofhereyes MOON BOY 13+ •#9780759531406 Vol. 9 13+ •#9780759531390176pgs$8.24 Vol. 8 13+ •#9780759531383176pgs$8.24 Vol. 7 13+ •#9780759531376192pgs$8.24 Vol. 6 13+ •#8952746120200pgs$8.21 Vol. 1 with 8thgraderEun-GyoSung?! Sword.” But...whatdoesallthishavetodo the Bulkirinwithlegendary“SevenBlade day whenahero appeared anddefeated helpless astowhatdo.Thatis,untilone half ofallhumanbeings,leavingtherest the monstrous Bulkirin.Themonsterkilled Once uponatime,selfi sh kingsummoned LEGEND 16+ •#9780759530546 Vol. 3 16+ •#9780759530522192pgs$8.24 Vol. 2 16+ •#9780759530539192pgs$8.24 Vol. 1 mischievous ways! behavior, hemaynothavereformed his missing appendages...butjudgingbyhis Laon isonamissiontotrackdownhis to Earth!Nowwiththehelpofareporter, abilities -are removed, andhe’s banished tails -whichholdthekeytohissupernatural consequence forhisbehavior?Hisearsand a bittoomischievousinheaven.The Laon isanine-tailedfoxwho’s been LAON 16+ •#9780316077866 Vol. 3 16+ •#9780759529533192pgs$8.24 Vol. 2 16+ •#9780759529540192pgs$8.24 Vol. 1 the deadlyJackFrost! aid ofthemostsinisterstudentatAmityville: rely ontheunlikely(andpossiblyunreliable) Caught inthecrossfi re, Noh-Amayhaveto paranormal creatures battleforsupremacy. is asitappearsatAmityvilleHigh,where is she?),Noh-Aquicklyrealizes thatnothing description! Decapitatedbutnotdead(or say theleast.Brutalmightbeabetter School, andherreception ischillyto It’s Noh-A’s fi rst dayatAmityvilleHigh JACK FROST 13+ •#9780759531543 Vol. 10 13+ •#9780759531536192pgs$8.24 Vol. 9 13+ •#9780759531529192pgs$8.24 Vol. 8 Released 8/31/10 Released 9/30/10 Released 5/31/10 Released 9/30/10 Released 5/31/10 Released 7/31/10 Released 5/31/10 Released 8/31/10 Bizenghast ©M.AliceLeGrow andTOKYOPOPInc. 192 176 192 192 192 pgs•$8.24 pgs•$8.24 pgs•$8.24 pgs•$8.24 pgs•$8.24 More volumesalsoavailable! that hesurvivestotellthetale? of strangethingswouldhedotomakesure desperate tosavehissister’s life?Whatkind But whatifShahrazadwasactuallyaboy genies, andmanyothermysticalcreatures. the adventures ofAladdin,AliBaba,Sinbad, nights, sheentertainedthemadSultanwith Arabian nights.Foronethousandand Shahrazad andherwonderfultalesofthe Everyone knowsaboutthestoryof AND ONENIGHTS ONE THOUSAND ALL •#9780316097611 Vol. 3 ALL •#9780759530577192pgs$8.24 Vol. 2 ALL •#9780759530560192pgs$8.24 Vol. 1 mischief andfun. manages tostirupahealthyhelpingof up, orhelpingoutafriend,thistrioalways Whether they’re bakingcookies,cleaning and you’vegotarecipe foradventure! a sprinkleofsunshineanddashmagic, 16+ •#9781427818089400pgs $14.99 Vol. 2 16+ •#9781427818072384pgs$14.99 Vol. 1 exchange forhissoul. who offered Ivanachanceatvengeance,in of thedemonBelial,avoiceindarkness black prayers,hehasreturnedwiththehelp corrupt withdemons,theundead,and Hell. Nowhe’s thepriesthood back.With onhim,sendinghimheadlonginto turned for it-thentheestablishmenthebelievedin his faithhewouldhavegivenupanything Ivan Isaacswasonceapriest.Devotedto ULTIMATE EDITION PRIEST 13+ •#9780316077736 Vol. 5 13+ •#9780316077729192pgs$8.24 Vol. 4 13+ •#9780316077705192pgs$8.24 Vol. 3 13+ •#9780759529557192pgs$8.24 Vol. 2 13+ •#9780759529564192pgs$8.24 Vol. 1 But it’s alljustadream, right? pig brideforaslonghecanremember. Si-Joon Leehasbeendreaming aboutthe done and...wakesup.Nowinhighschool, only afterward thatherealizes whathe’s to atoneforthesinsoftheirancestors.It’s told thathemustmarrythepig-facedgirl follows herdeepinthewoods,where heis girl inapigmaskappearsbefore him,he never makeitoutalive.Whenastrange camp, eight-year-old Si-Joonfearshe’ll Lost inthemountainsonatriptosummer PIG BRIDE 16+ •#9780759531635 Vol. 11 16+ •#9780759531628176pgs$8.24 Vol. 10 16+ •#9780759531444176pgs$8.24 Vol. 9 16+ •#8952744705180pgs$8.21 Vol. 1 Released 9/30/10 Released 5/31/10 Released 6/8/10 Released 5/4/10 Released 7/31/10 Released 4/30/10 Released 8/31/10 Released 4/30/10 176 192 176 pgs•$8.24 pgs•$8.24 pgs•$8.24 PICK SSTAFF P T I A C F K F 16+ •#9780759530591192pgs $8.24 Vol. 2 16+ •#9780759530584160pgs $8.24 Vol. 1 evil spirits. can becruelerthanthemostheinousof humans whoprove thatsometimespeople spirits bothwickedandmelancholy assistant, Ho-Yeon, astheyencounter of Baek-On,anexorcist forhire, andhis touching ghoststories,followtheadventures In thiscollectionofeerieandsometimes TIME ANDAGAIN 13+ •#9780316102414 Vol. 5 13+ •#9780759530775192pgs$8.24 Vol. 4 13+ •#9780759530768192pgs$8.24 Vol. 3 13+ •#9780759530751192pgs$8.24 Vol. 2 13+ •#9780759530744192pgs$8.24 Vol. 1 now abig-timerock star. school whomshebulliedmercilessly, andis to seeagain-Hee-Do,aboyfrom grade she’d meetthelastpersonsheeverwanted it wouldberough, butsheneverthought soon asshegetsoff thebus.Sheexpected element, shemanagestogetintotrouble as village tothebigcity. Completelyoutofher Jae-Gyu issentfrom hersecludedcountry SUGARHOLIC More volumesalsoavailable! 16+ •#9781595824530192pgs$9.71 Vol. 9 16+ •#DHGN159307638X208pgs$9.71 Vol. 1 protect hismaster’s child. a secret promise toleaveYarong’s sideand Yarong ismortallyinjured, Batumustfulfi ll plots whichwillsoonengulfthem.When whirlwind ofpoliticalmovementsandsecret grave mission,theyhaveyettorealize the Yarong andhisfaithfulservantBatu.Ona two mysteriouswarriors:masterwizard From thedesertwastelandsemerge SHAMAN WARRIOR 13+ •#9780316077859 Vol. 5 13+ •#9780316077842192pgs$8.24 Vol. 4 13+ •#9780316077811192pgs$8.24 Vol. 3 13+ •#9780759530164192pgs$8.24 Vol. 2 13+ •#9780759530157192pgs$8.24 Vol. 1 of herlifehatestodeath? time todie.Butwhygobackwhenthelove thatit’sworld beyond,onlytolearn nother down astaircase! Ji-Haeawakensinthe had enough...andinadvertentlypushesher crosses theline,Seung-Hyudecideshe’s but tonoavail.Whenherlatestscheme done allshecanthinkoftowinhisaffection, with herclassmateSeung-Hyu.Shehas High schoolerJi-Haeisdesperatelyinlove SARASAH 16+ •#9780759530515 Vol. 3 16+ •#9780759530508192pgs$8.24 Vol. 2 16+ •#9780759530492192pgs$8.24 Vol. 1 artifact. Drinkit?Ordie? must makeadecisionaboutthelife-giving creatures. herverylifeindanger, With herself pursuedbymysteriousanddeadly item isinhighdemand,andshesoonfi nds the onewhodrinksit.Butsuchaprecious blood ofChristthatwillgrantimmortalityto holy grail,shediscoversavialcontainingthe When shesneaksintoachurch tofi nd the Ariel worksasanarchaeologist’s assistant. RAIDERS Released 7/31/10 Released 5/31/10 Released 8/31/10 Released 5/31/10 Released 7/31/10 192 192 192 pgs•$8.24 pgs•$8.24 pgs•$8.24 13+ •#9781933164748496pgs $11.99 Vol. 1 the utmost-highschool! an assignmentthatwilltestherabilitiesto espionage weapon.Butnowsheisgiven ago tobetheU.S.government’s ultimate has beentrainedsinceherbirth15years in alabfrom thefi nest geneticmaterial, she Luna istheperfectsecret agent.Agirlgrown OMNIBUS EDITION AMAZING AGENTLUNA N/R •#9781595824127392pgs$12.71 spiritual growth. of lifeandeveryhuman’s possibilityfor that becomesametaphorforthecycle as aswordsman, heembarksonajourney of hismastertotraveltheworldandgrow When Ningenleaveshisdojoattherequest A FEWBOWLS OFRICE 365 SAMURAI AND More volumesalsoavailable! 13+ •#9780759531352192pgs$8.24 Vol. 6 13+ •#9780759531345192pgs$8.24 Vol. 5 13+ •#9780759528628200pgs$8.24 Vol. 1 perfect princewasactuallyabigjerk?! with anexpensiveprice.Whoknewthe true! ButwhenNan-wogetshers,itcomes However, sometimesdreams existtocome Seung-Ha wasjustadream -far, faraway. is defi nitely noteasy, andforNan-wo, school. Chasingaftersomeonesoperfect perfect princeandshiningstarofthe Everyone dreams aboutSeung-Ha,the YOU’RE SOCOOL More volumesalsoavailable! 13+ •#9780759531505176pgs$8.24 Vol. 7 13+ •#9780759531499176pgs$8.24 Vol. 6 13+ •#9780759531482176pgs$8.24 Vol. 5 13+ •#9780759528659192pgs$8.24 Vol. 1 torespectlearn eachother’s differences. encounter, thetwolatergrow closeand passes outonhim.Despiteanuglyfi rst a chattyandenergeticgirlnamedVery, brings himtoKorea where histaxidriver, their ancestry. Thefamilynames’roots sends himonaquesttofi nd theroots of reins tocrackdownonhim.Hisgrandfather strict grandfatherhasfi nally beengiventhe Chuyosi isarestless troublemaker whose VERY! VERY!SWEET 16+ •#9780759530607 Vol. 3 AMERIMANGA Released 6/30/10 Released 7/31/10 service!” -JustinS. service!” “I’ve beenenjoyingnothingbutgreatdealsand 160 pgs•$8.24 PICK SSTAFF P T I A C F K F 800.338.6827 books.rightstuf.com More volumesalsoavailable! 13+ •#9780759530393192pgs $8.24 Vol. 4 13+ •#9780759530430192pgs $8.24 Vol. 3 13+ •#9780759530386192pgs$8.24 Vol. 2 13+ •#9780759530416192pgs$8.24 Vol. 1 into thedarkandbloodyworldofvampires. and whatfollowsishishorrifyingdescent will go.Asifbydestiny, Darren winsone, available, sotheydrawstrawstoseewho mysterious freak show. Onlytwoticketsare an invitationtovisittheCirque duFreak, a friends. Thenonedaytheystumbleacross who enjoyshangingoutwithhisthree best Darren Shanisjustanordinary schoolboy DUFREAK CIRQUE 13+ •#9780759530294 Vol. 1 become apartofTheClique? her turf.DoesClaire havewhatittakesto less thrilledwiththenewcomersquattingon Claire’s newschool.Massiecouldn’t be just happenstobethequeensupreme of Block family’s estate,andMassieBlock has movedintotheguesthouseon To makemattersworse, Claire’s family (and fashion)demandsofhernewpeers. She’s totallyunprepared forthesocial Country Day, anexclusive privateschool. Claire Lyons isthenewgirlatOctavian CLIQUE 13+ •#9781427817662 Vol. 7 13+ •#MM1595327436192pgs$7.49 Vol. 1 of lostsouls. must “clean”thevaults,cryptsandgraves contract torelease wanderingspiritsand she accidentallyfi nds herselfboundtoa When Dinahdiscoversalostgraveyard, haunted, butherauntthinksshe’s mental. her aunt.Dinahthinksaunt’s houseis the smalltownofBizenghasttolivewith Dinah isayounggirlwho’s beensentto BIZENGHAST ALL •#9780345522245 Vol. 2 13+ •#978034551439496pgs$5.99 Vol. 1 blasts Benseeminglyoutofexistence! any theyhaveeverreckoned with:theship the crashsite,theyfi nd aforce greater than to Earth.WhenBenandhisfriendsrace superpowers whenanalienshipcrashes alien beings.AndBen’s goingtoneedhis him totransformintooneof10powerful a super-cool alienwristwatchthatallows disguise! He’s thepossessorofOmnitrix, Ben Tennyson isfi fteen -andahero in DOOM DIMENSION BEN 10 ALIEN FORCE ALL •#9780345515889176pgs$8.24 controls thefateofuniverse! called Vestroia -andthattheirgameactually world actually corresponded toanalternate battle game,notknowingthatthesecards different powers.Kidscreated apopular characters, different environments, and the world.Thecards featured different sky andwere pickedupbykidsallover One day, cards begantofallfrom the BRAWLERS BAKUGAN BATTLE 13+ •#9781934876664384pgs$11.99 Vol. 2 Released 7/31/10 Released 6/29/10 Released 7/27/10 96 192 192 pgs•$5.99 pgs•$8.99 pgs•$8.21

57 BOOKS BOOKS 58 The DarkCrystaltoldthestory ofJenand DARK CRYSTAL LEGENDS OF THE 16+ •#9780345513595192pgs$8.21 Vol. 1 Mages &Monstersgameintheworld. whose singlegoalinlifeistorunthegreatest Theodore, afanaticaltabletopgamemaster campus gamingclub,where theymeet plan untilafangirlintroduces themtothe computer. Everything’s goingaccording to tasked withkeepinghimfarawayfrom any and monthsoftherapy. HisfriendMikeis recovery toboot,followingacourtorder Maccabee isahard-core gamer-andin No onewouldguessthatfreshman Shesh KING OFRPGS 13+ •#9781934876725544pgs$14.99 evil geniuses!Omnibusedition. the nextgenerationofmadscientistsand boarding schooldedicatesitselftoraising and runbytheinsidiousEngineers,grim Fields. LocatedontheoutskirtsofNullsville Ethically Unfettered -alsoknownasHollow Academy fortheScientifi cally Giftedand sees herenrolled insteadatMissWeaver’s in town;however, amacabre twistoffate her fi rst dayattheniceelementaryschool Little LucySnowwasmeanttobeenjoying OMNIBUS EDITION HOLLOW FIELDS 16+ •#9780759530263 Vol. 1 she gotomakeamessofSerena’s life? Blair intendstorespond inkind!Howfarwill seeing Serena withhernewboyfriend,Dan, friend hasnointentionofforgivingher. After with Blair. Too badSerena’s formerbest Now she’s backandtryingtomakeamends Serena thendisappeared withoutaword. on herwithSerena! Asifthatwasn’t enough, discovered thatherboyfriend,Nate,cheated Blair andSerena were BFFs...untilBlair GOSSIP GIRL 13+ •#9781934876732496pgs$14.99 Complete Series girl whocanout-doanyman! of thelosttreasure? OliviaSoldana,abrash appoint toleadhisfearlesscrew insearch fi nd thelegendaryDevil’s Eye.Whodoeshe give up.Hisfi nal wishbefore hediesisto sunk andledbyadyingcaptainwhowon’t Destiny’s Hand:apirateshipthatcannotbe OMNIBUS EDITION DESTINY’S HAND 13+ •#9780316077644 Vol. 1 dangerous missionastheAlienHunter. race. Now, hevowstotakeonhisfather’s intergalactic criminalspreying onthehuman Daniel possesseshisfather’s listtargeting beyond theEarththatare theproblem. anything intheworld.It’s thethingsfrom mind, Danielisstrong enoughtotakeon shape-shift andmoveobjectswithhis supreme abilities,likebeingableto With DANIEL X 13+ •#9780759530409 Vol. 6 13+ •#9780759530423192pgs$8.24 Vol. 5 Released 8/31/10 Released 7/31/10 Released 7/31/10 Released 4/30/10 books.rightstuf.com 800.338.6827 192 192 192 pgs•$9.74 pgs•$8.99 pgs•$8.24 PICK SSTAFF P T I A C F K F 16+ •#MM1598167383192pgs $7.49 Vol. 2 16+ •#MM1598167375192pgs $7.49 Vol. 1 can thelightofthisromance survive? Between adarkpastandshadowyfuture, quickly spinsfrom adream toanightmare. fi gures beginstostalktheband,herworld prayers! Butwhenapairofmysterious extraordinaire. He’s theanswertoallher spot -untilshemeetsIzsak,bassplayer When herbassistbails,she’s inatough Cree isthe leadsingerforapunkband. RE:PLAY 16+ •#9781427813008192pgs$8.24 Vol. 2 16+ •#9781427812995192pgs$8.24 Vol. 1 both worldstothebrinkofdestruction... forces havegathered andthreaten topush are notastheyshouldbe,either. Mysterious of rule.AndbackonTheOtherSide,things with loneliness,isolation,andthepressures but allisnotwellinparadise,asAistruggles returned totroubled andwar-torn Ai-Land, A yearhaspassedsincePrincessAi THE PRISMOFMIDNIGHTDAWN PRINCESS AI 13+ •#9780759528611192pgs$9.74 Vol. 3 13+ •#9780759528604192pgs$8.24 Vol. 2 13+ •#9780759528598192pgs$8.24 Vol. 1 for whatshefi nds attheNightschool? become ofhersister. shebeprepared Will whathas and demonsatschooltolearn namedAlexjoinsthevampires A youngweirn lights maybeoff, butclassisstillinsession. Schools mayclosedforthenightand where dodemonsgettheirdiplomas? Nightschool answerstheage-oldquestion: NIGHTSCHOOL More volumesalsoavailable! ALL •#9781401224813240pgs$8.24 Vol. 6 ALL •#DHGN1593071639152pgs$7.46 Vol. 1 gamers ofthe21stcentury! the eyesofLargoandPiro -theuber towards love,experiencetheworldthrough zombies, oreventakingthosetimidsteps Tokyo from devastationbyrampaging in theirmostrecent gamingscenario,saving Whether they’re sneakingintoE3,entangled MEGATOKYO 13+ •#9780759529694240pgs$8.24 Vol. 3 13+ •#9780759529687240pgs$8.24 Vol. 2 13+ •#9780759529519240pgs$8.24 Vol. 1 to saveher. toblazinghotDeathValley,a journey CA, by sinisterscientists,theothersmustbrave and theotherswere geneticallyengineered is kidnappedandtakenbacktowhere she Angel, theyoungestmemberofFlock, only theyhavewingsandcanfl y. When of the“Flock”are justlikeordinary kids- above theworld.Sheandallmembers known asMax,knowswhatit’s liketosoar Fourteen-year-old MaximumRide,better MAXIMUM RIDE 13+ •#9781598167023 Vol. 2 13+ •#MM1598167014 Vol. 1 Unfortunately, soare theevilSkeksis... Gelfl ings andwiseMysticsare stillthriving. the eventsoffi lm, whenthegentle takes placehundreds ofyearsbefore forces ofgoodandevil.Thismangaprequel world precariously balancedbetweenthe Kira, thelastoftheirkindlivinginafractured Released 4/30/10 Released 5/26/10 Released 4/30/10 Released 8/3/10 224 192 pgs•$9.74 pgs•$7.49 More volumesalsoavailable! postcard, Danielmakeshiswaytotheheart only withhiswits,gun,andamysterious a different kind:hislong-lostsister. Armed Legend fi nds himselftrackingaquarryof In theyear2020,bountyhunterDaniel SHINJUKU 13+ •#9781427816870 Vol. 4 13+ •#MM1598167251192pgs$7.49 Vol. 1 best interests... Goblin King,hasbeenlookingoutforhis Little doesheknowthatJareth, the easily tohim,evenwhenunderpressure. noticed thatmanythingshavecomevery has grown up.Ashehasgrown hehas his initialvisit,Toby hasreturnedhomeand Sequel tothemovie!Afterhavingsurvived LABYRINTH RETURN TO 13+ •#9781427815668144pgs$11.24 Color into life,nomattertheconsequences. heart ofwhatitmeanstothrow youheart portrayals ofloveandlossthatgetatthe worth therisk?Benjamindepictsmoving When islettinggoofyourinhibitions REMEMBER N/R •#9781553653530120pgs$22.95 Hardback (Color) her andexactrevenge onhercaptors. a seethinganger, andRedsetsouttofi nd whisked away. Thelossofhissisterbreeds escapes dramaticallybuthissister, Jaada,is When raidersattackhisvillage,youngRed leads hiscommunitytothebrinkofwar. leader soblindedbyrevenge thathe the powerfulstoryofRed,anorphaned imagery withJapanesemangatotell this full-colorbookblendstraditionalHaida Referencing aclassicHaidaoralnarrative, RED: A HAIDA MANGA 16+ •#9781598167399192pgs$8.24 Vol. 3 Released 8/3/10 192 pgs•$9.74 both irresistible andimpenetrable.Upuntil gifts,Edward is voice, andsupernatural porcelain skin,goldeneyes,mesmerizing his With a thrillingandterrifyingturn. alluring Edward Cullen,herlifetakes town ofForksandmeetsthemysterious, When IsabellaSwanmovestothegloomy TWILIGHT 13+ •#9781427816139 Vol. 2 13+ •#9781427816122192pgs$8.24 Vol. 1 own buddingpsionicabilities. emotional pain,addictiontodrugs,andtheir teen issuessuchascrushes,physicaland with everyday-andnotso cadets intraining.Theyare forced todeal Terrans are rough-around-the-edges Ghost - andtragedy. Fiveteenagedfourth-class StarCraft charactersdestinedforgreatness Ghost Academychronicles theearlyyearsof GHOST ACADEMY STARCRAFT 12+ •#9780888999641144pgs$12.95 Paperback 12+ •#9780888997531144pgs$18.95 Hardback isolation. struggles tocopewithherconfusionand when Ms.Archer abruptlyleaves,Skim neo-hippie Englishteacher, Ms.Archer. But to Skimwhenshemeetsinsecret withher time tofallinlove,butthat’s whathappens to fi nd somethingtobelievein.It’s aweird overdrive,into mourning eachcliquetrying classmate killshimself,theschoolgoes stuck inaprivategirls’school.When goth Keiko Cameron, awould-beWiccan It’s theearlyninetiesand“Skim”isKimberly SKIM N/R •#9781595821898160pgs$18.74 Hardcover very fabricofreality. -threatensthe criminalandinfernal where aclashbetweentwounderworlds- of theseedyShinjukudistrictTokyo, Released 8/3/10 Go Heaven!!©1997KeikoYamada/Akitashoten. GO HEAVEN!! 192 pgs•$8.24 YOKAIDEN army before itovertakesthem? they beabletocontrol thisstrange,mutated of dragonsunlikeanyTyri hasseen.Will Warcraft originated.There, theyfi nd agroup Orcs andotherspeciesintheWorld of portal andintoOutland,from whichthe Jorad Maceare drawnthrough adark Blue dragonTyrygosa andhumanpaladin DRAGONS OFOUTLAND WARCRAFT N/R •#9780759529434224pgs$14.99 Vol. 1(Hardcover) uncover hisdarksecret... identity hidden,butBellaisdeterminedto now, hehasmanagedtokeephistrue talking lantern. Will Hamachibeableto fi Will talking lantern. nd truant children, anangrywaterspirit,and a way, heencounters anogre whopunishes intotheYokaijourneys realm. Alongthe mysterious circumstances, Hamachi When hisgrandmotherdiesunder 17+ •#9781933664422600pgs$24.74 Set (Vols. 1-4) nice slaveinhisownright! demon thinksthefeyFuyuwouldmakea are outofhisleague.Evenworse,thelead Fuyu realizes toolatethatthefi re demons only ifHakuinbecomeshiswillingslave. again, andheagrees todefeatthedemons Fuyu isthrilledtoseehisbeautifulmonk demon whotormentedhimayearago. forced toseekhelpfrom Fuyu,thesnow terrorize themonkHakuin’s village,he’s When three ruthlessfi re demonscometo WINTER DEMON 10+ •#9780061688652112pgs$5.24 Vol. 1 their homeforgood. overpower therogues -before theylose He andBarleymusttrytofi nd awayto shelter, Ravenpaw’s newlifeisthreatened. from Twolegplace seeking cometothebarn best friend,Barley. Butwhenfi ve rogue cats quiet daysandpeacefulnightswithhis the rightchoice,andheappreciates his He knowsthatleavingthewarriorclanswas away from theforest andTigerstar’s evileye. Ravenpaw hassettledintolifeonthefarm, RAVENPAW WARRIORS 13+ •#9781427814975192pgs$8.24 Released 6/8/10 can stop. when heisforced toconfront afoeonlyhe mage whofaceshisgreatest challenge This class-basedmangafollowsayoung MAGE 13+ •#9781427814968192pgs$8.24 Vol. 1 it takestolead. to others-andhimselfthathehaswhat army, Thassarianseeshischancetoprove to sailNorthrend andbattlethesource when PrinceArthascallstoarmsbravemen leaders havetoleadmenintobattle.So and skill,helacksthesparkthatallgreat father. Butthoughhepossessesstrength longs tobeagreat hero likehisdeceased Thassarian isaloyalLordaeron soliderwho DEATH KNIGHT 13+ •#9781427810267192pgs$8.24 Vol. 1 Released 6/8/10 PICK SSTAFF P T I A C F K F a violentaltercation withschoolbullies, When herbrother Hiroki disappearsafter BOOK OFHEROES N/R •#9780316076906192pgs$6.74 Vol. 1 delicacy? letters, willTouko discoveranewkindof literary clubdoorforadviceonwritinglove when astudentcomesknockingonthe delicacies are hand-writtenstories.But outpages.ButforTohko,on torn thereal found atallhoursofthedaymunching a literature-gobbling demon,whocanbe bread andbutter... literally!Tohko isactually than justanextracurricularactivity. It’s her being theheadofliteraryclubismore For Tohko Amano,self-styled “bookgirl,” 17+ •#9781595823380224pgs$8.21 powerful ? survive theirgreatest battle,againsttheall- faced manydeadlychallenges,butcanthey the murders ofherparents. Thetwohave Rin, anorphanwhoseeksvengeancefor past sins.Byhissideistheyoungwoman one thousandevilpeopletoatoneforhis hillsides offeudalJapan,hisquesttoslay the masterlesssamuraiManjiwanders mystical wormsthatcanrepair anywound, Rendered immortalbyaninfusionof LEGEND OFTHESWORDDEMON BLADE OF THE IMMORTAL 17+ •#9781421527727624pgs$12.71 “winner” remains. each otherforthree daysuntilonlyone when theybreak arule,theymustfi ght Forced towearspecialcollarsthatexplode with amap,food,andvariousweapons. students are takentoasmallisolatedisland ninth-grade totalitarian government, As partofaruthlessprogram bythe BATTLE ROYALE 10+ •#9781427813824192pgs$8.24 Vol. 2 10+ •#9781427813817192pgs$7.49 Vol. 1 his abilities? save Shinonowthathehaslostallof Level 1byamysteriouspower!CanHaseo called “Tri-Edge,” Haseoisdropped backto on fi nally meetingwithhissolelead,aPK Killer), continuesanendlessfi ght. However, virtual worldHaseo,aPPK(PlayerKiller this million peopleacross theglobe.Within online gameplayedbymore thantwelve “The World” isamassivelymultiplayer G.U. 16+ •#9781427817181192pgs$8.24 Vol. 1 Midori intheprocess. of herpast,andperhapssavethereal-world game-Midori willtrytosolvethemysteries thesanityofbothgirlsonline, With both MidoriShinomuraandgame-Midori. is astrangeandcloseconnectionbetween the onlinegameknownasTheWorld. There another Midori-afi ghter ofterribleskillin of wastes awayinahospital,shelearns Shinomura fallsmysteriouslyill.Whileshe Average high-schoolstudentMidori CELL .HACK// 13+ •#9780345503299208pgs$8.21 Vol. 2 13+ •#9780345503275208pgs$8.21 Vol. 1 forever inanotherworld? his grandmother’s killer, orwillhebelost Released 7/31/10 NOVELS comes forward asawitness,buttheman’s violent incidents.Apowerful businessman four havealsorecently diedinsimilarly three otheryoung women.Two ofthe had beeninvolvedinacruel scamwith taxicab. Mamorudiscoversthatthevictim in alate-nightaccidentwhiledrivinghis adjust tohisnewlife,uncleisinvolved aunt anduncle.Justasheisbeginningto recently movedtoTokyo tolivewithhis Sixteen-year-old MamoruKusakahas DEVIL’S WHISPER N/R •#9781421532257174pgs$13.49 humanity. to changetheworld...bykillingoff mostof justice, ortheywilluseadeadlynewvirus three daystobringaterrorist group to placed inaDeathNote.Hehastwenty- setting, acedetectiveL’s namehasbeen continuityintheDeathNote In analternative L CHANGETHEWORLD DEATH NOTE 16+ •#9781569701393200pgs$8.95 Vol. 3:ColdFever 16+ •#9781569701386200pgs$8.95 Vol. 2:ColdLight 16+ •#1569708878250pgs$8.95 Vol. 1:ColdSleep present. entangles theintricaterelation ofpastand What unravelsisadramaticlovestorythat refusing totellToru anythingabouthispast. However, Fujishimaiscoldandunwieldy, an oldermanclaimingtobehisfriend. Toru Takahisa istakeninbyFujishima, Having losthismemoryinanaccident, COLD SLEEP N/R •#9781934287125256pgs$11.21 Released 8/24/10 “the OldDog,”DetectiveTakagi. a boyduringhisgetaway, andonhistrailis But unlikeyourordinary hero, Kojikidnaps running from thepoliceaswellmod. on Koji’s handsisstillfresh. Nowhe’s loves, Makiko.Thesensationofthemurder He killedtwogangstersforthewomanhe CITY OFREFUGE More volumesalsoavailable! 13+ •#9781598169270192pgs$8.24 Vol. 6 13+ •#MM159816922X192pgs$5.99 Vol. 1 Karin seemstoneverdothingsright! be extremely positive.Theproblem isthat “victims.” Ifdoneright,thisactofgivingcan blood. Butsheprefers togivebloodher a familyofvampires wholovetosuck bleeding -from hernose!Karinisfrom Once amonth,sheexperiencesintense Karin isn’t likealltheotherteenagegirls. N/R •#9781421527734820pgs$12.71 Paperback together again. to bringhismotherandfatherback of seeminglyinsurmountableobstacles Breathing Dragon,Wataru facesaseries the Lizard Boy, theCatGirl,andFire- power tochangedestiny. thehelpof With realm inhabitedbyagoddesswhohasthe father, Wataru knowinglyentersafantasy aplantoreunite hismotherandWith N/R •#9781421527758400pgs$17.99 do so! powerful magicalbooksatherdisposalto together themysterywithalibraryof brother, andissentbacktoEarthpiece Land, where sheistoldhowtosaveher of Heroes. ShevisitsthemagicalNameless been possessedbyaspiritfrom theBook world where thatHiroki shelearns has his room. Thebookleadshertoanother the youngYuriko fi nds amagicalbookin Released 5/26/10 800.338.6827 books.rightstuf.com N/R •#9780345516275240pgs $7.46 nightmare -butit’s onlythefi rst ofmany. of losingtheircherishedclub istheultimate Kousaka, Ohno,andtheothers, theidea a bigfanofbruteforce. ForMadarame, kind thatdon’t (arty, frivolous),andhe’s industrious)andthe to survive(earnest, ideas aboutthekindofclubsthatdeserve organization committee.Hairuhasstrong named chairmanoftheon-campusclub Japanese conglomerate,andthenewly the handsomescionofapowerful New transferstudentRantoHairuis RETURN OFTHEOTAKU GENSHIKEN N/R •#9781934287804560pgs$20.21 Hardcover envasion inhistory! attempt toengageonthelargestland the U.S.hanginbalanceasAllies soldiers from Britain,Austrailia,Chinaand and thefateofhundreds ofthousands Operation Downfallisabouttocommence attack andpotentialinvasion...ofJapan. other offi cers ofhighranktoplantheir battleship. Hemeetswiththecaptainand designated toabriefassignmenton offi cer KenjiKobayashihasrecently been Decorated World War IIintelligence FLOWERS OFEDO 16+ •#9781569700914200pgs$10.95 why can’t Irefuse him?” wonder, “Whydoeshekissmeso?And that Asouhasagirlfriend.Satoribeginsto But onedaySatorihearsanastyrumor him, Satoriisunabletoresist hiskisses. over andover, andasmuchitperplexes comes overhedoesnothingbutkissSatori with Asou.Sincethen,everydaythatAsou free-fl owing alcohol,Satoriendsupsleeping spirits andundertheinfl uence oftheparty’s On thenightofyear-end party, inhigh FEVERED KISS 13+ •#9781594097935200pgs$6.74 Vol. 2:UnknownPleasure 13+ •#9781594097928200pgs$6.74 Vol. 1:BlueMonday thatwillchangebothoftheirlives... journey girl namedEureka emerges.Thisbeginsa grandfather’s garageandabeautifulyoung known asanLFOcrashlandsinhis hoverboarding. Oneday, alargemecha his timelifting,anextreme formofaerial who istired ofhisboringlifeandspends Renton Thurstonisayoung14yearold EUREKA SEVEN More volumesalsoavailable! ALL •#978142153125080pgs$3.74 Vol. 9 ALL •#978142153124380pgs$3.74 Vol. 8 ALL •#978142153123680pgs$3.74 Vol. 7:LettheTournament Begin ALL •#978142153122980pgs$3.74 Vol. 6:Training withtheMaster ALL •#978142153121280pgs$3.74 Vol. 5:OneEnemy, OneGoal ALL •#978142152945580pgs$3.74 Vol. 1:TheAdventureBegins! adventure ofalifetime... fl ying cloudforaride,Gokusetsoutonthe amagicstaff foraweaponand With needs Goku’s help(andhissuper-strength)! are scattered allovertheworld,andBulma grant heronewish.Buttheprecious orbs incredibly powerfuldragonwillappearand “Dragon Balls.”Ifshegathersthemall,an Bulma, agirlonquesttocollectseven whose quietlifechangeswhenhemeets Meet naiveyoungmonkey-tailedboyGoku, CHAPTER BOOKS DRAGON BALL N/R •#9784770031174264pgs$11.95 an already puzzlingcase. testimony onlyaddsmore confusingliesto Released 7/6/10 Released 5/4/10 Released 5/25/10

59 BOOKS BOOKS 60 to medicalnanotechnologyandpowerful Utopia hasfi nally beenachievedthanks HARMONY 13+ •#9781604962017200pgs$6.74 Vol. 2 13+ •#9781604961898180pgs$6.74 Vol. 1 of majorpowersandtheirallies. this systemare availableonlytoahandful orbital elevators.However, thebenefi ts of generation systembasedonthree huge in theformofalarge-scalesolarpower a newsource ofenergytoreplace them have beendepleted,humanityhasobtained The yearis2307A.D.Althoughfossilfuels 00 GUNDAM, MOBILE SUIT 16+ •#9781569701584200pgs$10.95 him upontheoffer. with me.”Buttohisshock,Natsukitakes everything, Izumifl ippantly says“Goout one daywhathecandotomakeupfor personality. SowhenNatsukiasksIzumi the ostracismhasseriouslywarpedhis him thehatred ofeveryoneinschool,and off-handed criticismofhisfriendearned around him.Butfi ve yearsago,Izumi’s disposition havewontheheartsofeveryone Natsuki. Natsuki’s perfectlooksandsweet problem: hischildhoodbestfriend,Makoto High schoolfreshman Shotaro Izumihasa GREEN LIGHT 13+ •#9781427805706232pgs$9.74 Vol. 2 13+ •#MM1427805695192pgs$7.49 Vol. 1 description toatee... a shipthatmatchestheQueenBerry’s it’s wholeadstheduotoboard Victorique solve mysteriesdetectivescan’t. Ironically, stories, andusesherunrivaledlogicto however, ismuchmore intriguedbytrue ship QueenBerry. HisfriendVictorique, are alltherage,includingstoryofghost Marguerite Academy, where urbanlegends studying abroad attheprestigious Saint The yearis1924.KazuyaKujohasbeen books.rightstuf.com 800.338.6827 to onlinenetworks.Evenschoolchildren exclusively through monitorsconnected In thefuture, humanscommunicatealmost LOUPS-GAROUS 16+ •#9780759529311240pgs$8.24 Vol. 3 16+ •#9780759529304240pgs$8.24 Vol. 2 16+ •#9780759529298240pgs$8.24 Vol. 1 possessing aradio,tohisgrave. who diedinthatwarandhassincebeen toreturntheghostofasoldier,his journey war 80yearsago.ShefollowsHarveyon to beimmortalkillingmachinesinaviolent from recycled corpsesthatwere trained Undying. TheUndyingwere soldiersmade who happenstobeoneofthelegendary ghosts, encountersamannamedHarvey, Kieli, alonelygirlwiththepowertosee KIELI 16+ •#9781569702683N/Apgs$10.95 Released 8/31/10 I WANTBITE TO N/R •#9781421536439300pgs$11.21 Released 7/20/10 help savetheplanet...from itself. her suicidepact,andtogethertheymust world, Tuan rediscovers anothermemberof As acrisisthreatens theharmonyofnew a memberoftheWorld HealthOrganization. one ofthegirls,Tuan Kirie,grows uptobe suicide viastarvation.Itdoesn’t work,but up tototalitariankindnessbyattempting perfect, though,andthree younggirlsstand social welfare. Thisperfectworldisn’t that FLOWER INASTORM Released 9/30/10 PICK SSTAFF P T I A C F K F crew andcargofortheSolomonSpace her teenfriends,allpetite, are theperfect youngest, lightestastronaut. Yukari and she needdoinreturnisbecome theworld’s the helpsheneedstofi nd herfather, andall she receives theoffer ofalifetime:she’llget searching forhimontheSolomonIslands, quest tofi nd hermissingfather. While Yukari Moritaisahighschool girl ona ROCKET GIRLS N/R •#9781421534411350pgs$12.71 Released 5/18/10 trouble, and perhapsromance await. Aomine headtothemoonwhere adventure, lunar surface.Tae andOtabaengineer Tae tobehiseyesandearsontheharsh civilian use,andhewantshisgranddaughter conglomerates, wantsamoonbasefi t for chairman ofonetheworld’s largestleisure challenge yet.SennosukeTouenji, the Construction hasreceived itsmostdaunting The yearis2025andOtabaGeneral NEXT CONTINENT More volumesalsoavailable! ALL •#978142153044480pgs$3.74 Vol. 14 ALL •#978142153043780pgs$3.74 Vol. 13 ALL •#978142153042080pgs$3.74 Vol. 12:Coward ALL •#978142153041380pgs$3.74 Vol. 11:TheTenth Question ALL •#978142152320080pgs$3.74 Vol. 10:TheFirstTest ALL •#978142152056880pgs$3.74 Vol. 1:TheBoyNinja clown fi rst! everyone thathe’s more thanjusttheclass ever lived.Onlyhe’llhavetoprove to thinks he’s goingtobethebestninjathat think he’s annoying,andNarutohimself trouble attheNinjaAcademy. Histeachers under control. He’s causingallkindsof having trouble keepinghisjokesterways Naruto’s trainingtobeaninja,buthe’s CHAPTER BOOKS NARUTO 16+ •#9780316038874224pgs$6.74 Vol. 3(Paperback) 16+ •#9780316038867224pgs$11.24 Vol. 3(Hardcover) 16+ •#9780316038799200pgs$6.74 Vol. 2(Paperback) 16+ •#9780316038812200pgs$11.24 Vol. 2(Hardcover) 16+ •#9780316039024224pgs$6.74 Vol. 1(Paperback) 16+ •#9780316039017224pgs$11.24 Vol. 1(Hardcover) the universe.Seriously. know it,Haruhihasthepowertodestroy happy... becauseeventhoughshedoesn’t Their secondmission?KeepingHaruhi with amissiontoseekouttheextraordinary. - anafter-school cluborganizedbyHaruhi ever openedupto.MeettheS.O.S.Brigade homeroom andtheonlyboyHaruhihas sarcastic guywhositsbehindHaruhiin one understandsher. MeetKyon-the high schoolinacitywhere absolutelyno Meet Haruhi-acute,determinedgirlstarting HARUHI SUZUMIYA MELANCHOLY OF N/R •#9781421532332450pgs$12.71 Released 5/18/10 to virtualreality thanmeetstheeye. killer, thatthere Hazukilearns ismuchmore As thegirlsgetcaughtupinfi nding the classmate; andAyumi Kono,herbestfriend. Hazuki Makino,aquietbutopinionated three girls:MioTsuzuki, acertifi ed prodigy; outtohavebeenincontactwith victim turns despite allthesafeguards, thekiller’s latest students, thecrackdownisharsh.But when aserialkillerstartsslaughtering designated communicationcenters.So are onlyallowedtomeetinthefl esh in Released 7/6/10 Released 5/4/10 Released 7/31/10 Released 7/31/10 N/R •#9781421534404450pgs $11.99 by humansintheancientpast. a younggirl,andtoldofthe stories created abducted byIbis,anandroid intheformof of thestoriespast.Oneday, heis to colonyasa“storyteller,” onethatspeaks time, ourmaincharactertravelsfrom colony a stableandculturalsociety. Inthisbrutal the androids, whohavebuiltthemselves lives intheirowncolonies.Theyresent populations ofhumansliveuncultured Centuries inthefuture, thediminished STORIES OFIBIS 16+ •#9780759531062240pgs$8.24 Vol. 2 16+ •#9780759531048240pgs$8.24 Vol. 1 oppressive, monotheisticChurch. Horo andthreatensherovertothe to turn when acompetingorganizationcaptures kingdom ofTrenni, buttheirplansgoawry the depreciating silvercurrency ofthe they discoverauniqueopportunitytoexploit and thetwobegintravelingtogether. Soon meets Horo, thewolf-godofharvest, years. Hislifechangesforever whenhe path oftheitinerantmerchant forseven Lawrence Crafthasbeenwalkingthelonely SPICE ANDWOLF N/R •#9781421534398200pgs$10.46 fi ghter SlasherJack. and nightsonlineinsearch oftheinvincible Fumiko goesnowhere, hespendshisdays While hisrelationship withnewclassmate the mostpowerfulmartialartistaround. karate champonhiswaytowards becoming he assumesthepersonalityof“Tetsuo,” a logs ontothecombatMMOVersus Town, feels uncomfortableinreality, butwhenhe Etsuro Sakagamiisacollegefreshmen who SLUM ONLINE N/R •#9781934287330240pgs$11.21 Released 6/22/10 Anayama’s class. exchange fortheneededcredit inProfessor for whichProfessor Anayamacoaches-in agrees tojointhecollege’s Sumoclub- no otheroptionavailabletohim,Shuhei failure inProfessor Anayama’s class.With not graduating,becauseofhisimminent fi nds himselfintheunenviablepositionof senior studentinKyoritsuCollegewho Shuhei Yamamoto isalazy, woman-chasing SUMO? SHALL WE 16+ •#9781569701324200pgs$10.95 mage ashislover... WhatisShizukutodo?! of matingseason,hehastotakeasexual once everyhundred years,rightatthecusp actually thekingofmagicalrealm and nature isthatofasexualmage.Doga Doga, tellsShizukuthathisShizuku’s true a stunninglybeautifulman.Theparagon, home from schooloneday, he’s metby secret he’s hiding.WhenShizukucomes school studentwhodoesn’t knowthe Shizuku isanadorableandspunkyhigh SELFISH DEMONKING N/R •#9781421536422250pgs$10.46 Released 7/20/10 dangerous -training. complete theirrigorous -andsometimes Association’s launches,orwillbeoncethey Flower inaStorm©ShigeyoshiTakagi 2008/HAKUSENSHA,Inc. Released 6/30/10 PICK SSTAFF P T I A C F K F More volumesalsoavailable! 13+ •#9781598169560224pgs$8.24 Vol. 4 13+ •#MM159816953X208pgs$5.99 Vol. 1 protect thepeaceeffort. vampire whopreys onothervampires -to called AXmustuseeverything-evena continuation, aVatican specialopsgroup manipulates eventstoensure thewar’s on. Whileagroup ofvampire extremists between humansandvampires rages In apost-apocalypticworld,thewar RAGE AGAINST THEMOONS TRINITY BLOOD Clamp inAmerica©CLAMP. fascinating women,Ii-chanis feelingalittle at anelaboratemansion.Surrounded by Kunagisa Tomo, fi nd themselvesguests and hisbestfriend,computer genius Nineteen-year-old collegestudentIi-chan ZAREGOTO 16+ •#9781421532554416pgs$11.21 sign: . plane, thesentientFFR-31Sylphid,call companion inthislonelytaskishisfi ghter matter thehumancost.Hisonlyconstant the enemyandbringitbacktobase-no Force, hisdutyistogatherinformationon and SurveillanceUnit3oftheSpecialAir planet Fairy. AttachedtoTactical Combat his missionsintheskiesoveralien Second LieutenantReiFukaicarriesout In themidstofawarwithnoendinsight, YUKIKAZE More volumesalsoavailable! 17+ •#9781595824400480pgs$11.21 Vol. 14:DarkRoad1-2 17+ •#9781593079307480pgs$11.21 Vol. 13:Twin-Shadowed Knights1-2 17+ •#DHGN1595820124300pgs$6.71 Vol. 1 bring theirownkindofdanger... Hunters are betterthanothers,andsome to theeradicationofNobility. Butsome who havepledgedtheirgunsandswords raids. EveryvillagewantsaHunter-warriors into smallvillagesstrugglingagainstnightly lie inruinandthecountrysideisfragmented against thevampires hastakenitstoll:cities of vampires knownastheNobility. Thewar hundred yearsofdominationbytherace Humanity iscrawlingoutfrom underthree 12,090 A.D.Itisadarktimefortheworld. VAMPIRE HUNTERD More volumesalsoavailable! 16+ •#9781598169492256pgs$14.99 Vol. (Hardcover) 4:SkiesofDawn 16+ •#9781427802590320pgs$7.49 Vol. 3:TheVast SpreadoftheSeas(Paperback) sword andamagicstone. nothing tohelpprotect hersaveamagic and wanderingthrough aforeign landwith vanishes, Yoko isleftalone,confused, their kingdom.Whentheboymysteriously her thatsheishismasterandmustreturnto the guiseofayoungblond-haired boy, tells ordinary in life-thatis,untilKeiki,aunicorn a typicalhigh-schoolstudentwithfairly Except forherred hair, Yoko Nakajimais TWELVE KINGDOMS 13+ •#9781427800923352pgs$8.24 Vol. 3 13+ •#MM142780091X200pgs$7.49 Vol. 2 13+ •#MM1427800901200pgs$5.99 Vol. 1 of Sorrow. Hungary, from unleashingthelegendaryStar and stopGyula,thebloodthirstyMarquis of a spunkyyoungnovicenamedEsthertotry Ops AXAgentAbelNightroad teamsupwith New HumanEmpire andtheVatican. Special bent onorchestrating awarbetweenthe A mysteriousterrorist organizationishell- REBORN ONTHEMARS Released 5/4/10 Find outeverythingyouever wantedto BANQUET FRUITS BASKET 16+ •#9780345510020336pgs$20.99 CLAMP. who havehadtheopportunitytoworkwith interviews withtheeditorsandpublishers manga creators they’veinfl uenced; and to America;interviewswiththeAmerican with Americanpublishers;their2006visit members ofCLAMPwork;theirwork behind-the-scenes looksathowthe including: adetailedguidetotheirwork; creators mangasuperstars, to international from theirhumblebeginningsasdoujinshi CLAMP inAmericaisahistoryofCLAMP, CLAMP IN AMERICA 13+ •#9781421532271184pgs$11.24 Color book includes72pagesoffull-colormanga. an essentialmanualforanyBleachfan.The columns are reprinted inside,makingthis in great detailandevenpopularhow-to 13 CourtGuard Companiesare covered shadowy worldoftheSoulReapers.All Bootleg takesyoubehindthescenesin Society, ColorBleach+:TheBleachOffi cial An indispensableguidebooktotheSoul THE BLEACH OFFICIALBOOTLEG BOOK 13+ •#9781421520537328pgs$11.24 Kubo. Tite one-shot storyandaninterviewwithcreator poster, bonusmanga,theoriginalBleach volumes 1-21.Italsoincludesanexclusive characters andstorylinesfrom Bleach Contains extensiveinformationonthe SOULS CHARACTER BOOK BLEACH N/R •#9780345505781352pgs$7.46 Vol. 2 N/R •#9780345504272288pgs$7.46 Vol. 1:TheKubikiriCycle is whotheyclaimtobe-andakiller. discover whatisreal andwhatisfake...who does possessabitofgenius:theabilityto island intoshock.Ii-chandiscoversthathe discovery ofagrislymurder sendsthe overmatched intellectually. Butthesudden ANIME &FILM Released 7/20/10 Released 6/22/10 GUIDES to appearinthebackground. Theyalso CLAMP’s otherworks thatalwaysseem including infoonfamouscharacters from Tsubasa spanningthegraphicnovels, characters, worlds,and mysteries of These guidesincludedetailsonthe CHARACTER GUIDES CHRONICLE TSUBASA, RESERVOIR N/R •#9781933330747128pgs$18.95 Color the satiricalTVseriesParanoiaAgent. , ,and entire pantheonofmasterpieces,including the map.Fanswillbethrilledtodiscoverhis Kon’s mind-bendingfi lm Paprikaputhimon premier illusionist.The2007USrelease of Japanese director SatoshiKon,anime’s introduction totheworkandvisionof This colorfulbookprovides acomprehensive ILLUSIONIST SATOSHI KON: THE N/R •#9784770031013248pgs$19.95 simply mustknow. terms thatanyfanofJapanesepopculture geeks, andpop-idolfanboys,withover600 the worldofJapan’s animenerds, game Cool Japan.Thisdefi nitive guideintroduces knowledge ofthefascinatingsubculture of The OtakuEncyclopediaexpandyour friends youcan’t relate to?Thenlet Are youanotaku?Dohaveotaku OTAKU ENCYCLOPEDIA 16+ •#9780345504029208pgs$12.71 and more! new storysetintheworldofGenshiken, Kujibiki Unbalancetradingcards, abrand- Also includesanexclusivefull-colorposter, and howtohuntdownthebestones. (including fi ght gamesandgirlygames) have anime,plusgames,games cosplay bare-skin rulestotheotakumust- virtually everyaspectoftheseries,from The GenshikenOffi cial Book covers OFFICIAL BOOK GENSHIKEN 13+ •#9781427817983224pgs$9.74 Released 5/4/10 material. also includespreviously unpublished the entire 23-volumeseries,thiscollection Takaya-sensei, andvolumerecaps through quizzes, stickers,behind-the-sceneswith with characterprofi les, colorillustrations, know abouttheworldofFruitsBasket!Filled 800.338.6827 books.rightstuf.com N/R •#9781595825049184pgs $26.24 (Color) Hardcover Konietzko andMichaelDante DiMartino. commentary from seriescreators Bryan beyond -alongwithbehind-the-scenes sketch through totheseriesfi nale and show’s development-from theveryfi rst smash-hit series,thisbookchronicles the design, andproduction artbehindthe An unprecedented lookattheconcept, THE ART OFTHEANIMATED SERIES THE LAST AIRBENDER AVATAR: 13+ •#9780345510006224pgs$13.46 beloved series. is yourultimatecompanionpiecetothe and muchmore, theoffi cial xxxHOLiCguide highlights, glossaries,lavishillustrations, story details,creator interviews,fashion the CLAMPuniverse.Filledwithfascinating various connectionstotheotherworksin about thefolklore behindthestoryand morethe thrillingworldofxxxHOLiC!Learn deepinside favorite charactersonajourney Join Yuko, Kimihiro, Domeki,andallyour OFFICIAL GUIDE XXXHOLIC 17+ •#9781595821119240pgs$10.46 Released 4/21/10 exclusive sketchesandinterviews! novels, anextensivedictionary, and Kikuchi andsneakpeeksfrom upcoming Vampire HunterDshortstorybyHideyuki through detailedsummaries.Includesa newsecretsD andlearn aboutthenovels two animatedadventures of Vampire Hunter have afront-row seatatthecreation ofthe inspirations forthememorablestories,you’ll and interviewsthatshedlightonthe rare artworkfromWith Yoshitaka Amano READER’S GUIDE VAMPIRE HUNTERD 15+ •#9780345510013240pgs$13.46 Vol. 2 15+ •#0345494849240pgs$9.71 Vol. 1 sections, pre-production artwork,andmore! include interviews,gamesandquizzes,fan ART BOOKS CLAMP INAMERICA Released 6/2/10

61 BOOKS BOOKS 62 see thedevelopmentoffi rst fourgames games tobepublished.In Dawn youwill inspired thedesignsofFinalFantasy Square Enixhavepermittedtheartwork that For thefi rst timeoutsideJapan,Amanoand FANTASY DAWN: THEWORLDSOFFINAL 13+ •#9781421518848100pgs$14.99 character information. plus anannotatedartguideandextra from volumes 1-19ofthemangaseries, Kubo’s vibrantillustrations,includingart This artbookshowcasescreator Tite See theworldofBleachinablastcolor! THE ART OF BLEACH ALL COLOURBUTTHEBLACK: BLEACH 17+ •#9781595825124160pgs$22.46 (Color) Hardcover by Samura. by GeofDarrow, andatranslatedafterword two extrapagesofartwork,anintroduction also includesanexclusivesectionwiththirty- oversized hardcover collection.Thisedition and chapterbreaks are ondisplayinthis detailed linework,selectedstorypages Hiroaki Samura’s lushcolorpaintings, THE ART OFBLADETHEIMMORTAL BLADE OF THE IMMORTAL AVATAR: THELASTAIRBENDER:ART OFTHEANIMATED SERIES books.rightstuf.com 800.338.6827 Released 6/2/10 PICK SSTAFF P T I A C F K F covers, andpromotional artworkfrom all Packed withcharacterdesigns, game THE ART OFPHOENIXWRIGHT ACE ATTORNEY PHOENIX WRIGHT: N/R •#9781595824561128pgs$9.74 Color stories from theCLAMPartists. duo Puffy AmiYumi!), andevenshortmanga (including aninterviewwithAmioftheJ-pop full ofdrawingsandillustrations,interviews Kimono, afunandlavishlyillustratedbook herself andshares herloveinOkimono kimonoandaccessories traditional Japanesekimono.Infact,she CLAMP artistMokonalovestheartof OKIMONO KIMONO 13+ •#9781897376799200pgs$39.99 Color art pieces. designs, boxart,promo art,andrarely seen this classicseriesandfeatures character showcases 20yearsofartworkfrom Mega Man:Offi cial CompleteWorks OFFICIAL COMPLETEWORKS MEGA MAN N/R •#978142152933282pgs$14.99 two-sided poster. Cross! Includesauthorcommentaryanda artwork from TheGentlemen’s Alliance A collectionofArinaTanemura’s color ILLUSTRATIONS ALLIANCE CROSS GENTLEMEN’S N/R •#9781593078683116pgs$22.46 (Color) Hardcover history-making collaboration. afterword, thegenesisofthis you’lllearn and preliminary sketches.Plus,inaspecial through Amano’s paintings,detailedlineart, N/R •#9784770030658160pgs $25.00 ordering, andmuchmore. that are served,how-toadviceonmenu of sake,cocktailsandother alcoholic drinks and spices,aguidetothemanyvarieties history, profi les ofJapaneseingredients energy ofpubculture. AlsoincludesIzakaya innovative creations thatrefl ect theliving Japanese “comfortfood”menutohighly those oftenfoundonthetraditional standards andspecialtiesrangingfrom quintessential izakayadishes-delicious This bookfeatures detailedrecipes for60 PUB COOKBOOK IZAKAYA:JAPANESE THE ALL •#978193428788096pgs$11.21 Color presentation techniques. recipes and8different packagingand and designs.Includesmore than40gummi customized toyourownparticulartastes own fun,tasty, andchewyconfections Now youtoocanmakeanddesignyour FAMILYTHE WHOLE CHEWY TREATSFOR GUMMI FUN: ALL •#978193428762096pgs$11.21 Veggie Haven ALL •#978193428757696pgs$11.21 Noodle Comfort ALL •#978193428749196pgs$11.21 Donburi Mania ALL •#978193428758396pgs$11.21 Bento Love ALL •#978193428763796pgs$11.21 Appetizer Rex dishes innotime! books willhaveyoucookingdelicious illustrated withfull-colorphotos,these of theaveragedinnerfortwo.Lavishly fi lling meals-allforfarlessthanthecost easy-to-follow instructionsforfl avorful and Each bookprovides over50recipes with COOKING EASY JAPANESE N/R •#9780345510792116pgs$14.96 that willappearonlyinthisbook! plus afi ve-page originalTsubasa manga more thanonehundred pagesofcolorart, deluxe, gorgeouslydesignedbookfeaturing creators intheUnitedStates-here’s a are nowamongthemostpopularmanga prolifi c collectiveoffourfemaleartistswho of thephenomenonknownasCLAMP-a In celebrationofthetwentiethanniversary ALBUM DEREPRODUCTIONS CHRONICLE TSUBASA, RESERVOIR 13+ •#9781897376584320pgs$39.99 Color Fighter IV! Fighter’s pastandfrom the all-newStreet before-published piecesfrom bothStreet and promo artwork,plusmanynever- character designs,conceptart,sketches, artists overthepast20years.Includedare 1,500 illustrationscreated byCapcom’s top The ArtofStreet Fightergathersover SF20: THEART OFSTREETFIGHTER STREET FIGHTER 13+ •#9781897376195240pgs$39.99 Color upstart successor. Ace Attorney, featuringPhoenixWright’s Also includedisartworkfrom ApolloJustice: three PhoenixWright:games. AceAttorney Released 6/8/10 COOKING Avatar: The Last Air Bender Artbook © © 2010 Viacom International, Inc. Avatar: International, TheLastAirBenderArtbook©2010 Viacom peace bydispellinganyaggression through in themartialarts,ultimate promotion of such tenetsas:theimportance ofharmony was basedontheShintoreligion. Itpresents founder’s philosophyandspirituality, which fi rst time, drawsontheessenceofAikido’s This book,translatedintoEnglishforthe TAKEMUSU AIKI THE PHILOSOPHYOF HEART OF AIKIDO: ALL •#1933330015160pgs$9.95 showing!” infoureasyhandmotions. at aloudparty, “Hey!Your underwearis and anime.Finally, awaytotellsomeone streets ofJapan,athome,andinmanga but allare genuineandusedtodayonthe some are practical,andsomeare wacky, promises -wordlessly! Someare deadly, yourself, cross thestreet, andevenmake will helpyouhurlinsults,fl irt, agree, excuse no language”introduces 70gestures that This whimsicallookatJapan’s “languageof 70 JAPANESE GESTURES N/R •#9784770031020128pgs$27.95 Color vegetables andlocalfi sh andmeats. sauce, sakeandnori,emphasizesfresh Arimoto usesbasicingredients suchassoy eaten inacontemporaryJapanesehome. they are forcreating casualdishestypically special ingredients ormultiplesteps.Rather, the homecook,andmostdon’t require miso soup.Therecipes are designedfor vegetables, tofu,deep-friedfoods,riceand divided intoseveralsections:seafood,meat, Yoko Arimotopresents about60recipes THE HEALTHY HOME MODERN COOKINGFOR SIMPLY JAPANESE: N/R •#9784921205072160pgs$14.99 and manyothers! onigiri, yakitori,oshinko,udon,okonomiyaki you seeinallyourfavoritemanga:authentic toidentifyandmakethesamethings Learn ingredients foundineveryWesternkitchen. preparing simpleJapanesedishesusing An illustratedstep-by-stepguideto MANGA COOKBOOK N/R •#978488996260480pgs$18.95 Color calculated sothatthere are noleftovers. and economical,witheachportioncarefully easy tomake,theyare tasty, nutritious take toprepare. Themealsare notjust the componentsaswelltimeitwill seasoning, decoratingandassembling include detailedinstructionsforcooking, and menus.Foreachbox,theauthors Kawaii BentoBoxesoffers dozensofrecipes GO ON THE JAPANESE MEALS CUTE &CONVENIENT KAWAII BENTOBOXES: CULTURE & Released 5/31/10 HISTORY PICK SSTAFF P T I A C F K F N/R •#9781933330525200pgs$16.95 of foreigners, andmuchmore. intonation, apologies,slang,preconceptions polite/rude speech,bowing,disagreeing, chapters, itoutlinestheinsandoutsof Japanese. Nowwithanindexandexpanded be mastered tocommunicateeffectively in into thenonverbalskillzonesthatmust This neweditiontakesthelanguagestudent WORDS JAPANESE BEYOND N/R •#9784770031143144pgs$19.95 Released 7/31/10 self andtheuniverse. such harmony, andthedivinityoftrue Alice’s Adventures inWonderland ©POP(2010). an interesting story line,writingsimplebut Illustrator. Coverstopicssuchascreating can fullycustomizewithPhotoshop and CD offers ahugevarietyoftemplates you manga intooneeasy-to-usepackage.The This bookdistillsalltheelementsofshonen STUDIO SHONEN ART N/R •#9780823014880192pgs$21.99 Chibis how toinventyourveryowndesigns! to “chibify”ordinary mangacharacters,and to drawvirtuallyeverychibioutthere, how stepbystep,how exist. Nowyoucanlearn, more) -withoutthem,mangawouldbarely magical girls,shounen,anthro, sci-fi -, and beloved inallmangagenres (fantasy, Excruciatingly cute,highlystylized,and THE BEGINNER MANGA FOR 13+ •#9780759530706128pgs$8.24 Vol. 2 13+ •#9780759529038144pgs$8.24 Vol. 1 was neverthisfun! the reader someartbasicsaswell.Artclass scattered throughout, thisvolumewillteach along theway. full-colorillustrations With and havesomecutecolorfullifelessons colortheoryandtechnique... as theylearn Follow thelivesoffi ve seniorartstudents DESIGN CLASS GA: GEIJUTSUKA ART N/R •#9780823095339160pgs$21.99 inhabit theshounenstyleofmanga. and themore grittyandgothicanimalsthat funny mascotsthatpopulateshoujomanga This bookfocusesonboththecrittersand CREATURES OTHER ADORABLE ANIMALS, CHIBIS, AND DRAWING MANGA N/R •#9784770031150192pgs$16.95 Released 8/31/10 importantly, whyare theysovery, verycool? schoolgirl developintoabrand?And,most uniform comefrom? HowdidtheJapanese questions as:Where didthesailor-style obsession andanswersuchburning author reveals thetruestorybehindJapan’s actresses, models,writers,andartists,the former andcurrent J-popidols,well-known By talkingtoJapanesewomen,including MADE A NATION COOL HOW TEENAGEGIRLS CONFIDENTIAL: JAPANESE SCHOOLGIRL DRAWING & CRAFTS FOR EVERYDAY USE 250 ESSENTIALKANJI N/R •#9784889962611368pgs $36.95 Vol. 2:BasictoIntermediate N/R •#9784889962215240pgs $24.00 Vol. 1:Levels1&2 shapes forthesamecharacter. similar-looking orolder kanjiandalternative and uniquefeatures suchasidentifying compound words, stroke order, meaning addition, thebookspresent informationon connect theshapesandmeaning.In manga-style illustrationtohelpthestudent each kanjicharacter;thenitshowsa distinct drawingsforthepartsthatform The KanjiinMangalandprogram uses INMANGALAND N/R •#0834802228328pgs$24.95 in universityclasses. has beentestedandrefi ned byyearsofuse either homeorclassroom use,thisbook that are nowineverydayuse.Devisedfor characters, thisbookintroduces thekanji and writethe2,000basicJapanese toreadAn integratedcourseforlearning ESSENTIAL KANJI N/R •#9784770031235224pgs$19.95 Released 7/31/10 presents more thanahundred keyentries. and-adjective combinations.Eachchapter frequently usednoun-and-verbandnoun- is thefi rst resource tointroduce themost o-furo. CommonJapaneseCollocations The verbhairuistheonethatcollocateswith equivalent is“getinabath,”o-furo nihairu. we say, “take abath,”butinJapanesethe than canbeexplainedbychance.InEnglish, occur innaturalspeechmore frequently Collocations are word combinationsthat WORD PAIRINGS A GUIDE TO FREQUENT COLLOCATIONS: COMMON JAPANESE ALL •#9780804840576192pgs$27.95 Workbook ALL •#9780804840569384pgs$49.95 Book +CD maintain thereader’s interest. resources, thisserieswaswrittento pages, andfree web-basedmultimedia adventure storyline,manga-stylestory anengaging the APJapaneseexams.With at thebeginnerlevelandcontinuingthrough focuses onhighschoolstudents,starting series This Japaneselanguagelearning BEGINNING JAPANESE ALL •#9784805309476224pgs$29.95 Vol. 2 ALL •#9784805309469256pgs$26.95 Vol. 1 environments are righthere. Revisededition. and accomplishyourgoalsinthese the toolsyouneedtofeelcomfortable hospitals, anduniversitycampuses.All stations, banks,postoffi ces,restaurants, illustrate situationsinplacesliketrain everyday situations.Twenty-one lessons on thecharactersmostfrequently usedin This introduction toreading kanjiisbased N/R •#9780823033324128pgs$25.99 Book +CD(Color) color covers. black-and-white manga,andimpressive compelling dialogue,creating dynamic MATERIALS LEARNING Released 5/18/10

A SEASONALPORTFOLIO ALL •#9784770030931104pgs$18.00 Color surroundings. devotions, coexistingseamlesslywiththeir as centersforpresent-day religious worship withinare assiduouslymaintained consigned tohistory, theancientplacesof readers willsoonnotethatfarfrom being by three photographers.Turning thepages, shrines -forviewingautumntints,captured locations -predominantly templesand This bookintroduces 49superlativeKyoto AUTUMN COLORSOFKYOTO N/R •#9784770031006320pgs$24.95 Book +CDs aloud inbothEnglishandJapanese. 2 CDscontainingallofthesentencesread and communicationstrategies.Comeswith and specialcolumnsare includedonusage build onwhattheyalready know. Notes to bottom ofeachpage,allowinglearners book, keyvocabularyislistedalongthe and much,muchmore. Throughout the talking abouttheweather, gettingaround, include basicgreetings, self-introductions, presented inbothkanjiandromaji. Topics Features 1,800expressions fordailyusewith PHRASEBOOK ULTIMATE JAPANESE Released 8/31/10 TRAVEL PICK SSTAFF P T I ALICE’S ADVENTURES INWONDERLAND A C F K F 800.338.6827 books.rightstuf.com N/R •#9781934159057275pgs$21.95 Color for thepassionatetraveler. To Loveisaone-of-a-kindguide JapanWith dining, shopping,sightseeing,andculture, itsuniqueinsightsinto inspired locals.With expatriates, seasonedtravelers,and Hiroshima, discoverthesecrets ofsavvy at Todaiji Temple tofi Fromnding peacein crawlingthrough Buddha’s nose THE CONNOISSEUR A TRAVEL GUIDEFOR TO JAPAN WITH LOVE: ALL •#978489684457396pgs$9.95 a guidetosigns,andwhere togoforhelp. Also includedare usefulwords andphrases, railway, Yokohama, andairportconnections. and full-colormapsthatincludenational passes; alandmarkfi nder; anexitfi on ticketing,touristfares,nder; andcommuter thirteen Tokyo subwaylines;information Included are color-coded diagramsofall but complicatedTokyo subwaysystem. readers confi dently navigatetheconvenient This handybookisdesignedtohelp SUBWAY GUIDEBOOK LITTLE TOKYO ALL •#9784770030948104pgs$18.00 Color made documentingitsbeautytheirlifework. captured bythree photographerswhohave superlative cherryblossomviewinglocations since earliesttimes.Thisbookfeatures 48 a specialplaceintheheartsofJapanese spectacle, thecherryblossomhasoccupied color. Despitethefl eeting nature ofthe suffusing thesurrounding landscapewith glory from lateMarch through earlyApril, Cherry trees fl ower inariotousblazeof CHERRY BLOSSOMSOFKYOTO

63 BOOKS WALL ART 64 Beach Asuna,Konoka, Wall Scroll (31”x43”): Wall Scroll (31” x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): #GE5292WS #GE5324WS #GE5245WS #GE9925WS #GE9688WS Naruto: Shippuden Statsuna &Makie Belldandy &Bike Ah! MyGoddess Misa &Light Death Note Soul Eater art.rightstuf.com 800.338.6827 art.rightstuf.com Negima Deidara Group $14.96 $14.96 $14.96 $14.96 $14.96 Wall Scroll (31” x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Strawhat PiratesFlag #GE5293WS #GE5318WS #GE5216WS #GE5257WS #GE9927WS Naruto: Shippuden Belldandy &Earth Ah! MyGoddess Dragon BallZ Maka &Soul Soul Eater Z Warriors One Piece Kakashi $14.96 $14.96 $14.96 $14.96 $14.96 Those NightshineChimes Naruto &FourthHokage Wall Scroll (31” x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): #GE5309WS #GE5321WS #GE9975WS #GE5209WS Lithograph (20”x16”): #RSM8097 Naruto: Shippuden Aria theNatural Exia &Setsuna Limited Edition Gundam 00 Playground Soul Eater Sgt. Frog Group $37.49 $14.96 $14.96 $14.96 $14.96 Red BackgroundGroup Naruto’s Homecoming Wall Scroll (31” x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): #GE9745WS #GE5325WS #GE5310WS #GE5238WS #GE5296WS Naruto: Shippuden Waiting attheCar Keroro Flying Gundam 00 Soul Eater Black Cat Sumeragi Sgt. Frog $14.96 $14.96 $14.96 $14.96 $14.96 Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): #GE5311WS #GE5241WS #GE5303WS Lithograph (16”x20”): Lithograph (16”x20”): #FUN01060 #RSM8096 Naruto: Shippuden Nana K&Nobu (Autographed) Limited Edition Limited Edition Limited Edition Rasengan Sgt. Frog Clannad Platoon Nana $37.49 $44.99 $14.96 $14.96 $14.96 Wall Scroll (31”x43”): Wall Scroll (31” x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): #GE5226WS #GE9818WS #GE5302WS #GE5328WS #GE5261WS Naruto: Shippuden Clare intheForest Syaoran &Sakura Clow Kingdom Nana O&Ren Team Kakashi Soul Eater Claymore Tsubasa Nana Girls $14.96 $14.96 $14.96 $14.96 $14.96 Wall Scroll (31” x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): Wall Scroll (31”x43”): #GE9689WS #GE5319WS #GE9931WS #GE9956WS #GE9821WS Konoka &Nodaka Uchiha Brothers Beach Asuna, Death Note Wallfl Soul Eater Negima Sunako Naruto Group Mello ower $14.96 $14.96 $14.96 $14.96 $14.96 X #COMGBX XL #COMGBL L #COMGBM M #SHIRTTORA1X XL #SHIRTTORA1L L #SHIRTTORA1M M #SHIRTTORA1S S #AWTST1016 XL S #COMGBS S XXL#5538XX #5538X XL #5538L L #5538M M #5538S S Girl’s Fitted Otaku ShopforDojin Akari attheBeach #GE2561 Toradora Parody Towel: T-shirt (White): T-shirt (White): T-shirt (Black): Meers Guitar Genshiken 2 Code Geass Japanese Aria T-shirt (Black) Suzaku $19.98 $23.99 $23.99 $23.99 $23.99 $15.16 $15.16 $15.16 $15.16 $13.56 $14.99 $13.49 $13.49 $13.49 $13.49 X #COMGKX XL #COMGKL L #COMGKM M XXL#SHIRTTSUN1XX #SHIRTTSUN1X XL #SHIRTTSUN1L L #SHIRTTSUN1M M #SHIRTTSUN1S S XXL#GE82025 #GE82024 XL #GE82023 L #GE82022 M #GE82021 S S #COMGKS S XXL#5544XX #5544X XL #5544L L #5544M M #5544S S XXL#5537XX #5537X XL #5537L L #5537M M #5537S S Girl’s Fitted Stand AloneComplex T-shirt: Ghost intheShell: Crane Inspiration T-shirt (Charcoal) Tribute T-shirt (White): T-shirt (Black): President Aria Meers Guitar Japanese Laughing Man T-shirt (KiwiGreen) Aria $23.99 $23.99 $23.99 $23.99 $15.96 $15.16 $15.16 $15.16 $15.16 $14.39 $12.79 $12.79 $12.79 $12.79 $14.99 $13.99 $13.99 $13.99 $13.99 $14.99 $13.49 $13.49 $13.49 $13.49 XXL#GE86465 #GE86464 XL #GE86463 L #GE86462 M #GE86461 S #SHIRTDOG1X XL #SHIRTDOG1L L #SHIRTDOG1M M #SHIRTDOG1S S XXL#5525XX #5525X XL #5525L L #5525M M #5525S S XXL#5545XX #5545X XL #5545L L #5545M M #5545S S Melancholy ofHaruhiSuzumiya Japanese SoulDog T-shirt (LightBlue) Crane Inspiration #GE2247 T-shirt (Khaki): T-shirt: T-shirt (Grey): Hat: Shuichi &Eiri Gravitation Japanese Bleach Kisuke’s Haruhi $13.49 $14.39 $12.79 $12.79 $12.79 $12.79 $15.16 $15.16 $15.16 $15.16 $14.24 $12.74 $12.74 $12.74 $12.74 $14.99 $13.99 $13.99 $13.99 $13.99 X #SHIRTTEATIME1X XL #SHIRTTEATIME1L L #SHIRTTEATIME1M M #SHIRTTEATIME1S S XXL#5535XX #5535X XL #5535L L #5535M M #5535S S L #BHAS1149L L X #GE86074 XL #GE86073 L #GE86072 M #GE86071 S #705105487137 XL #705105487038 L #705105486932 M #705105486833 S XXL#BHAS1149XX #BHAS1149X XL #BHAS1149M M #BHAS1149S S Melancholy ofHaruhiSuzumiya Girl’s FittedT-shirt (Pink): Shuichi &EiriwithLogo Afterschool Tea Time T-shirt (Black): T-shirt (LightBlue): T-shirt (White): T-shirt (Black): Ichigo Hollow Crazyheads Cat onBike Gravitation Japanese Bleach SOS $15.16 $15.16 $15.16 $15.16 $14.24 $12.74 $12.74 $12.74 $12.74 $12.79 $12.79 $12.79 $12.79 $18.40 $18.40 $18.40 $18.40 $15.19 $13.56 $13.56 $13.56 $13.56

XXL #SHIRTHUMANS1XX XXL#SHIRTHUMANS1XX #SHIRTHUMANS1X XL #SHIRTHUMANS1L L #SHIRTHUMANS1M M #SHIRTHUMANS1S S S #COLCBS S XXL#5540XX #5540X XL #5540L L #5540M M #5540S S #COLCBX XL #COLCBL L #COLCBM M M #BHAS1142M M XXL#705105486239 #705105486130 XL #705105486031 L #705105485935 M #705105485836 S XXL#BHAS1142XX #BHAS1142X XL #BHAS1142L L #BHAS1142S S Melancholy ofHaruhiSuzumiya T-shirt (Navy): Girl’s Fitted Girl’s Fitted Ichigo Black&White No NormalHumans T-shirt (Black): T-shirt (White): Crazyheads Classic Cat Lolita Cats 800.338.6827 apparel.rightstuf.com Japanese Bleach T-shirt (White): T-shirt (Black) Cheerleaders $14.99 $13.49 $13.49 $13.49 $13.49 $23.99 $23.99 $23.99 $23.99 $18.40 $18.40 $18.40 $18.40 $18.40 $15.19 $13.56 $13.56 $13.56 $13.56 $15.96 $15.16 $15.16 $15.16 $15.16

XL #SHIRTSKIRT1X #SHIRTSKIRT1X XL #SHIRTSKIRT1L L #SHIRTSKIRT1M M #SHIRTSKIRT1S S XXL#5541XX #5541X XL #5541L L #5541M M #5541S S Melancholy ofHaruhiSuzumiya Patch: Military Cap: T-shirt (Red): The AbsoluteZone #GE2315 #GE8297 #GE4449 Wristband: Goku’s Symbol Large T-shirt (Black): Dragon BallZ Code Geass Lucky Star Japanese Black Knights Bunny Girls $13.49 $3.15 $9.99 Icon $15.16 $15.16 $15.16 $15.16 $14.99 $13.49 $13.49 $13.49 $13.49

65 APPAREL APPAREL S #COPBBS S 66 #COPBBX XL #COPBBL L #COPBBM M #GE88092 XL #GE88091 S XXL#NSAS1033XX #NSAS1033X XL #NSAS1033L L #NSAS1033M M #NSAS1033S S XXL#5521XX #5521X XL #5521L L #5521M M #5521S S X #GE88444 XL #GE88443 L #GE88442 M #GE88441 S Akatsuki CloakStandardVersion Melancholy ofHaruhiSuzumiya T-shirt (Black): Girl’s Fitted Costume: T-shirt (White): Naruto: Shippuden Naruto: Shippuden apparel.rightstuf.com 800.338.6827 Pandy Bass One Piece Costume: T-shirt (Black) Luffy’s Vest Itachi Symbols Haruhi $23.99 $23.99 $23.99 $23.99 $26.99 $26.99 $15.19 $13.56 $13.56 $13.56 $13.56 $57.59 $57.59 $57.59 $57.59 $14.99 $13.49 $13.49 $13.49 $13.49 X #CORPBX XL #CORPBL L #CORPBM M XXL#NSAS1009XX #NSAS1009X XL #NSAS1009L L #NSAS1009M M #NSAS1009S S S #CORPBS S XXL#5542XX #5542X XL #5542L L #5542M M #5542S S Melancholy ofHaruhiSuzumiya Headband: T-shirt (White): Girl’s Fitted T-shirt (Black): Naruto: Shippuden Naruto: Shippuden #GE8749 #GE2556 Towel: Ramen Power One Piece Anti Waterfall Village Chopper T-shirt (Black) Haruhi Pose $19.98 $15.39 Kakashi $15.19 $13.56 $13.56 $13.56 $13.56 $23.99 $23.99 $23.99 $23.99 $14.99 $13.49 $13.49 $13.49 $13.49 X #CORLBX XL #CORLBL L #CORLBM M XXL#NSAS1011XX #NSAS1011X XL #NSAS1011L L #NSAS1011M M #NSAS1011S S S #CORLBS S Headband: Girl’s Fitted Leather Wristband: T-shirt (Black): Naruto: Shippuden Naruto: Shippuden #GE8676 #GE6130 #GE6141 Wristband: Ramune Love One Piece Naruto LeafVillage Nana T-shirt (Black) $15.39 $3.15 $4.89 Sanji Sasuke Blast $23.99 $23.99 $23.99 $23.99 $15.19 $13.56 $13.56 $13.56 $13.56 XXL#NSAS1068XX #NSAS1068X XL #NSAS1068L L #NSAS1068M M #NSAS1068S S X #CORLTX XL #CORLTL L #CORLTM M #5529L L #5529M M #5529S S XXL#5529XX #5529X XL S #CORLTS S Leather Wristband: T-shirt (Navy): Leather Wristband: Naruto: Shippuden Naruto: Shippuden Girl’s Fitted Otaku Collegiate #GE6137 #GE8713 (Turquoise Blue) Ramune Love T-shirt (Navy) Nana Sasuke Curse $4.89 $9.74 T-shirt Naruto Spiral Lotus $23.99 $23.99 $23.99 $23.99 $14.24 $12.74 $12.74 $12.74 $12.74 $15.19 $13.56 $13.56 $13.56 $13.56

XXL#NSAS1079XX #NSAS1079X XL #NSAS1079L L #NSAS1079M M #NSAS1079S S T-shirt (White): Ouran HighSchoolHostClub Beanie Cap: Ski MaskBeanieCap: Towel: Naruto: Shippuden Naruto: Shippuden Naruto: Shippuden Wristband: #GE2557 #GE2351 #GE2316 #GE6153 Sgt. Frog School Logo Akatsuki Clouds Naruto Shinobi $19.98 $13.49 $13.49 Dororo $3.15 Hidan $15.19 $13.56 $13.56 $13.56 $13.56 XXL#5536XX #5536X XL #5536L L #5536M M #5536S S XXL#NSAS1018XX #NSAS1018X XL #NSAS1018L L #NSAS1018M M #NSAS1018S S Ouran HighSchoolHostClub Beanie Cap: Wristband: Akatsuki RisingSun Naruto: Shippuden Naruto: Shippuden Wristband: #GE2324 #GE8626 #GE6149 Ninja Crossing T-shirt (Black): T-shirt (Black) Sgt. Frog Clouds &Forest Beelzenef $13.49 Keroro $3.15 $3.15 $14.99 $13.49 $13.49 $13.49 $13.49 $15.19 $13.56 $13.56 $13.56 $13.56 XXL#GE82015 #GE82014 XL #GE82013 L #GE82012 M #GE82011 S X #GE88084 XL #GE88083 L #GE88082 M #GE88081 S Hoodie Jacket: Towel: Wristband: Wristband: #GE2570 #GE6170 #GE6150 T-shirt: Black StarTsubaki Soul Eater Soul Eater Soul Eater Sgt. Frog Tsubasa Wings Tamama $19.98 Mouth $3.15 $3.15 Shinigami $14.39 $12.79 $12.79 $12.79 $12.79 $38.39 $38.39 $38.39 $38.39 X #VKJS1005X XL #VKJS1005L L #VKJS1005M M #VKJS1005S S Girl’s FittedT-shirt (Black): PVC LeatherWristband: Baseball Cap: #GE2357 #GE2569 #GE6172 #GE6211 Wristband: Vampire Knight Towel: Yuki Cross Soul Eater Soul Eater Soul Eater Soul Eater No Future Group $19.98 $13.49 $3.15 $4.89 Patti Tsubaki $14.36 $14.36 $14.36 $14.36 X #VKJS1008X XL #VKJS1008L L #VKJS1008M M #VKJS1008S S Girl’s Fitted Wristband: Zero: Vampire Hunter Beanie Cap: #GE2364 #GE2571 #GE6208 #GE6210 Wristband: Vampire Knight Towel: Soul Eater Soul Eater Soul Eater Soul Eater T-shirt (Red): Skulls Black Star $19.98 $13.49 $3.15 $3.15 Skull Logo $14.36 $14.36 $14.36 $14.36 X #VKJS1006X XL #VKJS1006L L #VKJS1006M M #VKJS1006S S XXL#5543XX #5543X XL #5543L L #5543M M #5543S S Girl’s Fitted Wristband: Sounds oftheSamurai Beanie Cap: #GE2365 #GE6205 #GE6171 Wristband: Vampire Knight T-shirt (Green) Soul Eater Soul Eater Soul Eater Rose T-shirt (White): Death theKid $13.49 Medusa $3.15 $3.15 Soul $14.36 $14.36 $14.36 $14.36 $14.99 $13.49 $13.49 $13.49 $13.49 S #COTYBS S X #VKJS1002X XL #VKJS1002L L #VKJS1002M M #VKJS1002S S #COTYBX XL #COTYBL L #COTYBM M L #GE88373 L #GE88372 M #GE88371 S Costume: Girl’s FittedT-shirt (White): Girl’s Fitted Yuki, Zero&Kaname Wristband: #GE6209 #GE6173 Vampire Knight Teacup Yorkie Wristband: 800.338.6827 apparel.rightstuf.com Soul Eater Soul Eater Soul Eater Death theKidBlazer T-shirt (Black) Tsubaki $3.15 $3.15 Liz $14.36 $14.36 $14.36 $14.36 $23.99 $23.99 $23.99 $23.99 $57.59 $57.59 $57.59 S #COTYKS S X #VKAS1005X XL #VKAS1005L L #VKAS1005M M #VKAS1005S S #COTYKX XL #COTYKL L #COTYKM M L #GE88333 L #GE88332 M #GE88331 S Ski MaskBeanieCap: Girl’s Fitted Hoodie Jacket: Zero: Vampire Hunter #GE2358 Wristband: #GE6169 Vampire Knight Teacup Yorkie T-shirt (Red): Soul Eater Soul Eater Soul Eater T-shirt (KiwiGreen) $13.49 $3.15 Logo Medusa Shinigami $13.56 $13.56 $13.56 $13.56 $23.99 $23.99 $23.99 $23.99 $38.39 $38.39 $38.39

67 APPAREL BAGS 68 Messenger Bag: #705105487731 Coin Purse(Black): Messenger Bag: Naruto: Shippuden Ouran HighSchool #GE5596 #GE5624 #GE5581 #GE5577 #GE2425 Wallet: Ah! MyGoddess Messenger Bag: Hunny’s Rabbit Gurren Lagann Crazyheads Plush Bag: Soul Eater Belldandy Host Club bags.rightstuf.com 800.338.6827 Yoko Skull $29.98 $29.98 $22.49 $29.98 $13.49 Kakashi $15.00 Blair Cat #705105487632 Messenger Bag: Long Wallet (Black): Naruto: Shippuden Ouran HighSchool #GE5568 #GE5528 #GE3081 #GE5620 #GE5562 Wallet: Messenger Bag: Death theKid Crazyheads Bag: Lucky Star Soul Eater Host Club Bag: Bleach Beelzenef Ichigo Cat $29.98 $13.49 $15.39 $29.98 $29.98 Naruto $22.50 Cat Messenger Bag: Naruto ShadowClones Messenger Bag: Messenger Bag: Naruto: Shippuden #GE5544 #GE5619 #GE5539 #GE5601 #GE5488 #GE5623 Messenger Bag: Dragon BallZ Bag: Bag: Soul Eater Sgt. Fro Bleach Nana Nana O. Rukia $29.98 $29.98 $29.98 $29.98 $29.98 $29.98 Trunks Giroro Skulls Messenger Bag: Messenger Bag: Naruto: Shippuden #GE2435 #GE5591 #GE5602 #GE3041 #GE5617 Wallet: Coin Purse: Keroro’s Platoon Messenger Bag: #GE7784 Dragon BallZ Wallet: Soul Eater Sgt. Frog Bleach Naruto Black Star Goku $13.49 $29.98 $29.98 $13.49 $29.98 $8.99 Frog Sakura Crew Plush CellPhoneHolder: Hobo Bag: Naruto: Shippuden Naruto: Shippuden Wallet: #GE2438 #GE6144 #GE2434 #GE5649 #GE5504 #GE5469 Messenger Bag: Messenger Bag: Fourth Hokage Fruits Basket Ichigo Streak Wallet: Soul Eater Sgt. Frog Pakkun Bleach Afro Keroro Blair Kyo Cat $13.49 $11.24 $13.49 $29.98 $29.98 $22.49 Messenger Bag: Messenger Bag: Messenger Bag: Wallet: Naruto: Shippuden Naruto: Shippuden #GE5548 #GE5570 #GE3044 #GE2415 #GE2436 #GE5600 Gunslinger Girl Wallet: Wallet: Soul Eater Sgt. Frog Bleach Maka &Soul Keroro Leaf $29.98 $29.98 $13.49 $13.49 $13.49 $29.98 Henrietta Gaara Renji Messenger Bag: Bag: Wallet: Naruto: Shippuden Naruto: Shippuden #GE5579 #GE3063 #GE3064 #GE2410 #GE5497 #GE5575 Wallet: Gurren Lagann Wallet: Clare Distressed Soul Eater Claymore Bag: Slayers Naruto Spiral Shinigami Lina Skull $29.98 $13.49 $13.49 $13.49 $13.49 $29.98 Itachi #GE4859KC #GE4619KC #GE4748KC Cell PhoneCharm: Gundams &Logos #GE8537 #GE8672 Plush Keychain: Metal Keychain: Metal Keychain: Gurren Lagann Gaara’s Gourd Magnet Set: Gundam 00 Death Note Core Drill Gin SD Bleach Naruto Skull $5.99 $5.24 $5.24 $5.24 $5.24 #GE4695KC #GE4785KC #GE4647KC #GE4773KC #GE8548 Plush Keychain: Metal Keychain: Metal Keychain: Gurren Lagann Light, L&Ryuk Haro &Logo Magnet Set: Gundam 00 Death Note Keychain: Ichigo SD Yoko SD Bleach Sakura Naruto $5.99 $5.24 $3.74 $5.24 $5.24 Plush CellPhoneCharm: #GE4787KC #GE3827KC #GE4816KC Junjo Romantica #GE8640 #GE8277 Plush Keychain: Metal Keychain: Celestial Being Dragon BallZ Gundam 00 Dragon Ball Necklace: Keychain: Kon SD Sasuke Bleach Naruto Ducks $8.99 $5.24 $3.74 $5.24 $5.24 #761568168075 #GE4751KC #GE4786KC #GE4817KC Naruto: Shippuden Junjo Romantica iPhone Gelaskin: The Swordsman #GE8641 Metal Keychain: Light Keychain: Union Symbol Final Fantasy Gundam 00 Suzuki-san Necklace: Keychain: Renji SD Bleach Gaara $8.98 $5.24 $3.74 $5.24 $14.95 Keychain: #GE4602KC #GE4739KC Naruto: Shippuden Kakashi Sharingan Haruhi Suzumiya #GE8674 #GE8316 #GE6236 Light Keychain: Gurren Lagann Melancholy of Hyourinmaru Gundam 00 Necklace: Hair Clip: Bracelet: Bleach Yoko’s Haro Haruhi Keycap $8.99 $7.49 $8.99 $5.24 $5.24 800.338.6827 merchandise.rightstuf.com #GE4649KC Naruto: Shippuden Cell PhoneCharm: #GE8638 #GE6132 #GE8549 #GE6237 Gurren Lagann Celestial Being Shihouin Mark Gundam 00 Magnet Set Kamina SD Guitar Pick Necklace: Keychain: Bracelet: Bleach Nana $5.24 $8.99 $5.99 $8.99 $3.74 Hidan’s AkatsukiRing #GE4651KC #GE4858KC Naruto: Shippuden Cell PhoneCharm: #GE8639 #GE8203 #GE8693 Metal Keychain: Gurren Lagann Castlevania Gundam 00 Necklace: Necklace: Keychain: Yoko SD Cross Union Lotus Nana $5.24 $8.99 $8.99 $3.74 $5.24

69 MERCHANDISE MERCHANDISE 70 Haruhi BoysUniform #GE4825KC #GE3893KC #GE4670KC Naruto: Shippuden Ouran HighSchool Cell PhoneCharm: Cell PhoneCharm: Luffy’s JollyRoger #GE8264 #GE8190 Metal Keychain: Metal Keychain: One Piece Jiraiya SD Host Club Keychain: Sgt. Frog Sgt. Frog Tamama merchandise.rightstuf.com 800.338.6827 Giroro $5.24 $5.24 $5.24 $5.24 $5.24 Dog Tag &SpiralSymbol Metal Keychain: #GE4774KC #GE4802KC #GE4693KC Naruto: Shippuden Ouran HighSchool Cell PhoneCharm: #GE6198 #GE6155 Giroro’s Symbol Jolly Roger One Piece Necklace: Host Club Keychain: Keychain: Sgt. Frog Sgt. Frog Keroro Hunny $5.24 $8.98 $5.24 $3.74 $5.24 Naruto

Sasori’s AkatsukiRing #GE4903KC #GE4898KC #GE4694KC Naruto: Shippuden Ouran HighSchool Cell PhoneCharm: #GE8263 #GE6157 Tamama Novice Chopper &Map Metal Keychain: Metal Keychain: One Piece Necklace: Host Club Keychain: Sgt. Frog Sgt. Frog Keroro Kaoru $5.24 $8.99 $5.24 $5.24 $5.24 #GE4700KC #GE4902KC #GE4713KC #GE4585KC Naruto: Shippuden Ouran HighSchool #GE6696 Metal Keychain: Metal Keychain: Metal Keychain: Giroro &Dororo Dororo &Kululu School Logo Luffy &Map One Piece Host Club Keychain: Sgt. Frog Sgt. Frog Pin Set: Sasuke $4.49 $5.24 $5.24 $5.24 $5.24 #GE4584KC Naruto: Shippuden Ouran HighSchool Ouran HighSchool Cell PhoneCharm: Keroro &Tamama #GE8356 #GE8675 #GE6695 #GE6248 Keroro &Giroro School Logo Necklace: Host Club Host Club Keychain: Sgt. Frog Sgt. Frog Pin Set: Kakashi Haruhi Mug: $11.24 $5.24 $4.49 $8.99 $5.24 Mug: #GE4586KC #GE2024PC Naruto: Shippuden Ouran HighSchool Ouran HighSchool Cell PhoneCharm: Keroro &Tamama #GE8347 #GE8666 #GE7357 Playing Cards Pin: Sasuke SD Team Kakashi& Host Club Host Club Keychain: Sgt. Frog Sgt. Frog Kaoru Keroro $11.24 $5.24 $4.49 $6.99 $5.24 Metal CellPhoneStrap: Skull &Crossbones Ouran HighSchool Cell PhoneCharm: Cell PhoneStrap: #GE6194 #GE6200 #GE8667 #GE8798 #GE8617 Brooch: Group &Crest Soul Eater One Piece Necklace: Host Club Robotech Sgt. Frog Tamama Luffy SD Blair’s $11.24 $5.24 $5.24 $5.24 $8.99 #GE4833KC #GE4839KC Maka &SoulKishin Cell PhoneCharm: Cell PhoneStrap: #GE6192 #GE6167 #GE6196 Metal Keychain: Death theKid Soul Eater Soul Eater Soul Eater Soul Eater Soul Eater Black Star Necklace: Keychain: Soul SD Mouth $5.24 $5.24 $8.99 $5.24 $3.74 Blair’s Pumpkins&Kishin #GE4829KC #GE4850KC #GE4826KC Cell PhoneCharm: #GE6204 #GE7910 Metal Keychain: Maka &Soul Soul Eater Soul Eater Soul Eater Soul Eater Soul Eater Necklace: Keychain: Keychain: Maka Stein Skull $8.99 $5.24 $3.74 $5.24 $5.24 Shinigami Snowfl ake Black Star&Tsubaki #GE4835KC #GE4853KC #GE4834KC Cell PhoneCharm: #GE6706 #GE6244 Metal Keychain: Black StarSD Tsubaki SD Soul Eater Soul Eater Soul Eater Soul Eater Soul Eater Keychain: Keychain: Pin Set: Soul $4.49 $5.24 $3.74 $5.24 $3.74 Death theKid&Guns Death theKid&Skull #GE4831KC #GE4852KC Cell PhoneCharm: #GE6712 #GE7911 #GE8853 Metal Keychain: Magnet Set: Soul Eater Soul Eater Soul Eater Soul Eater Soul Eater Keychain: Pin Set:

Stein Crew Soul $4.49 $5.24 $5.99 $5.24 $5.24 & TheThompsonSisters Keychain: Black Star&Tsubaki #GE4827KC #GE4828KC Cell PhoneCharm: #GE6247 #GE6705 #GE6249 Metal Necklace: Metal Keychain: Soul &Maka Soul Eater Soul Eater Soul Eater Soul Eater Soul Eater Pin Set: Tsubaki Logo Death theKid $8.99 $4.49 $5.24 $5.24 $6.99 800.338.6827 merchandise.rightstuf.com Cell PhoneStrap: Star &Tsubaki Kishin #GE4838KC #GE4832KC Thompson Sisters #GE8361 #GE6711 #GE6191 Metal Keychain: Mug: Soul Eater Soul Eater Soul Eater Soul Eater Soul Eater Black Star Keychain: Maka SD Pin Set: Skull $11.24 $4.49 $5.24 $3.74 $5.24 Black the Kid,Liz&PattiKishin #761568168068 Cell PhoneStrap: #GE4830KC #GE4846KC Vampire HunterD #GE6193 #GE6163 iPhone Gelaskin Metal Keychain: Soul Eater Soul Eater Soul Eater Soul Eater Black Star Necklace: Keychain: Cat Blair Skull $5.24 $8.99 $3.74 $5.24 $14.95 Death

71 MERCHANDISE PLUSH 72 Body Pillow(13.5”x42”): Belldandy MotorcycleGirl Plush: Kon ArmStickingOut Sonic theHedgehog Plush (20”): Plush (9”): #GE2854 #GE7099 Ah! MyGoddess #GE7091 #GE6996 #GE7035 Gurren Lagann Plush (8.5”): Boota Standing plush.rightstuf.com 800.338.6827 Bleach Naruto Naruto $29.99 $22.49 $7.49 $9.74 $9.74 Sonic Body Pillow(13.5”x42”): Body Pillow(13.5”x42”): Plush (9”): Belldandy Swimsuit Rukia Yellow Dress Plush (8”): #GE2855 #GE2863 Ah! MyGoddess #GE7033 #GE7041 #GE6055 Soul Eater Plush (8”): Inu Yasha Bleach Naruto

Maka Sesshomaru Sakura $29.99 $29.99 $9.74 $9.74 $9.74 Body Pillow(13.5”x42”): Body Pillow(13.5”x42”): Body Pillow(13.5”x42”): Plush (10”): Naruto: Shippuden Plush (9”): #GE2829 #GE2831 #GE2856 #GE7017 #GE8900 Haruhi Suzumiya Ah! MyGoddess Melancholy of Melancholy of Code Geass Tsubasa Haruhi C.C.

Urd Mokona Naruto $29.99 $29.99 $29.99 $13.99 $11.24 Naruto: Shippuden Sakaki FeedingCat Body Pillow: #GE2839 #GE2847 #GE8902 #GE7067 Azumanga Daioh Plush (9”): Plush (9”): #GE7036 Body Pillow: Gurren Lagann xxxHOLiC Plush (7:): Naruto $29.99 $29.99 $11.24 $11.24 Gaara Gaara $9.74 Yuko Nia Body Pillow: Pillow: Plush (8”): #GE2846 #GE2838 #GE8913 Plush (8”): #GE7013 #GE7025 Plush (8”): Gurren Lagann Black Cat xxxHOLiC Negima Mokona Black Naruto Older Yoko Nodoka $29.99 $14.24 $11.24 Hinata $9.74 $9.74 Train

Plush (5”): Mini Plush(4”): Plush (10”): Plush (8”): Body Pillow: #GE2842 #GE7096 #GE7055 #GE7037 #GE8934 Gurren Lagann One Piece xxxHOLiC Bleach Naruto Mokona Black Chopper $29.99 $11.24 Kakashi $8.99 $9.74 $7.49 Kurodo Yoko Plush (10”): Mini Plush(4”): Ouran HighSchool #GE8914 #GE7097 #GE8937 Plush (5”): #GE8933 #GE7087 Hunny’s Rabbit Plush (9”): Gurren Lagann Plush (20”): Host Club xxxHOLiC Bleach Naruto Mokona Black $11.24 $22.49 $17.99 Boota $7.49 $7.49 Kiba Lirin Critical Mass Video DVD! Get specialoffers andmore couponsforonlineorders by of thefollowingDVDs! Got AnimeSavingsClub!(Seepage6formore details.) and ourdailydealsat: order of$60ormore! Buy more than4itemsayear?Checkintoadditional RIGHT STUFSUPERCOUPON RIGHT STUFSUPERCOUPON RIGHT STUFSUPERCOUPON RIGHT STUFSUPERCOUPON RIGHT STUFSUPERCOUPON Legends oftheDarkKing (#SFLDK100) Ghost Hound(#SFGH100, #SFGH200) Tears to Tiara (#SFTT100,#SFTT200) FMA Brotherhood savings onEVERY itemyouorder byjoiningour Get $5.00off ANY Get $4.00off ANY Get $5.00off ANY Get $5.00off ANY Blu-ray orDVD! signing upforourspecialweeklynewsletter Soul EaterDVD! LOOKING FOREVEN Nozomi Ent.or Part 1or2on Get $5.00off This couponmayonlybeusedone timepercustomer. Expires 10/15/10. This couponmayonlybeusedonetimepercustomer. Expires 10/15/10. This couponmayonlybeusedonetimepercustomer. Expires 10/15/10. This couponmayonlybeusedonetimepercustomer. Expires 10/15/10. This couponmayonlybeusedonetimepercustomer. Expires 10/15/10. Blue Drop(#SFBD100) MORE SAVINGS? (see page12) (see page21) http://www.rightstuf.com/free $ $ $ $ $ 5 5 5 5 4 OOFF OOFF OOFF OOFF OOFF . . . . . ooo ooo ooo ooo ooo F F F F F F F F F F o o o o o #: W26-05 #: W26-04 #: W26-03 #: W26-02 #: W26-01 LOOKING FOR EVEN Billing Address Shipping Address (If paying by credit card, this address must match your credit card billing information.) (International customers must ship to their billing address. If using a credit card, MORE SAVINGS? we may contact you for additional information before your order will ship.)

Get special offers and more coupons for online orders by Name: Name: signing up for our special weekly newsletter and our daily deals at: http://www.rightstuf.com/free Company: Company: Buy more than 4 items a year? Check into additional savings on EVERY item you order by joining our Got Anime Savings Club! (See page 6 for more details.) Address: Address: (Suite/Apt #) (Suite/Apt #)

City: State/Prov: Zip: City: State/Prov: Zip:

This coupon is redeemable by mail or online at: www.rightstuf.com To redeem online, simply enter the Coupon Code listed on the upper right corner of the front of this coupon into the Country: Phone: ( ) Country: Phone: ( ) “Coupon Code” box during your online check out.

To redeem by mail, cut this coupon out, enter the discount amount in the “Coupon Discount” box on the order form, and attach the coupon to your order form. Email: Whether ordering online or by mail, only one coupon may be used per order. GIFT CERTIFICATES (Please provide an email address or daytime phone number in case we have questions about your order.) This coupon may be used only once per customer. Canceling or revising an order may affect eligibility for the coupon. Now available in any whole dollar amount from $5 on up! Just add the item * number “GIFT CERTIFICATE” on this order form and write in the amount Photocopies or other reproductions of this coupon will not be accepted. Items already heavily discounted (weekly specials, Got Anime Member?  Yes  No you’d like to give. Don’t forget to fill in the quantity! NOTE: Shipping charges bargain bin items, closeout items, and specialty imports items) are excluded from coupon discounts. Orders which do not *Remember: Your Got Anime membership is tied to your billing address. do not apply to gift certificates, Got Anime memberships or catalogs. fulfi ll the terms of the coupon will be returned or accepted with request for additional payment, at our option.

If you have any questions about the use of this coupon, please email at [email protected], or call us at 1-800-338-6827. ITEM# TITLE/DESCRIPTION (SIZE? COLOR?) PRICE QTY. TOTAL

Save Money! Add a Got Anime Savings Club Membership This coupon is redeemable by mail or online at: www.rightstuf.com (See page 6 for more details.) To redeem online, simply enter the Coupon Code listed on the upper right corner of the front of this coupon into the “Coupon Code” box during your online check out.

To redeem by mail, cut this coupon out, enter the discount amount in the “Coupon Discount” box on the order form, and attach the coupon to your order form.

Whether ordering online or by mail, only one coupon may be used per order.

This coupon may be used only once per customer. Canceling or revising an order may affect eligibility for the coupon.

Photocopies or other reproductions of this coupon will not be accepted. Coupons can only be redeemed against the items listed on the reverse. Items already heavily discounted (weekly specials, bargain bin items, closeout items, and specialty imports items) are excluded from coupon discounts. Orders which do not fulfi ll the terms of the coupon will be returned or accepted with request for additional payment, at our option.

If you have any questions about the use of this coupon, please email at [email protected], or call us at 1-800-338-6827.

This coupon is redeemable by mail or online at: www.rightstuf.com

To redeem online, simply enter the Coupon Code listed on the upper right corner of the front of this coupon into the “Coupon Code” box during your online check out.

To redeem by mail, cut this coupon out, enter the discount amount in the “Coupon Discount” box on the order form, and attach the coupon to your order form.

Whether ordering online or by mail, only one coupon may be used per order.

This coupon may be used only once per customer. Canceling or revising an order may affect eligibility for the coupon.

Photocopies or other reproductions of this coupon will not be accepted. Coupons can only be redeemed against the items COUPON DISCOUNT: listed on the reverse. Items already heavily discounted (weekly specials, bargain bin items, closeout items, and specialty METHOD OF PAYMENT (ONE COUPON PER ORDER) - imports items) are excluded from coupon discounts. Orders which do not fulfi ll the terms of the coupon will be returned or accepted with request for additional payment, at our option. Credit Card:  Discover  MasterCard  Visa  American Express GOT ANIME MEMBERSHIP DISCOUNT: - If you have any questions about the use of this coupon, please email at [email protected], or call us at 1-800-338-6827. (SEE PAGE 6 FOR DETAILS) SHIPPING TO AN IOWA ADDRESS? PLEASE ADD SALES TAX: For assistance, please contact Customer Service at 1-800-338-6827 This coupon is redeemable by mail or online at: www.rightstuf.com Name as it appears on card: To redeem online, simply enter the Coupon Code listed on the upper right corner of the front of this coupon into the SUBTOTAL: “Coupon Code” box during your online check out. Credit Card Number:

To redeem by mail, cut this coupon out, enter the discount amount in the “Coupon Discount” box on the order form, and U.S. ADDRESSES CANADIAN ADDRESSES attach the coupon to your order form. If your order exceeds $49, If your order exceeds $150, Whether ordering online or by mail, only one coupon may be used per order. Expiration Date: ECONOMY SHIPPING IS FREE! REGULAR SHIPPING IS FREE! This coupon may be used only once per customer. Canceling or revising an order may affect eligibility for the coupon.

Photocopies or other reproductions of this coupon will not be accepted. Coupons can only be redeemed against the items month year SHIPPING AND HANDLING CHARGES (SEE REVERSE): listed on the reverse. Items already heavily discounted (weekly specials, bargain bin items, closeout items, and specialty DOMESTIC:  Economy  USPS Standard imports items) are excluded from coupon discounts. Orders which do not fulfi ll the terms of the coupon will be returned or accepted with request for additional payment, at our option.  UPS Standard  UPS Express Signature: If you have any questions about the use of this coupon, please email at [email protected], or call us at 1-800-338-6827. INTERNATIONAL:  Canada  Other Countries

Other:  Check*  Money Order ORDER TOTAL: This coupon is redeemable by mail or online at: www.rightstuf.com *Right Stuf Inc. may present your check electronically to your financial institution for payment. In the event your check or If ordering adult product, I certify that I am at least 18 years old. To redeem online, simply enter the Coupon Code listed on the upper right corner of the front of this coupon into the electronic payment is returned unpaid for insufficient or uncollected funds, we may resubmit your payment electronically for the “Coupon Code” box during your online check out. face value of the payment, plus a service fee of $25, for each check or electronic payment that was returned unpaid. Signature: To redeem by mail, cut this coupon out, enter the discount amount in the “Coupon Discount” box on the order form, and By submitting your check to Right Stuf for payment of any kind, you acknowledge and agree to our check processing policy attach the coupon to your order form. and authorize us to utilize the information contained on your check to electronically collect the amount you have designated for payment and apply the funds collected to your order or customer account. Should you have questions about this policy or Date of Birth: / / Whether ordering online or by mail, only one coupon may be used per order. encounter any difficulties, please contact us immediately at (800) 338-6827. This coupon may be used only once per customer. Canceling or revising an order may affect eligibility for the coupon. WE ACCEPT CREDIT CARDS, CHECKS ON U.S. BANKS AND U.S. MONEY ORDERS. PLEASE DO NOT SEND CASH! Photocopies or other reproductions of this coupon will not be accepted. Coupons can only be redeemed against the items listed on the reverse. Items already heavily discounted (weekly specials, bargain bin items, closeout items, and specialty I found the following to be the most useful when placing my order: imports items) are excluded from coupon discounts. Orders which do not fulfi ll the terms of the coupon will be returned or (please check only one) Please Mail Completed Form To: accepted with request for additional payment, at our option.  Spring 2009 Catalog (S09M)  Website (R10I) If you have any questions about the use of this coupon, please email at [email protected], or call us at 1-800-338-6827. Right Stuf P.O. Box 680 Grimes, IA 50111  Fall 2009 Catalog (F09M)  Other: ______(R10M)  Spring 2010 Catalog (S10M) Or Fax To: (515) 986-1129 Billing Address Shipping Address (If paying by credit card, this address must match your credit card billing information.) (International customers must ship to their billing address. If using a credit card, we may contact you for additional information before your order will ship.)

GET FREE SHIPPING ON YOUR ORDER! Name: Name: If shipping to a U.S. address and your order exceeds $49 (without freight), then Economy Shipping is FREE! If shipping to a Canadian address and your order exceeds $150 (without freight), then Regular Shipping is FREE! Company: Company:

Domestic & Economy USPS Standard UPS Standard UPS Express Canada Other Countries Address: Address: (USPS Mail) (Priority Mail) (Ground) (2nd Day Air) (Sent via Mail) (Sent via Mail) (Suite/Apt #) (Suite/Apt #) International 4-14 Days 2-5 Days 2-5 Days 2 Days 1-2 Weeks** 2-3 Weeks** Shipping Options $3 for fi rst + $1 each $5 for fi rst + $1 each $7 for fi rst + $1 each $11 for fi rst + $2 each $7 for fi rst + $2 each $10 for fi rst + $2 each City: State/Prov: Zip: City: State/Prov: Zip: 1 item $3.00 $5.00 $7.00 $11.00 $7.00 $10.00

2 items $4.00 $6.00 $8.00 $13.00 $9.00 $12.00 Country: Phone: ( ) Country: Phone: ( ) 3 items $5.00 $7.00 $9.00 $15.00 $11.00 $14.00

4 items $6.00 $8.00 $10.00 $17.00 $13.00 $16.00 **International shipping times are approximate. Shipment time may vary due to customs inspections. Email: GIFT CERTIFICATES (Please provide an email address or daytime phone number in case we have questions about your order.) Now available in any whole dollar amount from $5 on up! Just add the item * number “GIFT CERTIFICATE” on this order form and write in the amount SHIPPING PAYMENT METHODS Got Anime Member?  Yes  No you’d like to give. Don’t forget to fill in the quantity! NOTE: Shipping charges Box Sets Domestic (U.S.) Orders *Remember: Your Got Anime membership is tied to your billing address. do not apply to gift certificates, Got Anime memberships or catalogs. Box sets are considered single items for shipping purposes. We accept checks and money orders in U.S. funds. Please make all checks / money orders payable to Right Stuf, Inc. All checks require ITEM# TITLE/DESCRIPTION (SIZE? COLOR?) PRICE QTY. TOTAL Shipment Time at least 12 days to clear our bank. Sorry, no CODs. PLEASE DO NOT Save Money! Add a Got Anime Savings Club Membership From the time we receive the order, standard processing time to ship it SEND CASH THROUGH THE MAIL! (See page 6 for more details.) is 24-48 hours. Express shipping means that your in stock item(s) will be We also accept the following credit cards: MasterCard, Visa, American shipped via 2 Business Day service. Express, and Discover. If paying by credit card, we may contact you to obtain additional details for security purposes. Shipment may be Actual shipment time can vary based on whether the item(s) is in-stock delayed until we have received the information necessary to complete at the time we receive your order. If an item(s) is on backorder, it can your order. take an average of 10-14 business days for us to receive it. Standard processing time then goes into effect. International Orders We accept money orders in U.S. funds. Please make all money orders Additional Shipment Options payable to Right Stuf, Inc. Sorry, we do not accept international checks. If you need your order delivered by a specifi c date, additional shipping PLEASE DO NOT SEND CASH THROUGH THE MAIL! options are available by phone (800-338-6827) or through our online store We also accept the following payment methods: MasterCard, Visa, (www.rightstuf.com). American Express, or Discover. For fi rst–time orders, we require a copy of some form of ID (driver’s license, passport, credit card statement, Shipments to Military Addresses & U.S. Protectorates utility bill, etc.), which shows your address along with a photocopy of In the U.S., including APO/FPO (AA, AE, AP), PR, GU and VI, please use BOTH THE FRONT AND BACK sides of your credit card. Right Stuf the Domestic Shipping Options. If you have a PO Box, or are stationed in can provide a secure website location for our international customers to the service, our standard shipping is via mail because UPS will not deliver submit this material. This information is destroyed after verifi cation. to these locations. If you live outside of the areas above, please use our International Shipping Options. RETURN POLICY If your merchandise is defective due to a fl aw in manufacturing, we are METHOD OF PAYMENT COUPON DISCOUNT: Shipments to International Customers (ONE COUPON PER ORDER) - more than happy to replace the product. Unopened DVDs and Blu-rays Shipping companies or local governments may charge an additional can be returned for Right Stuf store credit (or in the case of credit cards, fee for taxes or for delivering your package to your country. Such fees Credit Card:  Discover  MasterCard  Visa  American Express GOT ANIME MEMBERSHIP DISCOUNT: - refunded to the issuing card). All returns must be processed within 90 (SEE PAGE 6 FOR DETAILS) and customs duties are not included in our shipping price and are your days of the date on your purchase invoice. If you need to complete responsibility. We will not be responsible for seized shipments and cannot SHIPPING TO AN IOWA ADDRESS? PLEASE ADD SALES TAX: a return, please obtain a return authorization number from Customer provide refunds for seized products. Please check to make sure you are For assistance, please contact Customer Service at 1-800-338-6827 Service at 800-338-6827 or utilize our online return request form at: Name as it appears on card: in compliance with all local laws if you are ordering any adult product. SUBTOTAL: www.rightstuf.com/requestform Credit Card Number: Shipments to Commercial Addresses Products returned without a return authorization number, or those more U.S. ADDRESSES CANADIAN ADDRESSES Domestic (U.S.) customers may elect to have packages delivered to an than 90 days after the invoice date, will be returned to the customer, at our option. If your order exceeds $49, If your order exceeds $150, alternate work address. You must include the name of the business in Expiration Date: ECONOMY SHIPPING IS FREE! REGULAR SHIPPING IS FREE! the shipping address. If your package is returned to us, we will charge If your package was damaged (such as a crushed box) while in transit: you an additional shipment fee to reship it. if delivered by UPS, please contact UPS directly at (800)-PICK-UPS SHIPPING AND HANDLING CHARGES (SEE REVERSE): (1-800-742-5877). If delivered by Mail, please contact your local month year DOMESTIC:  Economy  USPS Standard Shipment Confi rmation postmaster.  UPS Standard  UPS Express Shipping confi rmations are often sent via email to the email address Signature: INTERNATIONAL:  Canada  Other Countries provided on the order form. Please make sure to write your email address COUPONS as clearly as possible. You may use one coupon per order. Some coupons and short-term Other:  Check*  Money Order ORDER TOTAL: deals, such as “Shawne’s Daily Deals,” can only be used through our Split Shipments *Right Stuf Inc. may present your check electronically to your financial institution for payment. In the event your check or If ordering adult product, I certify that I am at least 18 years old. website and cannot be honored for mail-in orders. Please see coupon electronic payment is returned unpaid for insufficient or uncollected funds, we may resubmit your payment electronically for the For domestic (U.S.) orders: We may, at our option, ship your order in details for specifi c restrictions. face value of the payment, plus a service fee of $25, for each check or electronic payment that was returned unpaid. multiple shipments. Please note that, in general, only shipments using the By submitting your check to Right Stuf for payment of any kind, you acknowledge and agree to our check processing policy Signature: economy ship method will receive partial shipments. Due to increased and authorize us to utilize the information contained on your check to electronically collect the amount you have designated for payment and apply the funds collected to your order or customer account. Should you have questions about this policy or Date of Birth: / / transportation costs, orders shipping by other methods or internationally ADDITIONAL ORDER FORMS encounter any difficulties, please contact us immediately at (800) 338-6827. may be held until the order is complete. You may request a shipment If you need additional order forms, you may make copies of this order WE ACCEPT CREDIT CARDS, CHECKS ON U.S. BANKS AND U.S. MONEY ORDERS. PLEASE DO NOT SEND CASH! of in-stock items at any time for an additional fee (based on the ship form. You can also print out additional forms from our website at: method you have selected) by contacting customer service. www.rightstuf.com/orderform I found the following to be the most useful when placing my order: (please check only one) Please Mail Completed Form To:  Spring 2009 Catalog (S09M)  Website (R10I) Right Stuf P.O. Box 680 Grimes, IA 50111  Fall 2009 Catalog (F09M)  Other: ______(R10M)  Spring 2010 Catalog (S10M) Or Fax To: (515) 986-1129 Billing Address Shipping Address (If paying by credit card, this address must match your credit card billing information.) (International customers must ship to their billing address. If using a credit card, we may contact you for additional information before your order will ship.)

GET FREE SHIPPING ON YOUR ORDER! Name: Name: If shipping to a U.S. address and your order exceeds $49 (without freight), then Economy Shipping is FREE! If shipping to a Canadian address and your order exceeds $150 (without freight), then Regular Shipping is FREE! Company: Company:

Domestic & Economy USPS Standard UPS Standard UPS Express Canada Other Countries Address: Address: (USPS Mail) (Priority Mail) (Ground) (2nd Day Air) (Sent via Mail) (Sent via Mail) (Suite/Apt #) (Suite/Apt #) International 4-14 Days 2-5 Days 2-5 Days 2 Days 1-2 Weeks** 2-3 Weeks** Shipping Options $3 for fi rst + $1 each $5 for fi rst + $1 each $7 for fi rst + $1 each $11 for fi rst + $2 each $7 for fi rst + $2 each $10 for fi rst + $2 each City: State/Prov: Zip: City: State/Prov: Zip: 1 item $3.00 $5.00 $7.00 $11.00 $7.00 $10.00

2 items $4.00 $6.00 $8.00 $13.00 $9.00 $12.00 Country: Phone: ( ) Country: Phone: ( ) 3 items $5.00 $7.00 $9.00 $15.00 $11.00 $14.00

4 items $6.00 $8.00 $10.00 $17.00 $13.00 $16.00 **International shipping times are approximate. Shipment time may vary due to customs inspections. Email: GIFT CERTIFICATES (Please provide an email address or daytime phone number in case we have questions about your order.) Now available in any whole dollar amount from $5 on up! Just add the item * number “GIFT CERTIFICATE” on this order form and write in the amount SHIPPING PAYMENT METHODS Got Anime Member?  Yes  No you’d like to give. Don’t forget to fill in the quantity! NOTE: Shipping charges Box Sets Domestic (U.S.) Orders *Remember: Your Got Anime membership is tied to your billing address. do not apply to gift certificates, Got Anime memberships or catalogs. Box sets are considered single items for shipping purposes. We accept checks and money orders in U.S. funds. Please make all checks / money orders payable to Right Stuf, Inc. All checks require ITEM# TITLE/DESCRIPTION (SIZE? COLOR?) PRICE QTY. TOTAL Shipment Time at least 12 days to clear our bank. Sorry, no CODs. PLEASE DO NOT Save Money! Add a Got Anime Savings Club Membership From the time we receive the order, standard processing time to ship it SEND CASH THROUGH THE MAIL! (See page 6 for more details.) is 24-48 hours. Express shipping means that your in stock item(s) will be We also accept the following credit cards: MasterCard, Visa, American shipped via 2 Business Day service. Express, and Discover. If paying by credit card, we may contact you to obtain additional details for security purposes. Shipment may be Actual shipment time can vary based on whether the item(s) is in-stock delayed until we have received the information necessary to complete at the time we receive your order. If an item(s) is on backorder, it can your order. take an average of 10-14 business days for us to receive it. Standard processing time then goes into effect. International Orders We accept money orders in U.S. funds. Please make all money orders Additional Shipment Options payable to Right Stuf, Inc. Sorry, we do not accept international checks. If you need your order delivered by a specifi c date, additional shipping PLEASE DO NOT SEND CASH THROUGH THE MAIL! options are available by phone (800-338-6827) or through our online store We also accept the following payment methods: MasterCard, Visa, (www.rightstuf.com). American Express, or Discover. For fi rst–time orders, we require a copy of some form of ID (driver’s license, passport, credit card statement, Shipments to Military Addresses & U.S. Protectorates utility bill, etc.), which shows your address along with a photocopy of In the U.S., including APO/FPO (AA, AE, AP), PR, GU and VI, please use BOTH THE FRONT AND BACK sides of your credit card. Right Stuf the Domestic Shipping Options. If you have a PO Box, or are stationed in can provide a secure website location for our international customers to the service, our standard shipping is via mail because UPS will not deliver submit this material. This information is destroyed after verifi cation. to these locations. If you live outside of the areas above, please use our International Shipping Options. RETURN POLICY If your merchandise is defective due to a fl aw in manufacturing, we are METHOD OF PAYMENT COUPON DISCOUNT: Shipments to International Customers (ONE COUPON PER ORDER) - more than happy to replace the product. Unopened DVDs and Blu-rays Shipping companies or local governments may charge an additional can be returned for Right Stuf store credit (or in the case of credit cards, fee for taxes or for delivering your package to your country. Such fees Credit Card:  Discover  MasterCard  Visa  American Express GOT ANIME MEMBERSHIP DISCOUNT: - refunded to the issuing card). All returns must be processed within 90 (SEE PAGE 6 FOR DETAILS) and customs duties are not included in our shipping price and are your days of the date on your purchase invoice. If you need to complete responsibility. We will not be responsible for seized shipments and cannot SHIPPING TO AN IOWA ADDRESS? PLEASE ADD SALES TAX: a return, please obtain a return authorization number from Customer provide refunds for seized products. Please check to make sure you are For assistance, please contact Customer Service at 1-800-338-6827 Service at 800-338-6827 or utilize our online return request form at: Name as it appears on card: in compliance with all local laws if you are ordering any adult product. SUBTOTAL: www.rightstuf.com/requestform Credit Card Number: Shipments to Commercial Addresses Products returned without a return authorization number, or those more U.S. ADDRESSES CANADIAN ADDRESSES Domestic (U.S.) customers may elect to have packages delivered to an than 90 days after the invoice date, will be returned to the customer, at our option. If your order exceeds $49, If your order exceeds $150, alternate work address. You must include the name of the business in Expiration Date: ECONOMY SHIPPING IS FREE! REGULAR SHIPPING IS FREE! the shipping address. If your package is returned to us, we will charge If your package was damaged (such as a crushed box) while in transit: you an additional shipment fee to reship it. if delivered by UPS, please contact UPS directly at (800)-PICK-UPS SHIPPING AND HANDLING CHARGES (SEE REVERSE): (1-800-742-5877). If delivered by Mail, please contact your local month year DOMESTIC:  Economy  USPS Standard Shipment Confi rmation postmaster.  UPS Standard  UPS Express Shipping confi rmations are often sent via email to the email address Signature: INTERNATIONAL:  Canada  Other Countries provided on the order form. Please make sure to write your email address COUPONS as clearly as possible. You may use one coupon per order. Some coupons and short-term Other:  Check*  Money Order ORDER TOTAL: deals, such as “Shawne’s Daily Deals,” can only be used through our Split Shipments *Right Stuf Inc. may present your check electronically to your financial institution for payment. In the event your check or If ordering adult product, I certify that I am at least 18 years old. website and cannot be honored for mail-in orders. Please see coupon electronic payment is returned unpaid for insufficient or uncollected funds, we may resubmit your payment electronically for the For domestic (U.S.) orders: We may, at our option, ship your order in details for specifi c restrictions. face value of the payment, plus a service fee of $25, for each check or electronic payment that was returned unpaid. multiple shipments. Please note that, in general, only shipments using the By submitting your check to Right Stuf for payment of any kind, you acknowledge and agree to our check processing policy Signature: economy ship method will receive partial shipments. Due to increased and authorize us to utilize the information contained on your check to electronically collect the amount you have designated for payment and apply the funds collected to your order or customer account. Should you have questions about this policy or Date of Birth: / / transportation costs, orders shipping by other methods or internationally ADDITIONAL ORDER FORMS encounter any difficulties, please contact us immediately at (800) 338-6827. may be held until the order is complete. You may request a shipment If you need additional order forms, you may make copies of this order WE ACCEPT CREDIT CARDS, CHECKS ON U.S. BANKS AND U.S. MONEY ORDERS. PLEASE DO NOT SEND CASH! of in-stock items at any time for an additional fee (based on the ship form. You can also print out additional forms from our website at: method you have selected) by contacting customer service. www.rightstuf.com/orderform I found the following to be the most useful when placing my order: (please check only one) Please Mail Completed Form To:  Spring 2009 Catalog (S09M)  Website (R10I) Right Stuf P.O. Box 680 Grimes, IA 50111  Fall 2009 Catalog (F09M)  Other: ______(R10M)  Spring 2010 Catalog (S10M) Or Fax To: (515) 986-1129 Blood Shadow © 2001 DISCOVERY/ZONE.