DOCSLIB.ORG

Supplementary File 1 (PDF, 295 Kib)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplementary File 1 (PDF, 295 Kib) Supplementary Material Table S1. Prognostic analysis (Log‐rank p‐values) of Autophagy related genes in LUAD patients. GENE OS DFS PFS DSS ATG12 0.14 0.38 0.38 0.01* ATG3 0.38 0.45 0.72 0.35 ATG4A 0.09 0.31 0.85 0.16 ATG4B 0.76 0.48 0.58 0.73 ATG4C 0.31 0.32 0.72 0.65 ATG4D 0.63 0.67 0.96 0.63 ATG5 0.25 0.55 0.46 0.82 ATG7 0.6 0.7 0.05 0.31 BECN1 0.71 0.62 0.59 0.75 BECN2 NA NA NA NA GABARAP 0.54 0.88 0.3 0.25 GABARAPL1 0.001* 0.27 0.001* 0.001* GABARAPL2 0.71 0.35 0.08 0.71 IFNA1 0.12 0.95 0.53 0.07 IFNA10 0.27 0.87 0.53 0.36 IFNA13 0.08 0.38 0.58 0.13 IFNA14 0.62 0.64 0.32 0.56 IFNA16 0.31 0.06 0.44 0.26 IFNA17 0.48 0.01* 0.11 0.57 IFNA2 0.57 0.46 0.28 0.98 IFNA21 0.65 0.72 0.89 0.63 IFNA4 0.18 0.91 0.12 0.18 IFNA5 0.55 0.35 0.47 0.96 IFNA6 NA NA NA NA IFNA7 NA NA NA NA IFNA8 0.01* 0.58 0.01* 0.01* IFNG 0.39 0.24 0.1 0.58 INS 0.45 0.52 0.4 NA PIK3C3 0.73 0.45 0.69 0.44 PIK3R4 0.88 0.45 0.31 0.68 PRKAA1 0.61 0.64 0.65 0.69 PRKAA2 0.37 0.22 0.34 0.3 ULK1 0.81 0.52 0.84 0.55 ULK2 0.74 0.22 0.06 0.93 Table S2. Prognostic analysis (Log‐rank p‐values) of Apoptosis related genes in LUAD patients. Gene OS DFS PFS DSS AIFM1 0.93 0.64 0.18 0.44 AKT1 0.93 0.52 0.88 0.95 AKT2 0.77 0.71 0.22 0.23 AKT3 0.1 0.29 0.61 0.58 APAF1 0.29 0.64 0.4 0.08 ATM 0.44 0.96 0.58 0.53 BAD 0.41 0.25 0.62 0.79 BAX 0.02* 0.75 0.19 0.05* BCL2 0.56 0.19 0.23 0.99 BCL2L1 0.01* 0.01* 0.01* 0.01* BID 0.69 0.78 0.8 0.39 BIRC2 0.15 0.17 0.12 0.14 BIRC3 0.01* 0.68 0.01* 0.01* CAPN1 0.59 0.22 0.41 0.06 CAPN2 0.48 0.4 0.92 0.61 CASP10 0.19 0.33 0.44 0.89 Cancers 2021, 13, 155. doi:10.3390/cancers13010155 www.mdpi.com/journal/cancers Cancers 2021, 13, 155 2 of 20 CASP3 0.85 0.93 0.77 0.86 CASP6 0.43 0.26 0.42 0.34 CASP7 0.95 0.74 0.37 0.41 CASP8 0.67 0.31 0.06 0.27 CASP9 0.01* 0.94 0.01* 0.01* CFLAR 0.77 0.47 0.67 0.78 CHP1 0.65 0.19 0.84 0.47 CHP2 0.01* 0.16 0.41 0.05* CHUK 0.25 0.39 0.61 0.31 CSF2RB 0.11 0.15 0.49 0.35 CYCS 0.04* 0.68 0.03* 0.04* DFFA 0.84 0.98 0.5 0.31 DFFB 0.96 0.33 0.54 0.63 ENDOD1 0.33 0.49 0.89 0.28 ENDOG 0.75 0.95 0.93 0.52 EXOG 0.41 0.05* 0.02* 0.35 FADD 0.1 0.49 0.03* 0.01* FAS 0.05* 0.05* 0.06 0.01* FASLG 0.1 0.52 0.93 0.13 IKBKB 0.58 0.96 0.44 0.33 IKBKG 0.07 0.36 0.5 0.11 IL1A 0.01* 0.01* 0.01* 0.06 IL1B 0.22 0.38 0.3 0.29 IL1R1 0.3 0.3 0.01* 0.4 IL1RAP 0.09 0.01* 0.3 0.58 IL3 0.64 0.79 0.98 0.34 IL3RA 0.01* 0.1 0.32 0.07 IRAK1 0.87 0.62 0.77 0.42 IRAK2 0.82 0.81 0.58 0.52 IRAK3 0.94 0.7 0.92 0.84 MAP3K14 0.84 0.34 0.58 0.54 MYD88 0.45 0.19 0.59 0.56 NFKB1 0.54 0.98 0.26 0.78 NFKBIA 0.31 0.06 0.02* 0.72 NGF 0.38 0.54 0.83 0.53 NTRK1 0.45 0.06 0.38 0.12 PIK3CA 0.02* 0.3 0.1 0.29 PIK3CB 0.54 0.45 0.99 0.6 PIK3CD 0.44 0.01* 0.07 0.63 PIK3CG 0.01* 0.03* 0.04* 0.03* PIK3R1 0.26 0.17 0.03* 0.43 PIK3R2 0.03* 0.46 0.62 0.13 PIK3R3 0.64 0.68 0.67 0.73 PIK3R5 0.09 0.34 0.75 0.1 PPP3CA 0.27 0.1 0.73 0.79 PPP3CB 0.69 0.37 0.83 0.83 PPP3CC 0.86 0.92 0.24 0.34 PPP3R1 0.76 0.64 0.93 0.51 PPP3R2 0.65 0.53 0.99 0.17 PRKACA 0.6 0.5 0.69 0.73 PRKACB 0.94 0.28 0.56 0.83 PRKACG 0.97 0.96 0.75 0.84 PRKAR1A 0.41 0.93 0.21 0.41 PRKAR1B 0.04* 0.45 0.17 0.09 PRKAR2A 0.93 0.21 0.18 0.78 PRKAR2B 0.79 0.72 0.84 0.69 PRKX 0.41 0.43 0.73 0.58 RELA 0.17 0.62 0.2 0.15 RIPK1 0.34 0.64 0.29 0.26 TNF 0.44 0.68 0.32 0.71 TNFRSF10A 0.93 0.02* 0.25 0.64 TNFRSF10B 0.01* 0.11 0.19 0.09 TNFRSF10C 0.07 0.73 0.35 0.03* Cancers 2021, 13, 155 3 of 20 TNFRSF10D 0.03* 0.04* 0.01* 0.11 TNFRSF1A 0.01* 0.98 0.01* 0.05* TNFSF10 0.79 0.4 0.79 0.71 TP53 0.7 0.24 0.92 0.48 TRADD 0.68 0.11 0.47 0.76 TRAF2 0.35 0.73 0.82 0.99 XIAP 0.9 0.07 0.18 0.95 Table S3. Prognostic analysis (Log‐rank p‐values) of Necrosis related genes in LUAD patients. Gene OS DFS PFS DSS BAX 0.02* 0.75 0.19 0.05* BIRC2 0.15 0.17 0.12 0.14 BIRC3 0.01* 0.68 0.01* 0.01* CASP8 0.67 0.31 0.06 0.27 CFLAR 0.77 0.47 0.67 0.78 FADD 0.1 0.49 0.03* 0.01* FAS 0.05* 0.05* 0.06 0.01* FASLG 0.1 0.52 0.93 0.13 RIPK1 0.34 0.64 0.29 0.26 TNF 0.44 0.68 0.32 0.71 TP53 0.7 0.24 0.92 0.48 TRAF2 0.35 0.73 0.82 0.99 ALKBH7 0.72 0.14 0.08 0.58 ARHGEF2 0.74 0.58 0.25 0.33 BNIP3 0.18 0.9 0.15 0.18 BOK 0.45 0.83 0.72 0.36 CAV1 0.35 0.84 0.22 0.12 CD14 0.19 0.28 0.62 0.28 CYLD 0.89 0.34 0.7 0.82 DNM1L 0.04* 0.07 0.03* 0.01* FZD9 0.78 0.73 0.79 0.69 GSDME 0.04* 0.01* 0.01* 0.01* HEBP2 0.54 0.32 0.28 0.91 IPMK 0.01* 0.53 0.22 0.01* IRF3 0.39 0.28 0.31 0.39 ITPK1 0.16 0.23 0.93 0.63 LY96 0.46 0.21 0.75 0.83 MAP3K5 0.52 0.84 0.49 0.38 MLKL 0.01* 0.55 0.44 0.48 MT‐CO2 NA NA NA NA MT3 0.14 0.69 0.94 0.43 MTCO2P12 NA NA NA NA PELI1 0.81 0.95 0.62 0.84 PGAM5 0.56 0.26 0.29 0.53 PPIF 0.3 0.54 0.87 0.68 PYGL 0.13 0.94 0.81 0.99 RBCK1 0.01* 0.42 0.31 0.07 RIPK3 0.79 0.6 0.19 0.68 SLC25A4 0.86 0.93 0.3 0.98 SPATA2 0.89 0.78 0.27 0.75 TICAM1 0.01* 0.33 0.28 0.01* TICAM2 0.63 0.65 0.5 0.29 TLR3 0.85 0.47 0.58 0.48 TLR4 0.09 0.4 0.51 0.13 TMEM123 0.75 0.57 0.89 0.48 TRPM7 0.89 0.48 0.7 0.42 TSPO 0.43 0.73 0.72 0.4 UCN 0.65 0.55 0.72 0.68 YBX3 0.01* 0.64 0.18 0.13 Cancers 2021, 13, 155 4 of 20 Table S4. Upregulated (329 genes) expressed at > 2‐fold in high risk group.
Load more

Recommended publications
  • Screening and Identification of Key Biomarkers in Clear Cell Renal Cell Carcinoma Based on Bioinformatics Analysis
    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Screening and identification of key biomarkers in clear cell renal cell carcinoma based on bioinformatics analysis Basavaraj Vastrad1, Chanabasayya Vastrad*2 , Iranna Kotturshetti 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. 3. Department of Ayurveda, Rajiv Gandhi Education Society`s Ayurvedic Medical College, Ron, Karnataka 562209, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Clear cell renal cell carcinoma (ccRCC) is one of the most common types of malignancy of the urinary system. The pathogenesis and effective diagnosis of ccRCC have become popular topics for research in the previous decade. In the current study, an integrated bioinformatics analysis was performed to identify core genes associated in ccRCC. An expression dataset (GSE105261) was downloaded from the Gene Expression Omnibus database, and included 26 ccRCC and 9 normal kideny samples. Assessment of the microarray dataset led to the recognition of differentially expressed genes (DEGs), which was subsequently used for pathway and gene ontology (GO) enrichment analysis.
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen GJB5
    PrEST Antigen GJB5 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen GJB5 Product Number APrEST78107 Gene Description gap junction protein, beta 5, 31.1kDa Alternative Gene CX31.1 Names Corresponding Anti-GJB5 (HPA038146) Antibodies Description Recombinant protein fragment of Human GJB5 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLL PDRPRDHVKK Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 24 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • A Fratricide-Resistant Allogeneic CAR T
    Investigation of ALLO-316: A Fratricide- Resistant Allogeneic CAR T Targeting CD70 As a Potential Therapy for the Treatment of AML Surabhi Srinivasan, Nguyen Tan, Hsin-Yuan Cheng, Yi Zhang, Silvia Tacheva-Grigorova, Tom Van Blarcom, Cesar Sommer, Duy Nguyen , Barbra Sasu, and Siler Panowski 1 Disclosures • Full-time employee of Allogene Therapeutics • Equity interest in Allogene Therapeutics ALLO-316 (CD70) utilizes TALEN® gene-editing technology pioneered and owned by Cellectis. Allogene has an exclusive license to the Cellectis technology for allogeneic products directed at this target and holds all global development and commercial rights for this investigational candidate. 22 CONFIDENTIAL Disclaimers This presentation is not intended for product promotion. All information is related to investigational therapies not available for commercial use. The safety and efficacy of the therapies have not been established for FDA approval. Forward-Looking Statements To the extent statements contained in this Presentation are not descriptions of historical facts regarding Allogene Therapeutics, Inc. (“Allogene,” “we,” “us,” or “our”), they are forward-looking statements reflecting management’s current beliefs and expectations. Forward-looking statements are subject to known and unknown risks, uncertainties, and other factors that may cause our or our industry’s actual results, levels or activity, performance, or achievements to be materially different from those anticipated by such statements. You can identify forward-looking statements by words such as “anticipate,” “believe,” “could,” “estimate,” “expect,” “intend,” “may,” “plan,” “potential,” “predict,” “project,” “should,” “will,” “would” or the negative of those terms, and similar expressions that convey uncertainty of future events or outcomes. Forward-looking statements contained in this Presentation include, but are not limited to, statements regarding: the ability to progress the clinical development of allogeneic CAR T (AlloCAR T™) therapies and the potential benefits of AlloCAR T™ therapy, including ALLO-316.
    [Show full text]
  • Dissecting Signaling and Functions of Adhesion G Proteincoupled Receptors
    Ann. N.Y. Acad. Sci. ISSN 0077-8923 ANNALS OF THE NEW YORK ACADEMY OF SCIENCES Issue: Annals Meeting Reports Dissecting signaling and functions of adhesion G protein–coupled receptors Demet Arac¸,1 Gabriela Aust,2 Davide Calebiro,3 Felix B. Engel,4 Caroline Formstone,5 Andre´ Goffinet,6 Jorg¨ Hamann,7 Robert J. Kittel,8 Ines Liebscher,9 Hsi-Hsien Lin,10 Kelly R. Monk,11 Alexander Petrenko,12 Xianhua Piao,13 Simone Promel,¨ 9 HelgiB.Schioth,¨ 14 Thue W. Schwartz,15 Martin Stacey,16 Yuri A. Ushkaryov,17 Manja Wobus,18 Uwe Wolfrum,19 Lei Xu,20 and Tobias Langenhan8 1Stanford University, Stanford, California. 2Department of Surgery, Research Laboratories, University of Leipzig, Leipzig, Germany. 3Institute of Pharmacology and Rudolf Virchow Center, DFG-Research Center for Experimental Biomedicine, University of Wurzburg,¨ Wurzburg,¨ Germany. 4Department of Cardiac Development and Remodelling, Max-Planck-Institute for Heart and Lung Research, Bad Nauheim, Germany, and Laboratory of Experimental Renal and Cardiovascular Research, Department of Nephropathology, Institute of Pathology, University of Erlangen-Nurnberg,¨ Erlangen, Germany. 5MRC Centre for Developmental Neurobiology, King’s College London, New Hunts House, London, United Kingdom. 6Universite´ Catholique de Louvain, Institute of Neuroscience, Developmental Neurobiology, Brussels, Belgium. 7Department of Experimental Immunology, Academic Medical Center, University of Amsterdam, Amsterdam, The Netherlands. 8Institute of Physiology, Department of Neurophysiology, University of Wurzburg,¨ Wurzburg,¨ Germany. 9Institute of Biochemistry, Molecular Biochemistry, Medical Faculty, University of Leipzig, Leipzig, Germany. 10Department of Microbiology and Immunology, College of Medicine, Chang Gung University, Tao-Yuan, Taiwan. 11Department of Developmental Biology, Washington University School of Medicine, St. Louis, Missouri. 12Shemyakin-Ovchinnikov Institute of Bioorganic Chemistry, Moscow, Russia.
    [Show full text]
  • Aquaporin Channels in the Heart—Physiology and Pathophysiology
    International Journal of Molecular Sciences Review Aquaporin Channels in the Heart—Physiology and Pathophysiology Arie O. Verkerk 1,2,* , Elisabeth M. Lodder 2 and Ronald Wilders 1 1 Department of Medical Biology, Amsterdam University Medical Centers, University of Amsterdam, 1105 AZ Amsterdam, The Netherlands; [email protected] 2 Department of Experimental Cardiology, Amsterdam University Medical Centers, University of Amsterdam, 1105 AZ Amsterdam, The Netherlands; [email protected] * Correspondence: [email protected]; Tel.: +31-20-5664670 Received: 29 March 2019; Accepted: 23 April 2019; Published: 25 April 2019 Abstract: Mammalian aquaporins (AQPs) are transmembrane channels expressed in a large variety of cells and tissues throughout the body. They are known as water channels, but they also facilitate the transport of small solutes, gasses, and monovalent cations. To date, 13 different AQPs, encoded by the genes AQP0–AQP12, have been identified in mammals, which regulate various important biological functions in kidney, brain, lung, digestive system, eye, and skin. Consequently, dysfunction of AQPs is involved in a wide variety of disorders. AQPs are also present in the heart, even with a specific distribution pattern in cardiomyocytes, but whether their presence is essential for proper (electro)physiological cardiac function has not intensively been studied. This review summarizes recent findings and highlights the involvement of AQPs in normal and pathological cardiac function. We conclude that AQPs are at least implicated in proper cardiac water homeostasis and energy balance as well as heart failure and arsenic cardiotoxicity. However, this review also demonstrates that many effects of cardiac AQPs, especially on excitation-contraction coupling processes, are virtually unexplored.
    [Show full text]
  • Edinburgh Research Explorer
    Edinburgh Research Explorer International Union of Basic and Clinical Pharmacology. LXXXVIII. G protein-coupled receptor list Citation for published version: Davenport, AP, Alexander, SPH, Sharman, JL, Pawson, AJ, Benson, HE, Monaghan, AE, Liew, WC, Mpamhanga, CP, Bonner, TI, Neubig, RR, Pin, JP, Spedding, M & Harmar, AJ 2013, 'International Union of Basic and Clinical Pharmacology. LXXXVIII. G protein-coupled receptor list: recommendations for new pairings with cognate ligands', Pharmacological reviews, vol. 65, no. 3, pp. 967-86. https://doi.org/10.1124/pr.112.007179 Digital Object Identifier (DOI): 10.1124/pr.112.007179 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: Pharmacological reviews Publisher Rights Statement: U.S. Government work not protected by U.S. copyright General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 02. Oct. 2021 1521-0081/65/3/967–986$25.00 http://dx.doi.org/10.1124/pr.112.007179 PHARMACOLOGICAL REVIEWS Pharmacol Rev 65:967–986, July 2013 U.S.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Emerging Roles for Multifunctional Ion Channel Auxiliary Subunits in Cancer T ⁎ Alexander S
    Cell Calcium 80 (2019) 125–140 Contents lists available at ScienceDirect Cell Calcium journal homepage: www.elsevier.com/locate/ceca Emerging roles for multifunctional ion channel auxiliary subunits in cancer T ⁎ Alexander S. Hawortha,b, William J. Brackenburya,b, a Department of Biology, University of York, Heslington, York, YO10 5DD, UK b York Biomedical Research Institute, University of York, Heslington, York, YO10 5DD, UK ARTICLE INFO ABSTRACT Keywords: Several superfamilies of plasma membrane channels which regulate transmembrane ion flux have also been Auxiliary subunit shown to regulate a multitude of cellular processes, including proliferation and migration. Ion channels are Cancer typically multimeric complexes consisting of conducting subunits and auxiliary, non-conducting subunits. Calcium channel Auxiliary subunits modulate the function of conducting subunits and have putative non-conducting roles, further Chloride channel expanding the repertoire of cellular processes governed by ion channel complexes to processes such as trans- Potassium channel cellular adhesion and gene transcription. Given this expansive influence of ion channels on cellular behaviour it Sodium channel is perhaps no surprise that aberrant ion channel expression is a common occurrence in cancer. This review will − focus on the conducting and non-conducting roles of the auxiliary subunits of various Ca2+,K+,Na+ and Cl channels and the burgeoning evidence linking such auxiliary subunits to cancer. Several subunits are upregu- lated (e.g. Cavβ,Cavγ) and downregulated (e.g. Kvβ) in cancer, while other subunits have been functionally implicated as oncogenes (e.g. Navβ1,Cavα2δ1) and tumour suppressor genes (e.g. CLCA2, KCNE2, BKγ1) based on in vivo studies. The strengthening link between ion channel auxiliary subunits and cancer has exposed these subunits as potential biomarkers and therapeutic targets.
    [Show full text]
  • Despite Differential Gene Expression Profiles Pediatric MDS Derived Mesenchymal Stromal Cells Display Functionality in Vitro☆ F.G.J
    Stem Cell Research (2015) 14, 198-210 Available online at www.sciencedirect.com ScienceDirect www.elsevier.com/locate/scr Despite differential gene expression profiles pediatric MDS derived mesenchymal stromal cells display functionality in vitro☆ F.G.J. Calkoen a,⁎, C. Vervat a, M. van Pel b, V. de Haas c, L.S. Vijfhuizen d, E. Eising d, W.G.M. Kroes e, P.A.C. 't Hoen d, M.M. van den Heuvel-Eibrink c,f, R.M. Egeler a,g, M.J.D. van Tol a, L.M. Ball a a Department of Pediatrics, Section Immunology, Hematology/Oncology and Hematopoietic Stem Cell Transplantation, Leiden University Medical Center, Leiden, The Netherlands b Department of Immunohematology and Blood Transfusion, Leiden University Medical Center, Leiden, The Netherlands c Dutch Childhood Oncology Group (DCOG), The Hague, The Netherlands d Department of Human Genetics, Leiden University Medical Center, Leiden, The Netherlands e Laboratory for Diagnostic Genome Analysis, Leiden University Medical Center, Leiden, The Netherlands f Department of Pediatric Oncology/Hematology, Erasmus MC-Sophia Children's Hospital, Rotterdam, The Netherlands g Department of Hematology/Oncology and Hematopoietic Stem Cell Transplantation, Hospital for Sick Children, University of Toronto, Toronto, Canada Received 24 June 2014; received in revised form 3 December 2014; accepted 19 January 2015 Available online 28 January 2015 Abstract Pediatric myelodysplastic syndrome (MDS) is a heterogeneous disease covering a spectrum ranging from aplasia (RCC) to myeloproliferation (RAEB(t)). In adult-type MDS there is increasing evidence for abnormal function of the bone-marrow microenvironment. Here, we extensively studied the mesenchymal stromal cells (MSCs) derived from children with MDS.
    [Show full text]
  • Transcriptomic Analysis of Native Versus Cultured Human and Mouse Dorsal Root Ganglia Focused on Pharmacological Targets Short
    bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Transcriptomic analysis of native versus cultured human and mouse dorsal root ganglia focused on pharmacological targets Short title: Comparative transcriptomics of acutely dissected versus cultured DRGs Andi Wangzhou1, Lisa A. McIlvried2, Candler Paige1, Paulino Barragan-Iglesias1, Carolyn A. Guzman1, Gregory Dussor1, Pradipta R. Ray1,#, Robert W. Gereau IV2, # and Theodore J. Price1, # 1The University of Texas at Dallas, School of Behavioral and Brain Sciences and Center for Advanced Pain Studies, 800 W Campbell Rd. Richardson, TX, 75080, USA 2Washington University Pain Center and Department of Anesthesiology, Washington University School of Medicine # corresponding authors [email protected], [email protected] and [email protected] Funding: NIH grants T32DA007261 (LM); NS065926 and NS102161 (TJP); NS106953 and NS042595 (RWG). The authors declare no conflicts of interest Author Contributions Conceived of the Project: PRR, RWG IV and TJP Performed Experiments: AW, LAM, CP, PB-I Supervised Experiments: GD, RWG IV, TJP Analyzed Data: AW, LAM, CP, CAG, PRR Supervised Bioinformatics Analysis: PRR Drew Figures: AW, PRR Wrote and Edited Manuscript: AW, LAM, CP, GD, PRR, RWG IV, TJP All authors approved the final version of the manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Targeting TSLP-Induced Tyrosine Kinase Signaling Pathways in CRLF2-Rearranged Ph-Like ALL Keith C.S
    Published OnlineFirst August 14, 2020; DOI: 10.1158/1541-7786.MCR-19-1098 MOLECULAR CANCER RESEARCH | CANCER GENES AND NETWORKS Targeting TSLP-Induced Tyrosine Kinase Signaling Pathways in CRLF2-Rearranged Ph-like ALL Keith C.S. Sia1, Ling Zhong2, Chelsea Mayoh1, Murray D. Norris1,3, Michelle Haber1, Glenn M. Marshall1,4, Mark J. Raftery2, and Richard B. Lock1,3 ABSTRACT ◥ Philadelphia (Ph)-like acute lymphoblastic leukemia (ALL) is combination cytotoxicity assays using the tyrosine kinase inhi- characterized by aberrant activation of signaling pathways and bitors BMS-754807 and ponatinib that target IGF1R and FGFR1, high risk of relapse. Approximately 50% of Ph-like ALL cases respectively, revealed strong synergy against both cell line and overexpress cytokine receptor-like factor 2 (CRLF2) associated patient-derived xenograft (PDX) models of CRLF2r Ph-like ALL. with gene rearrangement. Activated by its ligand thymic stromal Further analyses also indicated off-target effects of ponatinib in lymphopoietin (TSLP), CRLF2 signaling is critical for the devel- the synergy, and novel association of the Ras-associated protein- opment, proliferation, and survival of normal lymphocytes. To 1 (Rap1) signaling pathway with TSLP signaling in CRLF2r Ph- examine activation of tyrosine kinases regulated by TSLP/CRLF2, like ALL. When tested in vivo, the BMS-754807/ponatinib com- phosphotyrosine (P-Tyr) profiling coupled with stable isotope bination exerted minimal efficacy against 2 Ph-like ALL PDXs, labeling of amino acids in cell culture (SILAC) was conducted associated with low achievable plasma drug concentrations. using two CRLF2-rearranged (CRLF2r) Ph-like ALL cell lines Although this study identified potential new targets in CRLF2r stimulated with TSLP.
    [Show full text]
  • Supplemental Materials ZNF281 Enhances Cardiac Reprogramming
    Supplemental Materials ZNF281 enhances cardiac reprogramming by modulating cardiac and inflammatory gene expression Huanyu Zhou, Maria Gabriela Morales, Hisayuki Hashimoto, Matthew E. Dickson, Kunhua Song, Wenduo Ye, Min S. Kim, Hanspeter Niederstrasser, Zhaoning Wang, Beibei Chen, Bruce A. Posner, Rhonda Bassel-Duby and Eric N. Olson Supplemental Table 1; related to Figure 1. Supplemental Table 2; related to Figure 1. Supplemental Table 3; related to the “quantitative mRNA measurement” in Materials and Methods section. Supplemental Table 4; related to the “ChIP-seq, gene ontology and pathway analysis” and “RNA-seq” and gene ontology analysis” in Materials and Methods section. Supplemental Figure S1; related to Figure 1. Supplemental Figure S2; related to Figure 2. Supplemental Figure S3; related to Figure 3. Supplemental Figure S4; related to Figure 4. Supplemental Figure S5; related to Figure 6. Supplemental Table S1. Genes included in human retroviral ORF cDNA library. Gene Gene Gene Gene Gene Gene Gene Gene Symbol Symbol Symbol Symbol Symbol Symbol Symbol Symbol AATF BMP8A CEBPE CTNNB1 ESR2 GDF3 HOXA5 IL17D ADIPOQ BRPF1 CEBPG CUX1 ESRRA GDF6 HOXA6 IL17F ADNP BRPF3 CERS1 CX3CL1 ETS1 GIN1 HOXA7 IL18 AEBP1 BUD31 CERS2 CXCL10 ETS2 GLIS3 HOXB1 IL19 AFF4 C17ORF77 CERS4 CXCL11 ETV3 GMEB1 HOXB13 IL1A AHR C1QTNF4 CFL2 CXCL12 ETV7 GPBP1 HOXB5 IL1B AIMP1 C21ORF66 CHIA CXCL13 FAM3B GPER HOXB6 IL1F3 ALS2CR8 CBFA2T2 CIR1 CXCL14 FAM3D GPI HOXB7 IL1F5 ALX1 CBFA2T3 CITED1 CXCL16 FASLG GREM1 HOXB9 IL1F6 ARGFX CBFB CITED2 CXCL3 FBLN1 GREM2 HOXC4 IL1F7
    [Show full text]